Symbol:
Wdr43
Name:
WD repeat domain 43
RGD ID:
1565005
Description:
Predicted to enable RNA polymerase II complex binding activity and transcription elongation factor activity. Predicted to be involved in maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA); regulation of RNA metabolic process; and regulation of stem cell population maintenance. Predicted to be located in chromatin; fibrillar center; and nucleoplasm. Predicted to be part of small-subunit processome. Predicted to be active in nucleolus. Orthologous to human WDR43 (WD repeat domain 43); PARTICIPATES IN ribosome biogenesis pathway; INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 3-chloropropane-1,2-diol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LOC362703; MGC116335; similar to WD-repeat protein 43; WD repeat-containing protein 43
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
WDR43 (WD repeat domain 43) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Wdr43 (WD repeat domain 43) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Wdr43 (WD repeat domain 43) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
WDR43 (WD repeat domain 43) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
WDR43 (WD repeat domain 43) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Wdr43 (WD repeat domain 43) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
WDR43 (WD repeat domain 43) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
WDR43 (WD repeat domain 43) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Wdr43 (WD repeat domain 43) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
FUCA2 (alpha-L-fucosidase 2) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
WDR43 (WD repeat domain 43)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Wdr43 (WD repeat domain 43)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
wdr43 (WD repeat domain 43)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG30349
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
T10B5.3
Alliance
DIOPT (OrthoFinder|OrthoInspector|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):
UTP5
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 29,565,610 - 29,604,954 (-) NCBI GRCr8 mRatBN7.2 6 23,845,499 - 23,884,846 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 23,845,499 - 23,884,846 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 24,145,107 - 24,184,448 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 24,460,981 - 24,500,322 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 23,949,165 - 23,988,264 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 23,433,532 - 23,473,179 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 23,433,532 - 23,473,169 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 33,299,540 - 33,339,177 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 23,950,923 - 23,990,272 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 6 23,344,770 - 23,384,117 (-) NCBI Celera Cytogenetic Map 6 q14 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Wdr43 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of WDR43 mRNA] CTD PMID:31150632 Wdr43 Rat 1,2-dimethylhydrazine increases expression ISO Wdr43 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of WDR43 mRNA CTD PMID:22206623 Wdr43 Rat 1,2-dimethylhydrazine multiple interactions ISO Wdr43 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of WDR43 mRNA] CTD PMID:22206623 Wdr43 Rat 17beta-estradiol increases expression ISO WDR43 (Homo sapiens) 6480464 Estradiol results in increased expression of WDR43 mRNA CTD PMID:23019147 and PMID:31614463 Wdr43 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO WDR43 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Wdr43 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Wdr43 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of WDR43 mRNA CTD PMID:19770486 Wdr43 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of WDR43 mRNA CTD PMID:21215274 Wdr43 Rat 2,4,6-tribromophenol decreases expression ISO WDR43 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Wdr43 Rat 2-hydroxypropanoic acid increases expression ISO WDR43 (Homo sapiens) 6480464 Lactic Acid results in increased expression of WDR43 mRNA CTD