Advanced Search (OLGA)

Gene: Tex44 (testis expressed 44) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Tex44

Name:

testis expressed 44

RGD ID:

1564629

Description:

Predicted to be located in cytoplasm. Orthologous to human TEX44 (testis expressed 44); INTERACTS WITH bisphenol A; atrazine (ortholog); benzo[a]pyrene (ortholog).

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

hypothetical protein LOC501180; LOC501180; similar to hypothetical protein MGC35154; testis-expressed protein 44; uncharacterized protein C2orf57 homolog

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	TEX44 (testis expressed 44)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Tex44 (testis expressed 44)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Tex44 (testis expressed 44)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	TEX44 (testis expressed 44)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	TEX44 (testis expressed 44)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Tex44 (testis expressed 44)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	TEX44 (testis expressed 44)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	TEX44 (testis expressed 44)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Tex44 (testis expressed 44)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	TEX44 (testis expressed 44)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Tex44 (testis expressed 44)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	94,523,649 - 94,525,067 (+)	NCBI		GRCr8
mRatBN7.2	9	87,075,684 - 87,077,102 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	87,075,684 - 87,077,102 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	9	95,492,808 - 95,494,226 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	100,621,936 - 100,623,354 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	99,004,031 - 99,005,449 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	93,445,002 - 93,446,420 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	93,445,002 - 93,446,420 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	9	93,172,940 - 93,174,358 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	9	85,189,062 - 85,190,480 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	9	84,491,111 - 84,492,529 (+)	NCBI		Celera
Cytogenetic Map	9	q35	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tex44	Rat	hereditary spastic paraplegia		ISO	RGD:1606945	8554872	ClinVar Annotator: match by term: Hereditary spastic paraplegia	ClinVar	PMID:9373798
Tex44	Rat	Joubert syndrome 22		ISO	RGD:1606945	8554872	ClinVar Annotator: match by term: Joubert syndrome 22	ClinVar	PMID:28492532
Tex44	Rat	Perlman syndrome		ISO	RGD:1606945	8554872	ClinVar Annotator: match by term: Perlman syndrome	ClinVar	PMID:28492532

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tex44	Rat	atrazine	increases expression	ISO	RGD:1606945	6480464	Atrazine results in increased expression of TEX44 mRNA	CTD	PMID:22378314
Tex44	Rat	benzo[a]pyrene	decreases methylation	ISO	RGD:1606945	6480464	Benzo(a)pyrene results in decreased methylation of TEX44 5' UTR; Benzo(a)pyrene results in decreased methylation of more ...	CTD	PMID:27901495
Tex44	Rat	bis(2-ethylhexyl) phthalate	decreases expression	ISO	RGD:1606945	6480464	Diethylhexyl Phthalate results in decreased expression of TEX44 mRNA	CTD	PMID:31163220
Tex44	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of TEX44 mRNA	CTD	PMID:25181051
Tex44	Rat	bisphenol A	decreases methylation	ISO	RGD:1606945	6480464	bisphenol A results in decreased methylation of TEX44 gene	CTD	PMID:31601247
Tex44	Rat	resveratrol	multiple interactions	ISO	RGD:1606945	6480464	[Plant Extracts co-treated with Resveratrol] results in decreased expression of TEX44 mRNA	CTD	PMID:23557933
Tex44	Rat	triptonide	increases expression	ISO	RGD:1621502	6480464	triptonide results in increased expression of TEX44 mRNA	CTD	PMID:33045310
Tex44	Rat	valproic acid	increases methylation	ISO	RGD:1606945	6480464	Valproic Acid results in increased methylation of TEX44 gene	CTD	PMID:29154799

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tex44	Rat	cytoplasm	located_in	ISS	UniProtKB:Q53QW1	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Tex44	Rat	cytoplasm	located_in	IEA	UniProtKB-SubCell:SL-0086	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Tex44	Rat	cytoplasm	located_in	IEA	UniProtKB-KW:KW-0963	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Tex44	Rat	cytoplasm	located_in	ISO	RGD:1606945	1624291	PMID:26168773	RGD	PMID:26168773

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tex44	Rat	protein binding	enables	ISO	RGD:1606945	1624291	UniProtKB:O60830\|UniProtKB:O95563\|UniProtKB:P02654\|UniProtKB:Q16563\|UniProtKB:Q5RI15\|UniProtKB:Q5XKP0\|UniProtKB:Q6NTF9-3\|UniProtKB:Q6P1S2\|UniProtKB:Q92523\|UniProtKB:Q9BUN8\|UniProtKB:Q9NUH8\|UniProtKB:Q9UHD4 PMID:25416956, PMID:32296183	RGD	PMID:25416956\|PMID:32296183

