Symbol:
Camta1
Name:
calmodulin binding transcription activator 1
RGD ID:
1562703
Description:
Predicted to enable double-stranded DNA binding activity; sequence-specific DNA binding activity; and transcription coregulator activity. Predicted to be involved in positive regulation of calcineurin-NFAT signaling cascade and positive regulation of transcription by RNA polymerase II. Predicted to act upstream of or within neuromuscular process controlling balance. Predicted to be active in nucleus. Human ortholog(s) of this gene implicated in nonprogressive cerebellar ataxia with mental retardation. Orthologous to human CAMTA1 (calmodulin binding transcription activator 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; aflatoxin B1.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
calmodulin-binding transcription activator 1; MGC114278; similar to KIAA0833 protein
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 166,791,639 - 167,639,502 (-) NCBI GRCr8 mRatBN7.2 5 161,510,283 - 162,356,902 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 161,510,283 - 162,356,723 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 164,226,976 - 165,059,436 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 166,043,608 - 166,880,482 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 166,005,620 - 166,842,701 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 168,138,207 - 169,017,295 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 168,141,372 - 169,017,295 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 171,715,302 - 172,577,540 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 168,201,249 - 169,046,038 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 5 159,762,457 - 160,564,372 (-) NCBI Celera Cytogenetic Map 5 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Camta1 Rat 1,2-dimethylhydrazine affects expression ISO RGD:1551086 6480464 1,2-Dimethylhydrazine affects the expression of CAMTA1 mRNA CTD PMID:22206623 Camta1 Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO RGD:1551086 6480464 2,3',4,4',5-pentachlorobiphenyl results in increased expression of CAMTA1 mRNA CTD PMID:31388691 Camta1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of CAMTA1 mRNA CTD PMID:32109520 Camta1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of CAMTA1 mRNA CTD PMID:33387578 Camta1 Rat 2-methylcholine affects expression ISO RGD:1318785 6480464 beta-methylcholine affects the expression of CAMTA1 mRNA CTD PMID:21179406 Camta1 Rat 4,4'-sulfonyldiphenol decreases methylation ISO RGD:1551086 6480464 bisphenol S results in decreased methylation of CAMTA1 exon CTD PMID:33297965 Camta1 Rat 4,4'-sulfonyldiphenol affects methylation ISO RGD:1551086 6480464 bisphenol S affects the methylation of CAMTA1 gene CTD PMID:31683443 Camta1 Rat 4,4'-sulfonyldiphenol affects methylation ISO RGD:1318785 6480464 bisphenol S affects the methylation of CAMTA1 gene CTD PMID:31601247 Camta1 Rat 4,4'-sulfonyldiphenol multiple interactions ISO RGD:1318785 6480464 [bisphenol S co-treated with Fulvestrant] results in decreased methylation of CAMTA1 gene CTD PMID:31601247 Camta1 Rat 4,4'-sulfonyldiphenol increases methylation ISO RGD:1551086 6480464 bisphenol S results in increased methylation of CAMTA1 promoter CTD PMID:33297965 Camta1 Rat 4-hydroxyphenyl retinamide increases expression ISO RGD:1551086 6480464 Fenretinide results in increased expression of CAMTA1 mRNA CTD PMID:28973697 Camta1 Rat 5-aza-2'-deoxycytidine affects expression ISO RGD:1318785 6480464 Decitabine affects the expression of CAMTA1 mRNA CTD PMID:23300844 Camta1 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of CAMTA1 mRNA CTD PMID:24780913|PMID:30047161 Camta1 Rat aflatoxin B1 increases methylation ISO RGD:1318785 6480464 Aflatoxin B1 results in increased methylation of CAMTA1 gene CTD PMID:27153756 Camta1 Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of CAMTA1 mRNA CTD PMID:33354967 Camta1 Rat aflatoxin B1 affects methylation ISO RGD:1318785 6480464 Aflatoxin B1 affects the methylation of CAMTA1 intron CTD PMID:30157460 Camta1 Rat Aflatoxin B2 alpha increases methylation ISO RGD:1318785 6480464 aflatoxin B2 results in increased methylation of CAMTA1 intron; aflatoxin B2 results in increased methylation more ... CTD