PMID:30851411 Wdr43 Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO WDR43 (Homo sapiens) 6480464 tetrabromobisphenol A results in decreased expression of WDR43 protein CTD PMID:31675489 Wdr43 Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of WDR43 protein CTD PMID:34915118 Wdr43 Rat 4,4'-sulfonyldiphenol increases expression ISO Wdr43 (Mus musculus) 6480464 bisphenol S results in increased expression of WDR43 mRNA CTD PMID:39298647 Wdr43 Rat 4-hydroxyphenyl retinamide increases expression ISO Wdr43 (Mus musculus) 6480464 Fenretinide results in increased expression of WDR43 mRNA CTD PMID:28973697 Wdr43 Rat acrolein multiple interactions ISO WDR43 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of WDR43 mRNA more ... CTD PMID:32699268 and PMID:32845096 Wdr43 Rat aflatoxin B1 affects expression ISO WDR43 (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of WDR43 protein CTD PMID:20106945 Wdr43 Rat aflatoxin B1 increases expression ISO WDR43 (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of WDR43 mRNA CTD PMID:27153756 Wdr43 Rat alpha-pinene multiple interactions ISO WDR43 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of WDR43 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of WDR43 mRNA CTD PMID:32699268 Wdr43 Rat antimycin A increases expression ISO WDR43 (Homo sapiens) 6480464 Antimycin A results in increased expression of WDR43 mRNA CTD PMID:33512557 Wdr43 Rat aristolochic acid A decreases expression ISO WDR43 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of WDR43 mRNA CTD PMID:33212167 Wdr43 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of WDR43 mRNA CTD PMID:25181051 more ... Wdr43 Rat bisphenol A decreases expression ISO WDR43 (Homo sapiens) 6480464 bisphenol A results in decreased expression of WDR43 protein CTD PMID:31675489 and PMID:37567409 Wdr43 Rat bisphenol A decreases expression ISO Wdr43 (Mus musculus) 6480464 bisphenol A results in decreased expression of WDR43 mRNA CTD PMID:33221593 Wdr43 Rat bisphenol A affects expression ISO WDR43 (Homo sapiens) 6480464 bisphenol A affects the expression of WDR43 mRNA CTD PMID:30903817 Wdr43 Rat cadmium dichloride decreases expression ISO WDR43 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of WDR43 mRNA CTD PMID:38568856 Wdr43 Rat caffeine decreases expression EXP 6480464 Caffeine results in decreased expression of WDR43 mRNA CTD PMID:20864626 Wdr43 Rat carbon nanotube increases expression ISO Wdr43 (Mus musculus) 6480464 Nanotubes and Carbon results in increased expression of WDR43 mRNA CTD PMID:25554681 Wdr43 Rat chlorpyrifos decreases expression ISO Wdr43 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of WDR43 mRNA CTD PMID:37019170 Wdr43 Rat cisplatin decreases expression ISO WDR43 (Homo sapiens) 6480464 Cisplatin results in decreased expression of WDR43 mRNA CTD PMID:27594783 Wdr43 Rat cobalt dichloride increases expression EXP 6480464 cobaltous chloride results in increased expression of WDR43 mRNA CTD PMID:24386269 Wdr43 Rat coumarin affects phosphorylation ISO WDR43 (Homo sapiens) 6480464 coumarin affects the phosphorylation of WDR43 protein CTD PMID:35688186 Wdr43 Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of WDR43 mRNA CTD PMID:26577399 Wdr43 Rat cyclosporin A increases expression ISO WDR43 (Homo sapiens) 6480464 Cyclosporine results in increased expression of WDR43 mRNA CTD PMID:20106945 and PMID:25562108 Wdr43 Rat cylindrospermopsin increases expression ISO WDR43 (Homo sapiens) 6480464 cylindrospermopsin results in increased expression of WDR43 mRNA CTD PMID:24921660 Wdr43 Rat DDE increases expression ISO WDR43 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of WDR43 mRNA CTD PMID:38568856 Wdr43 Rat decabromodiphenyl ether decreases expression ISO WDR43 (Homo sapiens) 6480464 decabromobiphenyl ether results in decreased expression of WDR43 protein CTD PMID:31675489 Wdr43 Rat deguelin increases expression ISO WDR43 (Homo sapiens) 6480464 deguelin results in increased expression of WDR43 mRNA CTD PMID:33512557 Wdr43 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of WDR43 mRNA CTD PMID:21266533 Wdr43 Rat diethylstilbestrol increases expression ISO WDR43 (Homo sapiens) 6480464 Diethylstilbestrol