#	Reference Title	Reference Citation
1.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
3.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

PMID:26168773

Tex44
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	94,523,649 - 94,525,067 (+)	NCBI		GRCr8
mRatBN7.2	9	87,075,684 - 87,077,102 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	87,075,684 - 87,077,102 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	9	95,492,808 - 95,494,226 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	100,621,936 - 100,623,354 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	99,004,031 - 99,005,449 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	93,445,002 - 93,446,420 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	93,445,002 - 93,446,420 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	9	93,172,940 - 93,174,358 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	9	85,189,062 - 85,190,480 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	9	84,491,111 - 84,492,529 (+)	NCBI		Celera
Cytogenetic Map	9	q35	NCBI

TEX44
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	231,592,864 - 231,594,276 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	231,592,864 - 231,594,276 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	232,457,575 - 232,458,987 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	232,165,856 - 232,167,238 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	2	226,233,973 - 226,235,392 (+)	NCBI		Celera
Cytogenetic Map	2	q37.1	NCBI
HuRef	2	224,299,530 - 224,300,949 (+)	NCBI		HuRef
CHM1_1	2	232,463,249 - 232,464,668 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	2	232,077,341 - 232,078,753 (+)	NCBI		T2T-CHM13v2.0

Tex44
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	86,354,051 - 86,355,771 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	86,354,051 - 86,355,774 (+)	Ensembl		GRCm39 Ensembl
GRCm38	1	86,426,329 - 86,428,049 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	86,426,329 - 86,428,052 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	1	88,322,904 - 88,324,624 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	1	88,257,500 - 88,259,223 (+)	NCBI		MGSCv36	mm8
Celera	1	89,395,430 - 89,397,150 (+)	NCBI		Celera
Cytogenetic Map	1	C5	NCBI
cM Map	1	43.94	NCBI

Tex44
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955453	4,108,596 - 4,110,610 (-)	NCBI	ChiLan1.0	ChiLan1.0

TEX44
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	13	134,210,900 - 134,224,686 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2B	134,225,866 - 134,230,926 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2B	118,843,674 - 118,845,087 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2B	237,627,878 - 237,629,298 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2B	237,627,967 - 237,629,154 (+)	Ensembl	panpan1.1		panPan2

TEX44
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	25	43,453,253 - 43,454,573 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	25	43,453,310 - 43,454,437 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	25	44,011,601 - 44,012,918 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	25	43,710,636 - 43,711,953 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	25	43,710,362 - 43,711,817 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	25	43,638,003 - 43,639,337 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	25	43,481,143 - 43,482,460 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	25	43,637,050 - 43,638,367 (+)	NCBI		UU_Cfam_GSD_1.0

Tex44
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	185,584,212 - 185,585,661 (+)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936525	5,354,202 - 5,355,338 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TEX44
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	15	132,266,149 - 132,267,612 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	15	146,038,817 - 146,042,242 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TEX44
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	10	117,609,567 - 117,611,518 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	10	117,610,187 - 117,611,374 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666040	81,835,439 - 81,836,851 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Tex44
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624843	4,673,112 - 4,674,285 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Tex44
5 total Variants

Assembly: Rnor_5.0

Chromosome	Start Pos	End Pos	Reference Nucleotide	Variant Nucleotide	Variant Type	Strain	Variant Page
9	93173998	93173999	G	C	snv	HTX/Kyo (KyushuU), BUF/MNa (KyushuU)	View more Information