PMID:30157460 Camta1 Rat all-trans-retinoic acid decreases expression ISO RGD:1318785 6480464 Tretinoin results in decreased expression of CAMTA1 mRNA CTD PMID:21934132 Camta1 Rat amphetamine decreases expression EXP 6480464 Amphetamine results in decreased expression of CAMTA1 mRNA CTD PMID:30779732 Camta1 Rat aristolochic acid A decreases expression ISO RGD:1318785 6480464 aristolochic acid I results in decreased expression of CAMTA1 mRNA CTD PMID:33212167 Camta1 Rat arsane decreases methylation ISO RGD:1318785 6480464 Arsenic results in decreased methylation of CAMTA1 promoter CTD PMID:26771251 Camta1 Rat arsenic atom decreases methylation ISO RGD:1318785 6480464 Arsenic results in decreased methylation of CAMTA1 promoter CTD PMID:26771251 Camta1 Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of CAMTA1 gene CTD PMID:35440735 Camta1 Rat benzo[a]pyrene affects methylation ISO RGD:1318785 6480464 Benzo(a)pyrene affects the methylation of CAMTA1 intron; Benzo(a)pyrene affects the methylation of CAMTA1 promoter CTD PMID:30157460 Camta1 Rat benzo[a]pyrene decreases methylation ISO RGD:1318785 6480464 Benzo(a)pyrene results in decreased methylation of CAMTA1 3' UTR CTD PMID:27901495 Camta1 Rat benzo[e]pyrene increases methylation ISO RGD:1318785 6480464 benzo(e)pyrene results in increased methylation of CAMTA1 intron CTD PMID:30157460 Camta1 Rat beta-lapachone decreases expression ISO RGD:1318785 6480464 beta-lapachone results in decreased expression of CAMTA1 mRNA CTD PMID:38218311 Camta1 Rat beta-lapachone increases expression ISO RGD:1318785 6480464 beta-lapachone results in increased expression of CAMTA1 mRNA CTD PMID:38218311 Camta1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of CAMTA1 mRNA CTD PMID:25181051 Camta1 Rat bisphenol A multiple interactions ISO RGD:1318785 6480464 [bisphenol A co-treated with Fulvestrant] affects the methylation of CAMTA1 gene CTD PMID:31601247 Camta1 Rat bisphenol A decreases methylation ISO RGD:1318785 6480464 bisphenol A results in decreased methylation of CAMTA1 gene CTD PMID:31601247 Camta1 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with tributyltin] results in increased expression of CAMTA1 mRNA CTD PMID:31129395 Camta1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of CAMTA1 mRNA CTD PMID:31129395|PMID:34947998 Camta1 Rat bisphenol A decreases methylation ISO RGD:1551086 6480464 bisphenol A results in decreased methylation of CAMTA1 promoter CTD PMID:27312807 Camta1 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of CAMTA1 gene CTD PMID:28505145 Camta1 Rat butanal increases expression ISO RGD:1318785 6480464 butyraldehyde results in increased expression of CAMTA1 mRNA CTD PMID:26079696 Camta1 Rat cadmium atom multiple interactions ISO RGD:1551086 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of CAMTA1 more ... CTD PMID:37325564 Camta1 Rat cadmium dichloride increases expression ISO RGD:1318785 6480464 Cadmium Chloride results in increased expression of CAMTA1 mRNA CTD PMID:38568856 Camta1 Rat cadmium dichloride multiple interactions ISO RGD:1551086 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of CAMTA1 more ... CTD PMID:37325564 Camta1 Rat cannabidiol decreases methylation ISO RGD:1551086 6480464 Cannabidiol results in decreased methylation of CAMTA1 gene CTD PMID:33407853 Camta1 Rat cantharidin decreases expression ISO RGD:1551086 6480464 Cantharidin results in decreased expression of CAMTA1 mRNA CTD PMID:36907384 Camta1 Rat carbon nanotube decreases expression ISO RGD:1551086 6480464 Nanotubes, Carbon analog results in decreased expression of CAMTA1 mRNA; Nanotubes, Carbon results in decreased more ... CTD PMID:25554681 Camta1 Rat CGP 52608 multiple interactions ISO RGD:1318785 6480464 CGP 52608 promotes the reaction [RORA protein binds to CAMTA1 gene] CTD PMID:28238834 Camta1 Rat choline multiple interactions ISO RGD:1551086 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation more ... CTD PMID:20938992 Camta1 Rat cisplatin affects expression ISO RGD:1318785 6480464 Cisplatin affects the expression of CAMTA1 mRNA CTD PMID:23300844 Camta1 Rat cyclosporin A increases expression ISO RGD:1318785 6480464 Cyclosporine results in increased expression of CAMTA1 mRNA CTD PMID:25562108 Camta1 Rat doxorubicin affects methylation EXP 6480464 Doxorubicin affects the methylation of CAMTA1 gene CTD PMID:28962528 Camta1 Rat doxorubicin decreases expression ISO RGD:1318785 6480464 Doxorubicin results in decreased expression of CAMTA1 mRNA CTD PMID:29803840 Camta1 Rat epoxiconazole increases expression ISO RGD:1551086 6480464 epoxiconazole results in increased expression of CAMTA1 mRNA CTD PMID:35436446 Camta1 Rat ethanol affects splicing ISO RGD:1551086 6480464 Ethanol affects the splicing of CAMTA1 mRNA CTD PMID:30319688 Camta1 Rat ethyl methanesulfonate increases expression ISO RGD:1318785 6480464 Ethyl Methanesulfonate results in increased expression of CAMTA1 mRNA CTD PMID:23649840 Camta1 Rat fenamidone decreases expression ISO RGD:1551086 6480464 fenamidone results in decreased expression of CAMTA1 mRNA CTD PMID:27029645 Camta1 Rat fenthion increases expression ISO RGD:1551086 6480464 Fenthion results in increased expression of CAMTA1 mRNA CTD PMID:34813904 Camta1 Rat folic acid multiple interactions ISO RGD:1551086 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation more ... CTD PMID:20938992 Camta1 Rat folic acid decreases expression ISO RGD:1551086 6480464 Folic Acid results in decreased expression of CAMTA1 mRNA CTD PMID:25629700 Camta1 Rat formaldehyde increases expression ISO RGD:1318785 6480464 Formaldehyde results in increased expression of CAMTA1 mRNA CTD PMID:23649840 Camta1 Rat fulvestrant increases methylation ISO RGD:1318785 6480464 Fulvestrant results in increased methylation of CAMTA1 gene CTD PMID:31601247 Camta1 Rat fulvestrant multiple interactions ISO RGD:1318785 6480464 [bisphenol A co-treated with Fulvestrant] affects the methylation of CAMTA1 gene; [bisphenol S co-treated with more ... CTD PMID:31601247 Camta1 Rat genistein affects expression ISO RGD:1551086 6480464 Genistein affects the expression of CAMTA1 mRNA CTD PMID:32186404 Camta1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of CAMTA1 mRNA CTD PMID:33387578 Camta1 Rat glyphosate increases methylation EXP 6480464 Glyphosate results in increased methylation of CAMTA1 gene CTD PMID:31011160 Camta1 Rat L-methionine multiple interactions ISO RGD:1551086 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation more ... CTD PMID:20938992 Camta1 Rat methapyrilene increases methylation ISO RGD:1318785 6480464 Methapyrilene results in increased methylation of CAMTA1 intron CTD PMID:30157460 Camta1 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of CAMTA1 mRNA CTD PMID:30047161 Camta1 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of CAMTA1 gene CTD PMID:35440735 Camta1 Rat methyl methanesulfonate increases expression ISO RGD:1318785 6480464 Methyl Methanesulfonate results in increased expression of CAMTA1 mRNA CTD PMID:23649840 Camta1 Rat methylmercury chloride increases expression ISO RGD:1318785 6480464 methylmercuric chloride results in increased expression of CAMTA1 mRNA CTD PMID:28001369 Camta1 Rat N,N-diethyl-m-toluamide multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of CAMTA1 gene CTD PMID:33148267 Camta1 Rat Nor-9-carboxy-delta9-THC multiple interactions ISO RGD:1318785 6480464 [Cannabinoids results in increased abundance of 11-nor-delta(9)-tetrahydrocannabinol-9-carboxylic acid] which affects the methylation of CAMTA1 gene CTD PMID:30521419 Camta1 Rat paracetamol increases expression ISO RGD:1318785 6480464 Acetaminophen results in increased expression of CAMTA1 mRNA CTD PMID:22230336 Camta1 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of CAMTA1 mRNA CTD PMID:33387578 Camta1 Rat pentanal increases expression ISO RGD:1318785 6480464 pentanal results in increased expression of CAMTA1 mRNA CTD PMID:26079696 Camta1 Rat permethrin multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of CAMTA1 gene CTD PMID:33148267 Camta1 Rat propanal increases expression ISO RGD:1318785 6480464 propionaldehyde results in increased expression of CAMTA1 mRNA CTD PMID:26079696 Camta1 Rat silicon dioxide increases expression ISO RGD:1318785 6480464 Silicon Dioxide analog results in increased expression of CAMTA1 mRNA; Silicon Dioxide results in increased more ... CTD PMID:23806026|PMID:25351596|PMID:25895662 Camta1 Rat silver atom increases expression ISO RGD:1318785 6480464 Silver results in increased expression of CAMTA1 mRNA CTD PMID:26014281 Camta1 Rat silver(0) increases expression ISO RGD:1318785 6480464 Silver results in increased expression of CAMTA1 mRNA CTD PMID:26014281 Camta1 Rat sodium arsenite affects expression ISO RGD:1318785 6480464 sodium arsenite affects the expression of CAMTA1 mRNA CTD PMID:29319823 Camta1 Rat sunitinib increases expression ISO RGD:1318785 6480464 Sunitinib results in increased expression of CAMTA1 mRNA CTD PMID:31533062 Camta1 Rat testosterone increases expression ISO RGD:1318785 6480464 Testosterone results in increased expression of CAMTA1 mRNA CTD PMID:21475673 Camta1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of CAMTA1 mRNA CTD PMID:34492290 Camta1 Rat titanium dioxide decreases expression ISO RGD:1551086 6480464 titanium dioxide results in decreased expression of CAMTA1 mRNA CTD PMID:29264374 Camta1 Rat titanium dioxide decreases methylation ISO RGD:1551086 6480464 titanium dioxide results in decreased methylation of CAMTA1 gene; titanium dioxide results in decreased methylation more ... CTD PMID:35295148 Camta1 Rat toluene decreases expression EXP 6480464 Toluene results in decreased expression of CAMTA1 mRNA CTD PMID:22967744 Camta1 Rat tremolite asbestos decreases expression ISO RGD:1551086 6480464 tremolite results in decreased expression of CAMTA1 mRNA CTD PMID:29279043 Camta1 Rat tributylstannane multiple interactions EXP 6480464 [bisphenol A co-treated with tributyltin] results in increased expression of CAMTA1 mRNA CTD PMID:31129395 Camta1 Rat trichostatin A increases expression ISO RGD:1318785 6480464 trichostatin A results in increased expression of CAMTA1 mRNA CTD PMID:24935251 Camta1 Rat triptonide increases expression ISO RGD:1551086 6480464 triptonide results in increased expression of CAMTA1 mRNA CTD PMID:33045310 Camta1 Rat valproic acid affects expression ISO RGD:1318785 6480464 Valproic Acid affects the expression of CAMTA1 mRNA CTD PMID:25979313 Camta1 Rat valproic acid increases methylation ISO RGD:1318785 6480464 Valproic Acid results in increased methylation of CAMTA1 gene CTD PMID:29154799 Camta1 Rat valproic acid increases expression ISO RGD:1318785 6480464 Valproic Acid results in increased expression of CAMTA1 mRNA CTD PMID:24935251 Camta1 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of CAMTA1 mRNA CTD PMID:23034163 Camta1 Rat vinclozolin decreases methylation EXP 6480464 vinclozolin results in decreased methylation of CAMTA1 gene CTD PMID:31682807 Camta1 Rat zinc atom multiple interactions ISO RGD:1318785 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of CAMTA1 mRNA CTD PMID:18593933 Camta1 Rat zinc(0) multiple interactions ISO RGD:1318785 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of CAMTA1 mRNA CTD PMID:18593933
1,2-dimethylhydrazine (ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2-methylcholine (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 5-aza-2'-deoxycytidine (ISO) 6-propyl-2-thiouracil (EXP) aflatoxin B1 (EXP,ISO) Aflatoxin B2 alpha (ISO) all-trans-retinoic acid (ISO) amphetamine (EXP) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) atrazine (EXP) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) beta-lapachone (ISO) bisphenol A (EXP,ISO) butanal (ISO) cadmium atom (ISO) cadmium dichloride (ISO) cannabidiol (ISO) cantharidin (ISO) carbon nanotube (ISO) CGP 52608 (ISO) choline (ISO) cisplatin (ISO) cyclosporin A (ISO) doxorubicin (EXP,ISO) epoxiconazole (ISO) ethanol (ISO) ethyl methanesulfonate (ISO) fenamidone (ISO) fenthion (ISO) folic acid (ISO) formaldehyde (ISO) fulvestrant (ISO) genistein (ISO) gentamycin (EXP) glyphosate (EXP) L-methionine (ISO) methapyrilene (ISO) methimazole (EXP) methoxychlor (EXP) methyl methanesulfonate (ISO) methylmercury chloride (ISO) N,N-diethyl-m-toluamide (EXP) Nor-9-carboxy-delta9-THC (ISO) paracetamol (EXP,ISO) pentanal (ISO) permethrin (EXP) propanal (ISO) silicon dioxide (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenite (ISO) sunitinib (ISO) testosterone (ISO) thioacetamide (EXP) titanium dioxide (ISO) toluene (EXP) tremolite asbestos (ISO) tributylstannane (EXP) trichostatin A (ISO) triptonide (ISO) valproic acid (ISO) vinclozolin (EXP) zinc atom (ISO) zinc(0) (ISO)
Camta1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 166,791,639 - 167,639,502 (-) NCBI GRCr8 mRatBN7.2 5 161,510,283 - 162,356,902 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 161,510,283 - 162,356,723 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 164,226,976 - 165,059,436 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 166,043,608 - 166,880,482 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 166,005,620 - 166,842,701 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 168,138,207 - 169,017,295 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 168,141,372 - 169,017,295 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 171,715,302 - 172,577,540 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 168,201,249 - 169,046,038 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 5 159,762,457 - 160,564,372 (-) NCBI Celera Cytogenetic Map 5 q36 NCBI
CAMTA1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 6,785,454 - 7,769,706 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 6,785,454 - 7,769,706 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 6,845,514 - 7,829,766 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 6,767,971 - 7,752,351 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 6,779,649 - 7,764,029 NCBI Celera 1 5,960,132 - 6,937,492 (+) NCBI Celera Cytogenetic Map 1 p36.31-p36.23 NCBI HuRef 1 5,994,058 - 6,978,211 (+) NCBI HuRef CHM1_1 1 6,833,955 - 7,817,468 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 6,313,294 - 7,300,752 (+) NCBI T2T-CHM13v2.0
Camta1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 151,143,980 - 151,946,225 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 151,143,982 - 151,946,333 (-) Ensembl GRCm39 Ensembl GRCm38 4 151,059,523 - 151,861,768 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 150,917,322 - 151,861,876 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 150,433,633 - 151,235,866 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 149,903,324 - 150,705,551 (-) NCBI MGSCv36 mm8 Celera 4 153,335,401 - 154,126,558 (-) NCBI Celera Cytogenetic Map 4 E2 NCBI cM Map 4 81.53 NCBI
Camta1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955486 5,116,677 - 5,872,167 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955486 5,115,469 - 5,890,028 (-) NCBI ChiLan1.0 ChiLan1.0
CAMTA1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 220,456,554 - 221,439,290 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 219,097,682 - 220,081,228 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 5,549,742 - 6,532,568 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 6,824,691 - 7,781,265 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 6,824,687 - 7,781,265 (+) Ensembl panpan1.1 panPan2
CAMTA1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 60,566,136 - 61,429,092 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 5 60,580,334 - 61,426,251 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 60,590,405 - 61,437,844 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 60,798,180 - 61,645,946 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 60,798,188 - 61,645,946 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 5 60,796,944 - 61,645,198 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 60,662,147 - 61,509,651 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 61,065,157 - 61,913,319 (+) NCBI UU_Cfam_GSD_1.0
Camta1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 31,039,445 - 31,780,761 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936623 1,526,171 - 2,266,124 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936623 1,759,052 - 2,265,466 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CAMTA1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 67,605,790 - 68,471,920 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 67,605,863 - 68,471,922 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 62,602,664 - 62,678,307 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
CAMTA1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 123,985,812 - 124,957,522 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 123,985,755 - 124,116,124 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666054 28,020,760 - 28,999,369 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Camta1
.
Predicted Target Of
Count of predictions: 577 Count of miRNA genes: 265 Interacting mature miRNAs: 351 Transcripts: ENSRNOT00000066120, ENSRNOT00000067481 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
10053720 Scort26 Serum corticosterone level QTL 26 2.06 0.0147 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 5 124965598 166875058 Rat 631272 Lanf1 Left ventricular atrial natriuretic factor QTL 1 12 heart left ventricle natriuretic peptide A amount (VT:0010596) heart left ventricle natriuretic peptide A level (CMO:0002165) 5 151113452 166875058 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 631562 Apr2 Acute phase response QTL 2 3.7 blood murinoglobulin 1 amount (VT:0010597) plasma murinoglobulin 1 level (CMO:0001931) 5 135927956 166875058 Rat 634349 Bp139 Blood pressure QTL 139 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 128924607 166875058 Rat 61444 Strs2 Sensitivity to stroke QTL 2 4.7 cerebrum integrity trait (VT:0010549) post-insult time to onset of cerebrovascular lesion (CMO:0002343) 5 135929696 166875058 Rat 724525 Bp147 Blood pressure QTL 147 4.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 126424772 166875058 Rat 1549904 Neuinf1 Neuroinflammation QTL 1 3 0 nervous system integrity trait (VT:0010566) blood T lymphocyte count (CMO:0000110) 5 154828214 166875058 Rat 738018 Anxrr4 Anxiety related response QTL 4 5.1 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 5 130130159 166875058 Rat 8552908 Pigfal4 Plasma insulin-like growth factor 1 level QTL 4 6.6 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 128506074 166875058 Rat 7794791 Mcs33 Mammary carcinoma susceptibility QTL 33 1.93 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 5 131345754 166875058 Rat 1354631 Swd2 Spike wave discharge measurement QTL 2 3.64 0.0002 brain electrophysiology trait (VT:0010557) brain total spike-and-wave discharge duration (CMO:0001740) 5 151113452 164465185 Rat 1302790 Scl20 Serum cholesterol level QTL 20 6.4 0.0001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 82394392 166664054 Rat 1598861 Cm64 Cardiac mass QTL 64 2.9 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 127798274 166875058 Rat 631505 Bp103 Blood pressure QTL 103 3.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 132717196 165560427 Rat 1641920 Colcs1 Colorectal carcinoma susceptibility QTL 1 2.99 0.0055 intestine integrity trait (VT:0010554) benign colorectal tumor surface area measurement (CMO:0001799) 5 121846814 166846814 Rat 1598819 Bp292 Blood pressure QTL 292 4.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 127798274 166875058 Rat 8694169 Bw148 Body weight QTL 148 5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 128506074 166875058 Rat 1331721 Bp210 Blood pressure QTL 210 3.413 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 5 143069996 166846814 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
87
86
55
25
55
6
214
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000066120 ⟹ ENSRNOP00000059056
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 161,512,173 - 162,075,624 (-) Ensembl Rnor_6.0 Ensembl 5 168,141,547 - 168,734,296 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000067481 ⟹ ENSRNOP00000063320
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 162,323,172 - 162,330,197 (-) Ensembl Rnor_6.0 Ensembl 5 168,947,202 - 169,017,295 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000092887
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 161,510,283 - 162,356,723 (-) Ensembl Rnor_6.0 Ensembl 5 168,141,372 - 169,017,260 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000092964
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 5 168,985,141 - 168,985,830 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000093092
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 5 168,947,216 - 169,017,295 (-) Ensembl
RefSeq Acc Id:
NM_001195559 ⟹ NP_001182488
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 166,793,101 - 167,639,440 (-) NCBI mRatBN7.2 5 161,510,283 - 162,356,699 (-) NCBI Rnor_6.0 5 168,138,207 - 169,017,295 (-) NCBI Rnor_5.0 5 171,715,302 - 172,577,540 (-) NCBI Celera 5 159,762,457 - 160,564,372 (-) NCBI
Sequence:
GCGGCGGCGGTACGAGGCGCGCGCTCGGGGTCCCGGTCGCGAGGAGGAGGAGGATGTGGCGCGCGGAGGGGAAATGGCTGCCGAAAACAAGCCGGAAGAGCGTTTCCCAAAGTGTATTCTGCGGAACT
hide sequence
RefSeq Acc Id:
NM_001195560 ⟹ NP_001182489
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 167,568,644 - 167,639,440 (-) NCBI mRatBN7.2 5 162,285,896 - 162,356,699 (-) NCBI Rnor_6.0 5 168,947,200 - 169,017,295 (-) NCBI Rnor_5.0 5 171,715,302 - 172,577,540 (-) NCBI Celera 5 160,520,457 - 160,564,372 (-) NCBI
Sequence:
GCGGCGGCGGTACGAGGCGCGCGCTCGGGGTCCCGGTCGCGAGGAGGAGGAGGATGTGGCGCGC
hide sequence
RefSeq Acc Id:
XM_039110436 ⟹ XP_038966364
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 166,793,101 - 167,639,502 (-) NCBI mRatBN7.2 5 161,510,285 - 162,356,764 (-) NCBI
RefSeq Acc Id:
XM_039110438 ⟹ XP_038966366
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 166,793,101 - 167,639,502 (-) NCBI mRatBN7.2 5 161,513,589 - 162,356,766 (-) NCBI
RefSeq Acc Id:
XM_039110444 ⟹ XP_038966372
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 166,793,101 - 167,639,502 (-) NCBI mRatBN7.2 5 161,513,589 - 162,356,764 (-) NCBI
RefSeq Acc Id:
XM_039110445 ⟹ XP_038966373
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 166,793,101 - 167,639,502 (-) NCBI mRatBN7.2 5 161,513,589 - 162,356,766 (-) NCBI
RefSeq Acc Id:
XM_063288086 ⟹ XP_063144156
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 166,791,639 - 167,639,502 (-) NCBI
RefSeq Acc Id:
XM_063288088 ⟹ XP_063144158
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 166,793,101 - 167,639,502 (-) NCBI
RefSeq Acc Id:
XM_063288089 ⟹ XP_063144159
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 166,793,101 - 166,847,288 (-) NCBI
RefSeq Acc Id:
XM_063288090 ⟹ XP_063144160
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 166,793,101 - 166,847,301 (-) NCBI
RefSeq Acc Id:
XM_063288091 ⟹ XP_063144161
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 166,885,208 - 167,639,502 (-) NCBI
RefSeq Acc Id:
XM_063288092 ⟹ XP_063144162
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 166,885,208 - 167,639,502 (-) NCBI
RefSeq Acc Id:
XR_005504502
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 167,555,750 - 167,639,501 (-) NCBI mRatBN7.2 5 162,272,997 - 162,356,755 (-) NCBI
RefSeq Acc Id:
XR_010066426
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 166,793,101 - 167,639,502 (-) NCBI
RefSeq Acc Id:
XR_010066427
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 166,793,101 - 167,639,502 (-) NCBI
RefSeq Acc Id:
XR_010066428
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 166,793,101 - 167,639,502 (-) NCBI
RefSeq Acc Id:
XR_010066429
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 166,793,101 - 167,639,498 (-) NCBI
RefSeq Acc Id:
XR_010066430
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 166,793,101 - 167,639,495 (-) NCBI
RefSeq Acc Id:
XR_010066431
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 166,793,101 - 167,639,489 (-) NCBI
RefSeq Acc Id:
XR_010066432
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 166,793,101 - 167,639,489 (-) NCBI
RefSeq Acc Id:
XR_010066433
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 166,793,101 - 167,606,994 (-) NCBI
RefSeq Acc Id:
XR_010066434
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 166,793,101 - 167,639,502 (-) NCBI
RefSeq Acc Id:
XR_010066435
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 166,793,101 - 167,639,502 (-) NCBI
RefSeq Acc Id:
XR_010066436
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 166,793,101 - 166,876,455 (-) NCBI
RefSeq Acc Id:
XR_010066437
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 166,793,101 - 166,847,288 (-) NCBI
RefSeq Acc Id:
XR_010066438
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 166,793,101 - 166,847,089 (-) NCBI
RefSeq Acc Id:
XR_010066439
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 166,793,101 - 166,867,225 (-) NCBI
RefSeq Acc Id:
XR_010066440
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 166,793,101 - 166,847,288 (-) NCBI
RefSeq Acc Id:
NP_001182488 ⟸ NM_001195559
- Peptide Label:
isoform 1
- UniProtKB:
A0A8I6G9L6 (UniProtKB/TrEMBL), A6IUF2 (UniProtKB/TrEMBL)
- Sequence:
MWRAEGKWLPKTSRKSVSQSVFCGTSTYCVLNTVPPIEDDHGNSNSSHVKIFLPKKLLECLPKCSSLPKERHRWNTNEEIAAYLITFEKHEEWLTTSPKTRPQNGSMILYNRKKVKYRKDGYCWKKRK
hide sequence
RefSeq Acc Id:
NP_001182489 ⟸ NM_001195560
- Peptide Label:
isoform 2
- UniProtKB:
Q3KQW8 (UniProtKB/TrEMBL)
- Sequence:
MWRAEGKWLPKTSRKSVSQSVFCGTSTYCVLNTVPPIEDDHGNSNSSHVKIFLPKKLLECLPKC
hide sequence
Ensembl Acc Id:
ENSRNOP00000063320 ⟸ ENSRNOT00000067481
Ensembl Acc Id:
ENSRNOP00000059056 ⟸ ENSRNOT00000066120
RefSeq Acc Id:
XP_038966364 ⟸ XM_039110436
- Peptide Label:
isoform X1
- UniProtKB:
A6IUF2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038966373 ⟸ XM_039110445
- Peptide Label:
isoform X5
- UniProtKB:
A6IUF2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038966366 ⟸ XM_039110438
- Peptide Label:
isoform X3
- UniProtKB:
A6IUF2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038966372 ⟸ XM_039110444
- Peptide Label:
isoform X4
- UniProtKB:
A6IUF2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063144156 ⟸ XM_063288086
- Peptide Label:
isoform X2
- UniProtKB:
A6IUF2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063144158 ⟸ XM_063288088
- Peptide Label:
isoform X6
- UniProtKB:
A6IUF2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063144160 ⟸ XM_063288090
- Peptide Label:
isoform X8
- UniProtKB:
F1M4M6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063144159 ⟸ XM_063288089
- Peptide Label:
isoform X7
RefSeq Acc Id:
XP_063144162 ⟸ XM_063288092
- Peptide Label:
isoform X10
RefSeq Acc Id:
XP_063144161 ⟸ XM_063288091
- Peptide Label:
isoform X9
RGD ID: 13694291 Promoter ID: EPDNEW_R4814 Type: multiple initiation site Name: Camta1_1 Description: calmodulin binding transcription activator 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 5 169,017,308 - 169,017,368 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2006-02-09
LOC362665
similar to KIAA0833 protein
Symbol and Name status set to provisional
70820 PROVISIONAL