results in increased expression of WDR43 mRNA CTD PMID:36621641 Wdr43 Rat dioxygen multiple interactions ISO Wdr43 (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of WDR43 mRNA CTD PMID:30529165 Wdr43 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of WDR43 mRNA CTD PMID:29391264 Wdr43 Rat enzyme inhibitor multiple interactions ISO WDR43 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of WDR43 protein CTD PMID:23301498 Wdr43 Rat fipronil decreases expression EXP 6480464 fipronil results in decreased expression of WDR43 mRNA CTD PMID:34044035 Wdr43 Rat fluoranthene multiple interactions ISO Wdr43 (Mus musculus) 6480464 [1-methylanthracene co-treated with fluoranthene] results in increased expression of WDR43 mRNA CTD PMID:28329830 Wdr43 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of WDR43 mRNA CTD PMID:24136188 Wdr43 Rat folic acid multiple interactions ISO Wdr43 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of WDR43 mRNA] CTD PMID:22206623 Wdr43 Rat folic acid decreases expression ISO Wdr43 (Mus musculus) 6480464 Folic Acid results in decreased expression of WDR43 mRNA CTD PMID:25629700 Wdr43 Rat FR900359 affects phosphorylation ISO WDR43 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of WDR43 protein CTD PMID:37730182 Wdr43 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of WDR43 mRNA CTD PMID:33387578 Wdr43 Rat herbicide multiple interactions ISO WDR43 (Homo sapiens) 6480464 [Herbicides results in increased abundance of mesotrione] which affects the methylation of WDR43 gene CTD PMID:34516295 Wdr43 Rat ivermectin decreases expression ISO WDR43 (Homo sapiens) 6480464 Ivermectin results in decreased expression of WDR43 protein CTD PMID:32959892 Wdr43 Rat ketoconazole increases expression ISO WDR43 (Homo sapiens) 6480464 Ketoconazole results in increased expression of WDR43 mRNA CTD PMID:36621641 Wdr43 Rat leflunomide increases expression ISO WDR43 (Homo sapiens) 6480464 leflunomide results in increased expression of WDR43 mRNA CTD PMID:28988120 Wdr43 Rat mercury dichloride increases expression EXP 6480464 Mercuric Chloride results in increased expression of WDR43 mRNA CTD PMID:16507785 Wdr43 Rat mesotrione multiple interactions ISO WDR43 (Homo sapiens) 6480464 [Herbicides results in increased abundance of mesotrione] which affects the methylation of WDR43 gene CTD PMID:34516295 Wdr43 Rat methoxyacetic acid decreases expression EXP 6480464 methoxyacetic acid results in decreased expression of WDR43 mRNA CTD PMID:20864626 Wdr43 Rat methylmercury chloride decreases expression EXP 6480464 methylmercuric chloride results in decreased expression of WDR43 mRNA CTD PMID:20864626 Wdr43 Rat Monobutylphthalate decreases expression EXP 6480464 monobutyl phthalate results in decreased expression of WDR43 mRNA CTD PMID:20864626 Wdr43 Rat ozone multiple interactions ISO WDR43 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of WDR43 mRNA more ... CTD PMID:32699268 and PMID:32845096 Wdr43 Rat paracetamol affects expression ISO Wdr43 (Mus musculus) 6480464 Acetaminophen affects the expression of WDR43 mRNA CTD PMID:17562736 Wdr43 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of WDR43 mRNA CTD PMID:33387578 Wdr43 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of WDR43 mRNA CTD PMID:32479839 Wdr43 Rat paracetamol decreases expression ISO WDR43 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of WDR43 mRNA CTD PMID:21420995 Wdr43 Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of WDR43 mRNA CTD PMID:32680482 Wdr43 Rat perfluorononanoic acid increases expression ISO WDR43 (Homo sapiens) 6480464 perfluoro-n-nonanoic acid results in increased expression of WDR43 mRNA CTD PMID:32588087 Wdr43 Rat pirinixic acid increases expression ISO Wdr43 (Mus musculus) 6480464 pirinixic acid results in increased expression of WDR43 mRNA CTD PMID:18301758 and PMID:23811191 Wdr43 Rat pregnenolone 16alpha-carbonitrile increases expression ISO Wdr43 (Mus musculus) 6480464 Pregnenolone Carbonitrile results in increased expression of WDR43 mRNA CTD PMID:28903501 Wdr43 Rat rac-lactic acid increases expression ISO WDR43 (Homo sapiens) 6480464 Lactic Acid results in increased expression of WDR43 mRNA CTD PMID:30851411 Wdr43 Rat resveratrol decreases expression ISO Wdr43 (Mus musculus) 6480464 resveratrol results in decreased expression of WDR43 protein CTD PMID:25505154 Wdr43 Rat SB 431542 multiple interactions ISO WDR43 (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in decreased expression of WDR43 protein CTD PMID:37664457 Wdr43 Rat silicon dioxide increases expression ISO WDR43 (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of WDR43 mRNA CTD PMID:25895662 Wdr43 Rat sodium arsenite affects methylation ISO WDR43 (Homo sapiens) 6480464 sodium arsenite affects the methylation of WDR43 gene CTD PMID:28589171 Wdr43 Rat sodium arsenite decreases expression ISO WDR43 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of WDR43 mRNA CTD PMID:38568856 Wdr43 Rat sodium dichromate increases expression EXP 6480464 sodium bichromate results in increased expression of WDR43 mRNA CTD PMID:25993096 Wdr43 Rat sunitinib increases expression ISO WDR43 (Homo sapiens) 6480464 Sunitinib results in increased expression of WDR43 mRNA CTD PMID:31533062 Wdr43 Rat tert-butyl hydroperoxide increases expression ISO WDR43 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in increased expression of WDR43 mRNA CTD PMID:15336504 Wdr43 Rat tetrachloromethane increases expression ISO Wdr43 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of WDR43 mRNA CTD PMID:27339419 and PMID:31919559 Wdr43 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of WDR43 mRNA] CTD PMID:31150632 Wdr43 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of WDR43 mRNA CTD PMID:31150632 Wdr43 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of WDR43 mRNA CTD PMID:23411599 and PMID:34492290 Wdr43 Rat titanium dioxide decreases expression ISO Wdr43 (Mus musculus) 6480464 titanium dioxide results in decreased expression of WDR43 mRNA CTD PMID:29264374 Wdr43 Rat titanium dioxide decreases methylation ISO Wdr43 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of WDR43 promoter CTD PMID:35295148 Wdr43 Rat titanium dioxide affects methylation ISO Wdr43 (Mus musculus) 6480464 titanium dioxide affects the methylation of WDR43 gene CTD PMID:35295148 Wdr43 Rat trichostatin A affects expression ISO WDR43 (Homo sapiens) 6480464 trichostatin A affects the expression of WDR43 mRNA CTD PMID:28542535 Wdr43 Rat triphenyl phosphate decreases expression EXP 6480464 triphenyl phosphate results in decreased expression of WDR43 mRNA CTD PMID:30589522 Wdr43 Rat triphenyl phosphate affects expression ISO WDR43 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of WDR43 mRNA CTD PMID:37042841 Wdr43 Rat urethane decreases expression ISO WDR43 (Homo sapiens) 6480464 Urethane results in decreased expression of WDR43 mRNA CTD PMID:28818685 Wdr43 Rat valproic acid decreases expression ISO Wdr43 (Mus musculus) 6480464 Valproic Acid results in decreased expression of WDR43 mRNA CTD PMID:21427059
Imported Annotations - KEGG (archival)
(+)-schisandrin B (EXP) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-tribromophenol (ISO) 2-hydroxypropanoic acid (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 3-chloropropane-1,2-diol (EXP) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) acrolein (ISO) aflatoxin B1 (ISO) alpha-pinene (ISO) antimycin A (ISO) aristolochic acid A (ISO) bisphenol A (EXP,ISO) cadmium dichloride (ISO) caffeine (EXP) carbon nanotube (ISO) chlorpyrifos (ISO) cisplatin (ISO) cobalt dichloride (EXP) coumarin (ISO) Cuprizon (EXP) cyclosporin A (ISO) cylindrospermopsin (ISO) DDE (ISO) decabromodiphenyl ether (ISO) deguelin (ISO) dibutyl phthalate (EXP) diethylstilbestrol (ISO) dioxygen (ISO) endosulfan (EXP) enzyme inhibitor (ISO) fipronil (EXP) fluoranthene (ISO) flutamide (EXP) folic acid (ISO) FR900359 (ISO) gentamycin (EXP) herbicide (ISO) ivermectin (ISO) ketoconazole (ISO) leflunomide (ISO) mercury dichloride (EXP) mesotrione (ISO) methoxyacetic acid (EXP) methylmercury chloride (EXP) Monobutylphthalate (EXP) ozone (ISO) paracetamol (EXP,ISO) paraquat (EXP) perfluorononanoic acid (ISO) pirinixic acid (ISO) pregnenolone 16alpha-carbonitrile (ISO) rac-lactic acid (ISO) resveratrol (ISO) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sodium dichromate (EXP) sunitinib (ISO) tert-butyl hydroperoxide (ISO) tetrachloromethane (EXP,ISO) thioacetamide (EXP) titanium dioxide (ISO) trichostatin A (ISO) triphenyl phosphate (EXP,ISO) urethane (ISO) valproic acid (ISO)
Wdr43 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 29,565,610 - 29,604,954 (-) NCBI GRCr8 mRatBN7.2 6 23,845,499 - 23,884,846 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 23,845,499 - 23,884,846 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 24,145,107 - 24,184,448 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 24,460,981 - 24,500,322 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 23,949,165 - 23,988,264 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 23,433,532 - 23,473,179 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 23,433,532 - 23,473,169 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 33,299,540 - 33,339,177 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 23,950,923 - 23,990,272 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 6 23,344,770 - 23,384,117 (-) NCBI Celera Cytogenetic Map 6 q14 NCBI
WDR43 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 28,894,667 - 28,948,219 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 28,894,667 - 28,948,219 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 29,117,533 - 29,171,085 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 28,971,037 - 29,024,584 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 2 28,962,215 - 29,015,725 (+) NCBI Celera Cytogenetic Map 2 p23.2 NCBI HuRef 2 28,858,993 - 28,912,363 (+) NCBI HuRef CHM1_1 2 29,048,026 - 29,101,578 (+) NCBI CHM1_1 T2T-CHM13v2.0 2 28,938,252 - 28,991,773 (+) NCBI T2T-CHM13v2.0
Wdr43 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 17 71,923,175 - 71,966,026 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 17 71,922,890 - 71,966,026 (+) Ensembl GRCm39 Ensembl GRCm38 17 71,616,178 - 71,659,031 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 17 71,615,895 - 71,659,031 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 17 71,965,555 - 72,008,371 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 17 71,521,072 - 71,563,888 (+) NCBI MGSCv36 mm8 Celera 17 75,892,336 - 75,935,090 (+) NCBI Celera Cytogenetic Map 17 E1.3 NCBI cM Map 17 41.87 NCBI
Wdr43 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955469 10,777,292 - 10,835,577 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955469 10,777,332 - 10,835,577 (+) NCBI ChiLan1.0 ChiLan1.0
WDR43 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 12 97,558,175 - 97,612,251 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2A 97,562,148 - 97,616,208 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2A 28,901,521 - 28,955,579 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 2A 28,955,612 - 29,034,485 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 2A 28,987,883 - 29,033,049 (+) Ensembl panpan1.1 panPan2
WDR43 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 17 22,769,281 - 22,813,559 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 17 22,769,318 - 22,812,199 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 17 22,563,584 - 22,607,784 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 17 23,331,918 - 23,376,135 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 17 23,331,947 - 23,376,131 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 17 22,631,178 - 22,675,451 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 17 22,683,827 - 22,728,006 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 17 22,799,918 - 22,844,094 (+) NCBI UU_Cfam_GSD_1.0
Wdr43 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024406292 66,925,384 - 66,968,637 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936493 3,869,906 - 3,914,215 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936493 3,871,167 - 3,914,172 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
WDR43 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 3 110,318,538 - 110,365,062 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 3 110,317,549 - 110,365,108 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 3 117,165,162 - 117,192,545 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
WDR43
Wdr43
.
Predicted Target Of
Count of predictions: 287 Count of miRNA genes: 191 Interacting mature miRNAs: 227 Transcripts: ENSRNOT00000035320 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
8552962 Pigfal16 Plasma insulin-like growth factor 1 level QTL 16 9.4 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 6 1 41223769 Rat 1549905 Stresp10 Stress response QTL 10 6.83 0.0066 stress-related behavior trait (VT:0010451) number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960) 6 1 27574569 Rat 8693645 Alc31 Alcohol consumption QTL 31 3.7 0.038 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 6 17532521 24011952 Rat 10401812 Kidm54 Kidney mass QTL 54 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 6 14368788 59368788 Rat 1331743 Uae28 Urinary albumin excretion QTL 28 4.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 6 1 34235784 Rat 2292589 Emca10 Estrogen-induced mammary cancer QTL 10 0.048 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 6 16536140 61536140 Rat 10401800 Kidm49 Kidney mass QTL 49 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 6 14368788 59368788 Rat 1300164 Rf15 Renal function QTL 15 3.12 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 6 5074497 54641141 Rat 9589129 Insul24 Insulin level QTL 24 19.06 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 6 1 41223769 Rat 1578758 Tcas9 Tongue tumor susceptibility QTL 9 3.29 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 6 1 37618905 Rat 4145119 Mcs25 Mammary carcinoma susceptibility QTL 25 0.0001 mammary gland integrity trait (VT:0010552) ratio of deaths to total study population during a period of time (CMO:0001023) 6 10894415 110548006 Rat 7411603 Foco13 Food consumption QTL 13 5.5 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 6 1 41223769 Rat 1598843 Cm63 Cardiac mass QTL 63 2.6 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 6 1 39036266 Rat 738024 Sach5 Saccharine consumption QTL 5 3.9 0.00039 consumption behavior trait (VT:0002069) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 6 1 43394190 Rat 7411542 Bw127 Body weight QTL 127 5.5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 6 1 41223769 Rat 9589048 Scfw3 Subcutaneous fat weight QTL 3 4.57 0.001 subcutaneous adipose mass (VT:1000472) abdominal subcutaneous fat pad weight (CMO:0002069) 6 1 41223769 Rat 738023 Alc17 Alcohol consumption QTL 17 3.1 0.003 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 6 1 27574569 Rat 1354616 Despr12 Despair related QTL 12 0.0012 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 6 1 27574569 Rat 2293839 Kiddil2 Kidney dilation QTL 2 4.8 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 6 20866422 81133036 Rat 1576309 Emca7 Estrogen-induced mammary cancer QTL 7 4 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 6 15107216 107351382 Rat 2293709 Bss23 Bone structure and strength QTL 23 5.18 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 6 1 42487980 Rat 2293650 Bss31 Bone structure and strength QTL 31 5.05 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 6 1 42487980 Rat 7411584 Foco4 Food consumption QTL 4 4.3 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 6 1 42838846 Rat 1578665 Bss16 Bone structure and strength QTL 16 4.4 femur morphology trait (VT:0000559) bone trabecular cross-sectional area (CMO:0002311) 6 11735669 72593685 Rat 2293841 Kiddil4 Kidney dilation QTL 4 4.4 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 6 20866422 81133036 Rat 2300176 Bmd51 Bone mineral density QTL 51 11.7 0.0001 femur mineral mass (VT:0010011) bone mineral density (CMO:0001226) 6 1 27574569 Rat 1300128 Rf16 Renal function QTL 16 3.89 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 6 5074497 34434305 Rat 1641898 Colcr4 Colorectal carcinoma resistance QTL4 3.71 0.0007 intestine integrity trait (VT:0010554) well differentiated malignant colorectal tumor surface area measurement (CMO:0002077) 6 20338777 62613667 Rat 1578668 Bmd14 Bone mineral density QTL 14 3.8 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 6 11735669 72593685 Rat 2301972 Bp325 Blood pressure QTL 325 4.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 6 1 72227641 Rat 2293656 Bss28 Bone structure and strength QTL 28 6.79 0.0001 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 6 1 42487980 Rat 1359023 Bp272 Blood pressure QTL 272 2.5 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 6 16536140 27261739 Rat 1354664 Slep2 Serum leptin concentration QTL 2 4.49 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 6 16536140 71636405 Rat 2300190 Bmd52 Bone mineral density QTL 52 11.2 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 6 1 27574569 Rat
RH129043
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 23,845,544 - 23,845,751 (+) MAPPER mRatBN7.2 Rnor_6.0 6 23,433,578 - 23,433,784 NCBI Rnor6.0 Rnor_5.0 6 33,299,586 - 33,299,792 UniSTS Rnor5.0 RGSC_v3.4 6 23,950,969 - 23,951,175 UniSTS RGSC3.4 Celera 6 23,344,816 - 23,345,022 UniSTS Cytogenetic Map 6 q13 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000035320 ⟹ ENSRNOP00000033485
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 23,845,499 - 23,884,846 (-) Ensembl Rnor_6.0 Ensembl 6 23,433,532 - 23,473,169 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000115867 ⟹ ENSRNOP00000080448
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 23,845,499 - 23,884,846 (-) Ensembl
RefSeq Acc Id:
NM_001037791 ⟹ NP_001032880
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 29,565,610 - 29,604,954 (-) NCBI mRatBN7.2 6 23,845,499 - 23,884,846 (-) NCBI Rnor_6.0 6 23,433,532 - 23,473,169 (-) NCBI Rnor_5.0 6 33,299,540 - 33,339,177 (-) NCBI RGSC_v3.4 6 23,950,923 - 23,990,272 (-) RGD Celera 6 23,344,770 - 23,384,117 (-) RGD
Sequence:
CGGGCGAACACGTGGCTGCCGCGGAGCTAGAGCAGCAATGGCGGCCGGTGGCGGCGGTAGCTGCGACCCCTTGGCCCCGGCGGGGGTCCCCTGCGCCTTCTCGCCGGACAGTCAAGCCTACTTCGCTT
hide sequence
RefSeq Acc Id:
NP_001032880 ⟸ NM_001037791
- UniProtKB:
G3V920 (UniProtKB/TrEMBL), A6HA21 (UniProtKB/TrEMBL), A0A8I5ZQB1 (UniProtKB/TrEMBL)
- Sequence:
MAAGGGGSCDPLAPAGVPCAFSPDSQAYFALASSDGHLRVWETANNRLHQEYVPSAHLSGTCTCLAWAPARLQAKESHQRKKRKSEAIGTNDQADLLALGTAVGSILLYSTVKGELHSKLISGGHEKR
hide sequence
Ensembl Acc Id:
ENSRNOP00000033485 ⟸ ENSRNOT00000035320
Ensembl Acc Id:
ENSRNOP00000080448 ⟸ ENSRNOT00000115867
RGD ID: 13694417 Promoter ID: EPDNEW_R4942 Type: multiple initiation site Name: Wdr43_1 Description: WD repeat domain 43 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 6 23,473,152 - 23,473,212 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-03-05
Wdr43
WD repeat domain 43
LOC362703
similar to WD-repeat protein 43
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-02-09
LOC362703
similar to WD-repeat protein 43
Symbol and Name status set to provisional
70820 PROVISIONAL