Predicted Target Of

	Summary Value
Count of predictions:	50
Count of miRNA genes:	41
Interacting mature miRNAs:	42
Transcripts:	ENSRNOT00000025029
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631656	Bp108	Blood pressure QTL 108	5.97	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	48598251	93598251	Rat
8662828	Vetf6	Vascular elastic tissue fragility QTL 6	3.9		artery integrity trait (VT:0010639)	patent ductus arteriosus score (CMO:0002566)	9	36962359	92058970	Rat
11353957	Bmd92	Bone mineral density QTL 92		0.01	tibia mineral mass (VT:1000283)	volumetric bone mineral density (CMO:0001553)	9	46114199	91114199	Rat
724515	Uae16	Urinary albumin excretion QTL 16	8		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	9	58163035	100929646	Rat
731171	Glom6	Glomerulus QTL 6	2.8	0.0003	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	9	64573531	109573531	Rat
724547	Cm21	Cardiac mass QTL 21	2.7		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	9	79271511	102910209	Rat
61385	Edpm9	Estrogen-dependent pituitary mass QTL 9	3.43	0.05	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	9	63869687	108869687	Rat
2303178	Bp334	Blood pressure QTL 334	3.7	0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	79271511	91616855	Rat
724544	Uae9	Urinary albumin excretion QTL 9	4.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	9	25268044	114175309	Rat
2290450	Scl57	Serum cholesterol level QTL 57	4.15		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	9	36962359	95410867	Rat
1578760	Cm53	Cardiac mass QTL 53	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	9	56771635	101771635	Rat
11353951	Bp394	Blood pressure QTL 394			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	44649921	89649921	Rat
1581580	Uae34	Urinary albumin excretion QTL 34			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	9	62072275	96470995	Rat
1300134	Bp185	Blood pressure QTL 185	3.73		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	9	61381434	104821652	Rat
12879506	Pur33	Proteinuria QTL 33			urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	9	44649921	89649921	Rat
1354626	Bvd1	Brain ventricular dilatation QTL 1	3.73	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	9	75712843	111552878	Rat
4889852	Pur26	Proteinuria QTL 26	15	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	9	77813894	101597663	Rat
7794784	Mcs31	Mammary carcinoma susceptibility QTL 31	2.98		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	9	77813894	111552878	Rat
731164	Uae25	Urinary albumin excretion QTL 25	3.5	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	9	25661188	100929786	Rat
10058949	Gmadr5	Adrenal mass QTL 5	2	0.014	adrenal gland mass (VT:0010420)	both adrenal glands wet weight to body weight ratio (CMO:0002411)	9	42791513	87976209	Rat
1578757	Pur6	Proteinuria QTL 6	3.3	0.005	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	9	62072275	96470995	Rat
4889943	Bss90	Bone structure and strength QTL 90	4.1		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	9	86369631	92058970	Rat

UniSTS:492179

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	9	87,075,670 - 87,077,050 (+)	MAPPER	mRatBN7.2
Rnor_6.0	9	93,444,989 - 93,446,368	NCBI	Rnor6.0
Rnor_5.0	9	93,172,927 - 93,174,306	UniSTS	Rnor5.0
RGSC_v3.4	9	85,189,049 - 85,190,428	UniSTS	RGSC3.4
Celera	9	84,491,098 - 84,492,477	UniSTS
Cytogenetic Map	9	q35	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
5	3	8	8	13	4	4	4	31	11	6	13	23	9


RefSeq Transcripts	NM_001024364	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC112440	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC085806	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000009	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000025029 ⟹ ENSRNOP00000025030

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	9	87,075,684 - 87,077,102 (+)	Ensembl
Rnor_6.0 Ensembl	9	93,445,002 - 93,446,420 (+)	Ensembl

RefSeq Acc Id:

NM_001024364 ⟹ NP_001019535

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	94,523,649 - 94,525,067 (+)	NCBI
mRatBN7.2	9	87,075,684 - 87,077,102 (+)	NCBI
Rnor_6.0	9	93,445,002 - 93,446,420 (+)	NCBI
Rnor_5.0	9	93,172,940 - 93,174,358 (+)	NCBI
RGSC_v3.4	9	85,189,062 - 85,190,480 (+)	RGD
Celera	9	84,491,111 - 84,492,529 (+)	RGD

Sequence:

show sequence

CAACCACCATAAGTAGCAGGGGGCATAGATGACCACTGAGCCCTTGGAAGACCCTGAAGCCAACAGCAATTTTGTACATGGTCTTCCTGAGGCCTCCTTGGGCAACAAAGCTGATGAAAACTCTGAAG
ATTTACCCGGACCGTCTGAAGGACTGGATCCCCTACCTGATGAAGTCCCACCAGAAGACATCGTGGAAGCACGAGCTGAAGAGGATGTAGACCAGGCCTCTGAGGCAAACATCATCGCCACAGAGCAA
GATGAAGAGCAGGCCTCCATGCAGATTGCCACTTCTATGGGACAGAATAAAGATCGGGCCTCCATGCAGACGGACACCTCCACAGGGCGAGATGCAGAGCCAGCCACCTCCATGACTACATCAACATC
TGGGGTCAAAGAAGAGATCCCAGGTACTCCAAATCCTAGCCAGGAGAATCTCGAAGAGCTCACATCCCTGCTGCCCCAAGACCCAGGTATCCTGCAAATGTTTGTAGGTTTCCAGAACCCAGTGTGGG
ACAGGCTGGCTGAAAACAACCGCACAAGTCGGAGCCGGACGGTTTCCCCAAGTGACTCCCAGACCCAAGAAAAGACATCAGGAAAGTCAACTGTTTCGGAAGGGCAACTGGAGATAGCTTCAAATGCT
GACGTCCCATCTGTCCTACCTGAAGATGTCCAGACTTCTGCAGGAGCTACTGACCCACCCCCTTCAGATACCACTGGTCCTGAACCAGAACCCACCAAGTCTGCTGATCAGGAGGCTGAAGATTTCAA
GGCCTTGAACCCTGAGAGCAAAGTTAGATCTCCGAAGTCAACCAGTGAGGATTTAGCTGCGGACTCAGGGACCCCTCAGGCCCCACCTTCTCCAAATTCCCCAGCAGACAGTCCACCCCCCTCTCCAG
ATTCCTATCAGGTGTCCCTAGGAAGGAGCCGTCTGGACCCCAGTCTGTATGGTCCTGAAGTGGAGAATGACTACATGCGCTCTATGACCAGCTTACTGTGTGGAGGAGAGGGCTCCATCAGCTCCCTC
ACAGACATCCTGGTGTGGTCAGACACAGCCACACGCATGGGTGTGGCTATGGGCATTCTGGCCTCAGGCCGCAGCTCTCCAGCTGACAGGCTACAAGACGAGGGTCCCCGACTGCGCACTGTCGCCAG
CCTCTTTCGCAGTGCCAGGTCAGCTTTCTCGTCTGGGGTGATGGCTGGAACTAGCTCAGTCCTGCGCTCTGTCACACACCTGCTGGAATCTGTGGAGAGGCACACTATGGAAGGCATCCGTTCAACTA
TGCGCTACCTGAACCACTTCACCTTGCGCTGGGCTCGCACTGGCTCCAATAGTGACTAGACCAGCAAGCCCCTCTACTCCTTCCCCAACCCTGTGCTAAATAACTGCTCCCTGCCCCTCAGTAAATAA
CCACAAGCGTTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence


Protein RefSeqs	NP_001019535	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH85806	(Get FASTA)	NCBI Sequence Viewer
	EDL75588	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000025030
	ENSRNOP00000025030.4
GenBank Protein	Q5U2Y8	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001019535 ⟸ NM_001024364

- UniProtKB:

Q5U2Y8 (UniProtKB/Swiss-Prot), A6JWI0 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MTTEPLEDPEANSNFVHGLPEASLGNKADENSEDLPGPSEGLDPLPDEVPPEDIVEARAEEDVDQASEANIIATEQDEEQASMQIATSMGQNKDRASMQTDTSTGRDAEPATSMTTSTSGVKEEIPGT
PNPSQENLEELTSLLPQDPGILQMFVGFQNPVWDRLAENNRTSRSRTVSPSDSQTQEKTSGKSTVSEGQLEIASNADVPSVLPEDVQTSAGATDPPPSDTTGPEPEPTKSADQEAEDFKALNPESKVR
SPKSTSEDLAADSGTPQAPPSPNSPADSPPPSPDSYQVSLGRSRLDPSLYGPEVENDYMRSMTSLLCGGEGSISSLTDILVWSDTATRMGVAMGILASGRSSPADRLQDEGPRLRTVASLFRSARSAF
SSGVMAGTSSVLRSVTHLLESVERHTMEGIRSTMRYLNHFTLRWARTGSNSD

hide sequence

Ensembl Acc Id:

ENSRNOP00000025030 ⟸ ENSRNOT00000025029

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5U2Y8-F1-model_v2	AlphaFold	Q5U2Y8	1-436	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13696823

Promoter ID:

EPDNEW_R7348

Type:

multiple initiation site

Name:

Tex44_1

Description:

testis expressed 44

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	9	93,444,993 - 93,445,053	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-26883	BioCyc
Ensembl Genes	ENSRNOG00000018559	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000025029	ENTREZGENE
	ENSRNOT00000025029.5	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7112277	IMAGE-MGC_LOAD
InterPro	DUF4678	UniProtKB/Swiss-Prot
KEGG Report	rno:501180	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:93876	IMAGE-MGC_LOAD
NCBI Gene	501180	ENTREZGENE
PANTHER	PTHR37365	UniProtKB/Swiss-Prot
	TESTIS-EXPRESSED PROTEIN 44	UniProtKB/Swiss-Prot
Pfam	DUF4678	UniProtKB/Swiss-Prot
PhenoGen	Tex44	PhenoGen
RatGTEx	ENSRNOG00000018559	RatGTEx
UniProt	A6JWI0	ENTREZGENE, UniProtKB/TrEMBL
	Q5U2Y8	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-04-26	Tex44	testis expressed 44	LOC501180	similar to hypothetical protein MGC35154	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-02-09	LOC501180	similar to hypothetical protein MGC35154			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar