Symbol:
Krt4
Name:
keratin 4
RGD ID:
1359272
Description:
Predicted to be a structural constituent of skin epidermis. Predicted to be involved in intermediate filament organization; keratinization; and negative regulation of epithelial cell proliferation. Predicted to be located in cell surface and intermediate filament cytoskeleton. Predicted to be active in keratin filament. Human ortholog(s) of this gene implicated in white sponge nevus 1. Orthologous to human KRT4 (keratin 4); INTERACTS WITH 2,3,7,8-Tetrachlorodibenzofuran; 3-chloropropane-1,2-diol; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
CK-4; cytokeratin-4; K4; Kb4; keratin 4, type II; keratin, type II cytoskeletal 4; keratin-4; type II keratin Kb4; type-II keratin Kb4
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
KRT4 (keratin 4)
HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Krt4 (keratin 4)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Krt4 (keratin 4)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
KRT4 (keratin 4)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
KRT73 (keratin 73)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Krt4 (keratin 4)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
KRT4 (keratin 4)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
KRT4 (keratin 4)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Krt4 (keratin 4)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
KRT4 (keratin 4)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Krt4 (keratin 4)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
krt5 (keratin 5)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|PANTHER)
Danio rerio (zebrafish):
krt4 (keratin 4)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|PANTHER)
Caenorhabditis elegans (roundworm):
ifc-2
Alliance
DIOPT (Ensembl Compara|OMA)
Caenorhabditis elegans (roundworm):
ifa-1
Alliance
DIOPT (Ensembl Compara|OrthoFinder)
Caenorhabditis elegans (roundworm):
ifa-3
Alliance
DIOPT (Ensembl Compara|OrthoFinder)
Caenorhabditis elegans (roundworm):
ifb-2
Alliance
DIOPT (Ensembl Compara|OrthoFinder)
Xenopus tropicalis (tropical clawed frog):
krt78.7
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
krt78.6
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 134,924,753 - 134,931,050 (-) NCBI GRCr8 mRatBN7.2 7 133,046,067 - 133,052,027 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 133,046,515 - 133,052,019 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 134,807,258 - 134,813,217 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 137,036,779 - 137,042,738 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 137,015,435 - 137,021,394 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 143,517,562 - 143,523,522 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 143,518,010 - 143,523,503 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 141,315,271 - 141,321,166 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 140,622,632 - 140,628,079 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 140,699,068 - 140,704,516 (-) NCBI Celera 7 129,484,207 - 129,489,655 (-) NCBI Celera Cytogenetic Map 7 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Krt4 Rat 1-chloro-2,4-dinitrobenzene affects binding ISO KRT4 (Homo sapiens) 6480464 Dinitrochlorobenzene binds to KRT4 protein CTD PMID:32991956 Krt4 Rat 17alpha-ethynylestradiol affects expression ISO Krt4 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of KRT4 mRNA CTD PMID:14976129 Krt4 Rat 17alpha-ethynylestradiol multiple interactions ISO Krt4 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of KRT4 mRNA CTD PMID:17942748 Krt4 Rat 17alpha-ethynylestradiol increases expression ISO Krt4 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of KRT4 mRNA CTD PMID:12072388 and PMID:17942748 Krt4 Rat 17beta-estradiol increases expression ISO Krt4 (Mus musculus) 6480464 Estradiol results in increased expression of KRT4 mRNA CTD PMID:19484750 and PMID:37657410 Krt4 Rat 17beta-estradiol multiple interactions ISO Krt4 (Mus musculus) 6480464 Fulvestrant inhibits the reaction [Estradiol results in increased expression of KRT4 mRNA] CTD PMID:37657410 Krt4 Rat 17beta-estradiol decreases expression ISO KRT4 (Homo sapiens) 6480464 Estradiol results in decreased expression of KRT4 mRNA CTD PMID:31614463 and PMID:36828454 Krt4 Rat 17beta-estradiol decreases expression ISO Krt4 (Mus musculus) 6480464 Estradiol results in decreased expression of KRT4 mRNA CTD PMID:39298647 Krt4 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Krt4 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of KRT4 mRNA CTD PMID:17942748 Krt4 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Krt4 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of KRT4 mRNA CTD PMID:21570461 Krt4 Rat 2,3,7,8-Tetrachlorodibenzofuran increases expression EXP 6480464 2 more ... CTD PMID:32109520 Krt4 Rat 2,6-dimethoxyphenol multiple interactions ISO KRT4 (Homo sapiens) 6480464 [pyrogallol 1 more ... CTD PMID:38598786 Krt4 Rat 2-acetamidofluorene increases expression ISO Krt4 (Mus musculus) 6480464 2-Acetylaminofluorene results in increased expression of KRT4 mRNA CTD PMID:17317680 Krt4 Rat 2-acetamidofluorene multiple interactions ISO Krt4 (Mus musculus) 6480464 TRP53 protein modified form affects the reaction [2-Acetylaminofluorene results in increased expression of KRT4 mRNA] CTD PMID:17317680 Krt4 Rat 3-chloropropane-1,2-diol decreases expression EXP 6480464 alpha-Chlorohydrin results in decreased expression of KRT4 protein CTD PMID:26597043 Krt4 Rat 4,4'-sulfonyldiphenol increases expression ISO Krt4 (Mus musculus) 6480464 bisphenol S results in increased expression of KRT4 mRNA CTD PMID:30951980 Krt4 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of KRT4 mRNA CTD PMID:24780913 and PMID:30047161 Krt4 Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of KRT4 mRNA CTD PMID:28959563 Krt4 Rat aflatoxin B1 decreases expression ISO KRT4 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of KRT4 mRNA CTD PMID:32234424 Krt4 Rat all-trans-retinoic acid increases expression ISO KRT4 (Homo sapiens) 6480464 Tretinoin results in increased expression of KRT4 mRNA CTD PMID:16249480 and PMID:23830798 Krt4 Rat ammonium chloride decreases expression EXP 6480464 Ammonium Chloride results in decreased expression of KRT4 protein CTD PMID:16483693 Krt4 Rat aristolochic acid A increases expression ISO KRT4 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of KRT4 mRNA CTD PMID:33212167 Krt4 Rat benzo[a]pyrene increases methylation ISO KRT4 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of KRT4 3' UTR and Benzo(a)pyrene results in increased methylation of KRT4 promoter CTD PMID:27901495 Krt4 Rat benzo[a]pyrene decreases expression ISO KRT4 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of KRT4 mRNA CTD PMID:35870112 Krt4 Rat Benzo[k]fluoranthene decreases expression ISO Krt4 (Mus musculus) 6480464 benzo(k)fluoranthene results in decreased expression of KRT4 mRNA CTD PMID:26377693 Krt4 Rat beryllium sulfate decreases expression ISO KRT4 (Homo sapiens) 6480464 beryllium sulfate results in decreased expression of KRT4 mRNA CTD PMID:35679967 Krt4 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of KRT4 mRNA CTD PMID:25181051 Krt4 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of KRT4 mRNA CTD PMID:32145629 Krt4 Rat bisphenol A decreases expression ISO KRT4 (Homo sapiens) 6480464 bisphenol A results in decreased expression of KRT4 mRNA CTD PMID:29718440 and PMID:36828454 Krt4 Rat bisphenol A increases expression ISO Krt4 (Mus musculus) 6480464 bisphenol A results in increased expression of KRT4 mRNA CTD PMID:30951980 and PMID:37657410 Krt4 Rat bisphenol A decreases methylation ISO Krt4 (Mus musculus) 6480464 bisphenol A results in decreased methylation of KRT4 promoter CTD PMID:27312807 Krt4 Rat bisphenol F increases expression ISO Krt4 (Mus musculus) 6480464 bisphenol F results in increased expression of KRT4 mRNA CTD PMID:30951980 Krt4 Rat buta-1,3-diene increases expression ISO Krt4 (Mus musculus) 6480464 1 and 3-butadiene results in increased expression of KRT4 mRNA CTD PMID:29038090 Krt4 Rat cadmium atom multiple interactions ISO KRT4 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of KRT4 mRNA CTD PMID:35301059 Krt4 Rat cadmium dichloride multiple interactions ISO KRT4 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of KRT4 mRNA CTD PMID:35301059 Krt4 Rat CGP 52608 multiple interactions ISO KRT4 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to KRT4 gene] CTD PMID:28238834 Krt4 Rat chlordecone increases expression ISO Krt4 (Mus musculus) 6480464 Chlordecone results in increased expression of KRT4 mRNA CTD PMID:33711761 Krt4 Rat choline multiple interactions ISO Krt4 (Mus musculus) 6480464 [Methionine co-treated with Choline co-treated with Folic Acid co-treated with Betaine co-treated with Vitamin B 12 co-treated with Zinc co-treated with Phenobarbital] results in increased expression of KRT4 mRNA CTD PMID:33549593 Krt4 Rat chrysene increases expression ISO Krt4 (Mus musculus) 6480464 chrysene results in increased expression of KRT4 mRNA CTD PMID:26377693 Krt4 Rat cisplatin decreases expression ISO KRT4 (Homo sapiens) 6480464 Cisplatin results in decreased expression of KRT4 mRNA CTD PMID:16061661 Krt4 Rat cisplatin multiple interactions ISO KRT4 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of KRT4 mRNA CTD PMID:27392435 Krt4 Rat clofibrate multiple interactions ISO Krt4 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of KRT4 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of KRT4 mRNA] CTD PMID:17585979 Krt4 Rat clofibrate decreases expression ISO Krt4 (Mus musculus) 6480464 Clofibrate results in decreased expression of KRT4 mRNA CTD PMID:17585979 Krt4 Rat copper atom multiple interactions ISO Krt4 (Mus musculus) 6480464 [ATP7A gene mutant form results in increased abundance of Copper] which results in decreased expression of KRT4 mRNA CTD PMID:15467011 Krt4 Rat copper(0) multiple interactions ISO Krt4 (Mus musculus) 6480464 [ATP7A gene mutant form results in increased abundance of Copper] which results in decreased expression of KRT4 mRNA CTD PMID:15467011 Krt4 Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of KRT4 mRNA CTD PMID:26577399 Krt4 Rat cyanocob(III)alamin multiple interactions ISO Krt4 (Mus musculus) 6480464 [Methionine co-treated with Choline co-treated with Folic Acid co-treated with Betaine co-treated with Vitamin B 12 co-treated with Zinc co-treated with Phenobarbital] results in increased expression of KRT4 mRNA CTD PMID:33549593 Krt4 Rat cyclosporin A decreases expression ISO KRT4 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of KRT4 mRNA CTD PMID:33631201 Krt4 Rat cylindrospermopsin increases expression ISO KRT4 (Homo sapiens) 6480464 cylindrospermopsin results in increased expression of KRT4 mRNA CTD PMID:24921660 Krt4 Rat diethylstilbestrol increases expression ISO Krt4 (Mus musculus) 6480464 Diethylstilbestrol results in increased expression of KRT4 mRNA CTD PMID:15171707 Krt4 Rat dimethylarsinic acid increases expression ISO Krt4 (Mus musculus) 6480464 Cacodylic Acid results in increased expression of KRT4 mRNA CTD PMID:32052077 Krt4 Rat dioxygen multiple interactions EXP 6480464 [Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in increased expression of KRT4 mRNA CTD PMID:33729688 Krt4 Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of KRT4 mRNA CTD PMID:21551480 Krt4 Rat fenvalerate decreases expression EXP 6480464 fenvalerate results in decreased expression of KRT4 mRNA CTD PMID:30307764 Krt4 Rat folic acid multiple interactions ISO Krt4 (Mus musculus) 6480464 [Methionine co-treated with Choline co-treated with Folic Acid co-treated with Betaine co-treated with Vitamin B 12 co-treated with Zinc co-treated with Phenobarbital] results in increased expression of KRT4 mRNA CTD PMID:33549593 Krt4 Rat fonofos increases methylation ISO KRT4 (Homo sapiens) 6480464 Fonofos results in increased methylation of KRT4 promoter CTD PMID:22847954 Krt4 Rat fulvestrant multiple interactions ISO Krt4 (Mus musculus) 6480464 Fulvestrant inhibits the reaction [Estradiol results in increased expression of KRT4 mRNA] CTD PMID:37657410 Krt4 Rat furfural multiple interactions ISO KRT4 (Homo sapiens) 6480464 [pyrogallol 1 more ... CTD PMID:38598786 Krt4 Rat glycidyl methacrylate decreases expression ISO KRT4 (Homo sapiens) 6480464 glycidyl methacrylate results in decreased expression of KRT4 protein CTD PMID:36641056 Krt4 Rat glycine betaine multiple interactions ISO Krt4 (Mus musculus) 6480464 [Methionine co-treated with Choline co-treated with Folic Acid co-treated with Betaine co-treated with Vitamin B 12 co-treated with Zinc co-treated with Phenobarbital] results in increased expression of KRT4 mRNA CTD PMID:33549593 Krt4 Rat glyphosate increases expression ISO Krt4 (Mus musculus) 6480464 Glyphosate results in increased expression of KRT4 mRNA CTD PMID:37657410 Krt4 Rat indole-3-methanol multiple interactions EXP 6480464 [indole-3-carbinol co-treated with Diethylnitrosamine] results in increased expression of KRT4 mRNA CTD PMID:22129741 Krt4 Rat L-methionine multiple interactions ISO Krt4 (Mus musculus) 6480464 [Methionine co-treated with Choline co-treated with Folic Acid co-treated with Betaine co-treated with Vitamin B 12 co-treated with Zinc co-treated with Phenobarbital] results in increased expression of KRT4 mRNA CTD PMID:33549593 Krt4 Rat lipopolysaccharide increases expression ISO Krt4 (Mus musculus) 6480464 Lipopolysaccharides results in increased expression of KRT4 mRNA CTD PMID:12057914 Krt4 Rat methylmercury chloride increases expression ISO KRT4 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of KRT4 mRNA CTD PMID:28001369 Krt4 Rat N-nitrosodiethylamine multiple interactions ISO Krt4 (Mus musculus) 6480464 [Diethylnitrosamine co-treated with Phenobarbital] results in increased expression of KRT4 mRNA CTD PMID:24535843 Krt4 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [indole-3-carbinol co-treated with Diethylnitrosamine] results in increased expression of KRT4 mRNA CTD PMID:22129741 Krt4 Rat N-Nitrosopyrrolidine decreases expression ISO KRT4 (Homo sapiens) 6480464 N-Nitrosopyrrolidine results in decreased expression of KRT4 mRNA CTD PMID:32234424 Krt4 Rat nickel atom decreases expression ISO KRT4 (Homo sapiens) 6480464 Nickel results in decreased expression of KRT4 mRNA CTD PMID:24768652 Krt4 Rat O-methyleugenol decreases expression ISO KRT4 (Homo sapiens) 6480464 methyleugenol results in decreased expression of KRT4 mRNA CTD PMID:32234424 Krt4 Rat ozone multiple interactions ISO Krt4 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of KRT4 mRNA and [Air Pollutants results in increased abundance of Ozone] which results in increased expression of KRT4 mRNA CTD PMID:34911549 Krt4 Rat ozone increases expression ISO Krt4 (Mus musculus) 6480464 Ozone results in increased expression of KRT4 mRNA CTD PMID:33026818 Krt4 Rat paracetamol multiple interactions ISO Krt4 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of KRT4 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of KRT4 mRNA] CTD PMID:17585979 Krt4 Rat parathion increases methylation ISO KRT4 (Homo sapiens) 6480464 Parathion results in increased methylation of KRT4 promoter CTD PMID:22847954 Krt4 Rat pentane-2,3-dione increases expression ISO KRT4 (Homo sapiens) 6480464 2 and 3-pentanedione results in increased expression of KRT4 mRNA CTD PMID:30710127 Krt4 Rat perfluorooctane-1-sulfonic acid increases expression ISO KRT4 (Homo sapiens) 6480464 perfluorooctane sulfonic acid results in increased expression of KRT4 mRNA CTD PMID:32588087 Krt4 Rat phenobarbital multiple interactions ISO Krt4 (Mus musculus) 6480464 [Diethylnitrosamine co-treated with Phenobarbital] results in increased expression of KRT4 mRNA and [Methionine co-treated with Choline co-treated with Folic Acid co-treated with Betaine co-treated with Vitamin B 12 co-treated with Zinc co-treated with Phenobarbital] results in increased expression of KRT4 mRNA CTD PMID:24535843 and PMID:33549593 Krt4 Rat phenobarbital decreases expression EXP 6480464 Phenobarbital results in decreased expression of KRT4 mRNA CTD PMID:30047161 Krt4 Rat phenobarbital increases expression ISO Krt4 (Mus musculus) 6480464 Phenobarbital results in increased expression of KRT4 mRNA CTD PMID:19270015 more ... Krt4 Rat pirinixic acid multiple interactions ISO Krt4 (Mus musculus) 6480464 PPARA protein promotes the reaction [pirinixic acid results in decreased expression of KRT4 mRNA] CTD PMID:20059764 Krt4 Rat pirinixic acid decreases expression ISO Krt4 (Mus musculus) 6480464 pirinixic acid results in decreased expression of KRT4 mRNA CTD PMID:20059764 Krt4 Rat pirinixic acid multiple interactions ISO KRT4 (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of KRT4 mRNA CTD PMID:19710929 Krt4 Rat potassium dichromate decreases expression ISO Krt4 (Mus musculus) 6480464 Potassium Dichromate results in decreased expression of KRT4 mRNA CTD PMID:23608068 Krt4 Rat propanal decreases expression ISO KRT4 (Homo sapiens) 6480464 propionaldehyde results in decreased expression of KRT4 mRNA CTD PMID:26079696 Krt4 Rat propiconazole increases expression ISO Krt4 (Mus musculus) 6480464 propiconazole results in increased expression of KRT4 mRNA CTD PMID:21278054 Krt4 Rat silicon dioxide decreases expression ISO KRT4 (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of KRT4 mRNA and Silicon Dioxide results in decreased expression of KRT4 mRNA CTD PMID:25351596 and PMID:25895662 Krt4 Rat sodium arsenite increases expression ISO KRT4 (Homo sapiens) 6480464 sodium arsenite results in increased expression of KRT4 mRNA CTD PMID:29301061 Krt4 Rat sodium chloride multiple interactions ISO KRT4 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of KRT4 protein more ... CTD PMID:38598786 Krt4 Rat sulforaphane decreases expression ISO KRT4 (Homo sapiens) 6480464 sulforaphane results in decreased expression of KRT4 mRNA CTD PMID:31838189 Krt4 Rat tamoxifen increases expression ISO Krt4 (Mus musculus) 6480464 Tamoxifen results in increased expression of KRT4 mRNA CTD PMID:25123088 Krt4 Rat terbufos increases methylation ISO KRT4 (Homo sapiens) 6480464 terbufos results in increased methylation of KRT4 promoter CTD PMID:22847954 Krt4 Rat tetrachloromethane increases expression ISO Krt4 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of KRT4 mRNA CTD PMID:15056808 Krt4 Rat triptonide increases expression ISO Krt4 (Mus musculus) 6480464 triptonide results in increased expression of KRT4 mRNA CTD PMID:33045310 Krt4 Rat valproic acid increases methylation ISO KRT4 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of KRT4 gene CTD PMID:29154799 Krt4 Rat zearalenone decreases expression ISO KRT4 (Homo sapiens) 6480464 Zearalenone results in decreased expression of KRT4 mRNA CTD PMID:36828454 Krt4 Rat zinc atom multiple interactions ISO Krt4 (Mus musculus) 6480464 [Methionine co-treated with Choline co-treated with Folic Acid co-treated with Betaine co-treated with Vitamin B 12 co-treated with Zinc co-treated with Phenobarbital] results in increased expression of KRT4 mRNA CTD PMID:33549593 Krt4 Rat zinc(0) multiple interactions ISO Krt4 (Mus musculus) 6480464 [Methionine co-treated with Choline co-treated with Folic Acid co-treated with Betaine co-treated with Vitamin B 12 co-treated with Zinc co-treated with Phenobarbital] results in increased expression of KRT4 mRNA CTD PMID:33549593
1-chloro-2,4-dinitrobenzene (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,6-dimethoxyphenol (ISO) 2-acetamidofluorene (ISO) 3-chloropropane-1,2-diol (EXP) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) acrylamide (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) ammonium chloride (EXP) aristolochic acid A (ISO) benzo[a]pyrene (ISO) Benzo[k]fluoranthene (ISO) beryllium sulfate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) buta-1,3-diene (ISO) cadmium atom (ISO) cadmium dichloride (ISO) CGP 52608 (ISO) chlordecone (ISO) choline (ISO) chrysene (ISO) cisplatin (ISO) clofibrate (ISO) copper atom (ISO) copper(0) (ISO) Cuprizon (EXP) cyanocob(III)alamin (ISO) cyclosporin A (ISO) cylindrospermopsin (ISO) diethylstilbestrol (ISO) dimethylarsinic acid (ISO) dioxygen (EXP) diuron (EXP) fenvalerate (EXP) folic acid (ISO) fonofos (ISO) fulvestrant (ISO) furfural (ISO) glycidyl methacrylate (ISO) glycine betaine (ISO) glyphosate (ISO) indole-3-methanol (EXP) L-methionine (ISO) lipopolysaccharide (ISO) methylmercury chloride (ISO) N-nitrosodiethylamine (EXP,ISO) N-Nitrosopyrrolidine (ISO) nickel atom (ISO) O-methyleugenol (ISO) ozone (ISO) paracetamol (ISO) parathion (ISO) pentane-2,3-dione (ISO) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (EXP,ISO) pirinixic acid (ISO) potassium dichromate (ISO) propanal (ISO) propiconazole (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sodium chloride (ISO) sulforaphane (ISO) tamoxifen (ISO) terbufos (ISO) tetrachloromethane (ISO) triptonide (ISO) valproic acid (ISO) zearalenone (ISO) zinc atom (ISO) zinc(0) (ISO)
Krt4 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 134,924,753 - 134,931,050 (-) NCBI GRCr8 mRatBN7.2 7 133,046,067 - 133,052,027 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 133,046,515 - 133,052,019 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 134,807,258 - 134,813,217 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 137,036,779 - 137,042,738 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 137,015,435 - 137,021,394 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 143,517,562 - 143,523,522 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 143,518,010 - 143,523,503 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 141,315,271 - 141,321,166 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 140,622,632 - 140,628,079 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 140,699,068 - 140,704,516 (-) NCBI Celera 7 129,484,207 - 129,489,655 (-) NCBI Celera Cytogenetic Map 7 q36 NCBI
KRT4 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 52,806,549 - 52,814,116 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 52,806,549 - 52,814,116 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 53,200,333 - 53,207,900 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 51,486,600 - 51,494,602 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 12 51,486,600 - 51,494,602 NCBI Celera 12 52,846,566 - 52,854,610 (-) NCBI Celera Cytogenetic Map 12 q13.13 NCBI HuRef 12 50,244,297 - 50,251,912 (-) NCBI HuRef CHM1_1 12 53,167,133 - 53,174,706 (-) NCBI CHM1_1 T2T-CHM13v2.0 12 52,771,007 - 52,778,574 (-) NCBI T2T-CHM13v2.0
Krt4 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 15 101,826,970 - 101,833,170 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 15 101,826,970 - 101,833,170 (-) Ensembl GRCm39 Ensembl GRCm38 15 101,918,535 - 101,924,735 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 15 101,918,535 - 101,924,735 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 15 101,748,966 - 101,755,166 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 15 101,746,570 - 101,752,745 (-) NCBI MGSCv36 mm8 Celera 15 104,070,333 - 104,076,533 (-) NCBI Celera Cytogenetic Map 15 F2 NCBI cM Map 15 57.13 NCBI
Krt4 (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955458 108,738 - 115,807 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955458 108,803 - 115,755 (-) NCBI ChiLan1.0 ChiLan1.0
KRT4 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 10 41,378,610 - 41,385,724 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 12 41,375,373 - 41,382,487 (+) NCBI NHGRI_mPanPan1
KRT73 (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 27 2,477,859 - 2,488,437 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 27 43,765,584 - 43,776,130 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 27 2,476,138 - 2,486,934 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 27 2,476,277 - 2,486,820 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 27 2,493,978 - 2,504,515 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 27 2,479,145 - 2,489,683 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 27 44,163,942 - 44,174,486 (-) NCBI UU_Cfam_GSD_1.0
Krt4 (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404945 62,983,065 - 62,989,584 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936512 10,175,747 - 10,181,747 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936512 10,175,240 - 10,181,765 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
KRT4 (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 5 18,091,743 - 18,099,178 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 5 18,091,742 - 18,099,086 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 5 18,585,174 - 18,592,517 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
KRT4 (Chlorocebus sabaeus - green monkey)
Krt4 (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 171 Count of miRNA genes: 126 Interacting mature miRNAs: 137 Transcripts: ENSRNOT00000012943 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1300179 Kidm5 Kidney mass QTL 5 3.51 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 43747012 135012528 Rat 1354582 Stl11 Serum triglyceride level QTL 11 3.42 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 7 119513385 135012528 Rat 731176 Glom5 Glomerulus QTL 5 2.5 0.0035 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 7 96670164 135012528 Rat 1300112 Bp183 Blood pressure QTL 183 3.51 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 7 111182207 135012528 Rat 2306821 Bp335 Blood pressure QTL 335 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 106571501 135012528 Rat 631663 Bw6 Body weight QTL 6 3.4 body mass (VT:0001259) body weight (CMO:0000012) 7 111075573 134976056 Rat 1331731 Bp216 Blood pressure QTL 216 2.851 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 102297359 133492884 Rat 731174 Uae23 Urinary albumin excretion QTL 23 2.4 0.0042 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 7 104603555 135012528 Rat 1357339 Stl14 Serum triglyceride level QTL 14 3.45 0.0001 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 7 112729683 133492707 Rat 1331748 Bp215 Blood pressure QTL 215 4.043 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 112308254 133492884 Rat 1358914 Bp266 Blood pressure QTL 266 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 83591953 134666232 Rat 2299163 Iddm34 Insulin dependent diabetes mellitus QTL 34 2.71 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 7 91281130 135012528 Rat 70173 Niddm19 Non-insulin dependent diabetes mellitus QTL 19 4.33 0.00005 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 7 64002457 135012528 Rat 1549899 Stresp8 Stress response QTL 8 4.37 0.0008 stress-related behavior trait (VT:0010451) defensive burying duration (CMO:0001961) 7 90482196 135012528 Rat 1358891 Bp265 Blood pressure QTL 265 2.21 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 83591953 134666232 Rat
AA818868
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 133,046,199 - 133,046,303 (+) MAPPER mRatBN7.2 Rnor_6.0 7 143,517,695 - 143,517,798 NCBI Rnor6.0 Rnor_5.0 7 141,315,404 - 141,315,507 UniSTS Rnor5.0 RGSC_v3.4 7 140,622,317 - 140,622,420 UniSTS RGSC3.4 Celera 7 129,483,892 - 129,483,995 UniSTS RH 3.4 Map 7 1065.3 UniSTS Cytogenetic Map 7 q36 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
8
8
46
57
91
90
59
19
59
6
197
81
37
41
44
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000012943 ⟹ ENSRNOP00000012943
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 7 143,518,010 - 143,523,457 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000082264 ⟹ ENSRNOP00000073894
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 133,046,515 - 133,052,019 (-) Ensembl Rnor_6.0 Ensembl 7 143,518,010 - 143,523,503 (-) Ensembl
RefSeq Acc Id:
NM_001008806 ⟹ NP_001008806
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 134,924,753 - 134,930,713 (-) NCBI mRatBN7.2 7 133,046,067 - 133,052,027 (-) NCBI Rnor_6.0 7 143,518,010 - 143,523,457 (-) NCBI Rnor_5.0 7 141,315,271 - 141,321,166 (-) NCBI RGSC_v3.4 7 140,622,632 - 140,628,079 (-) RGD Celera 7 129,484,207 - 129,489,655 (-) RGD
Sequence:
ATGATCTCCAGACAGTCAAGCGTCCGCGGAGTCTCCCGGGGCTTTAGCAGTGGCTCAGCTGTTGCCGGTGGAGTCAAGCGGGTGGCCTTCAGCTCAGCCTCCATGTCTGGGGGTGCCGGGCGCTGCTC CTCTGGGGGTTTCGGCAGCAGGAGTCTTTACAACCTCGGGGGTCACAAGAGTATCTCCATGAGCGTGGCTGGGTCCTGCCAAGGCGGTGGCTACGGCGGTGCCGGAGGCTTCGGTGTTGGAGGATACG GTGCTGGGTTTGGTGCCGGTGGTTTTGGCGGTGGCTTTGGAGGCTCCTTCAACGGCCGAGGCGGTCCTGGTTTCCCTGTCTGTCCTGCTGGAGGTATTCAGGAAGTCACCATCAACCAGAGCCTGCTG ACACCTCTTCAGGTGGAAATTGACCCAGAGATCCAGAAAATCCGCACAGCAGAGCGCGAGCAGATCAAGACCCTCAACAACAAATTTGCTTCCTTCATCGACAAGGTGCGGTTTTTAGAGCAACAGAA CAAAGTCCTGGAGACCAAATGGAACCTCCTCCAGCAGCAGACAACCACCACATCCCCCAGAAACCTGGATCCTTTCTTTGAGACGTACATCAACGCCTTAAGGAAGAACCTGGACACTTTGAGCAATG ACAAAGGTCGCCTACAGTCAGAGCTGAAGCTCATGCAGGACAGTGTGGAGGACTTCAAGACCAAGTATGAGGAAGAGATCAACAAGCGCACAGCTGCAGAGAACGACTTTGTGGTCCTCAAGAAAGAT GTGGATGCTGCTTACATGATCAAGGTGGAGTTAGAGGCCAAAATGGAAAGCCTTAAGGATGAGATCAACTTCATGAGAGTCCTCTATGAAGCGGAGCTGTCCCAGATGCAGACACATGTCTCAGACAC ATCTGTGGTGCTGTCCATGGATAATAACCGGAACCTGGACCTGGACGGCATCATCGCTGAGGTCCGAGCCCAGTATGAGGAGATTGCTCGGAAGAGCAAGGCTGAGGTTGAGTCCTGGTACCAGATCA AGGTCCAGCAGCTCCAGATGTCAGCTGACCAGCACGGAGATAGCCTGAAGAGCACCAAGAATGAGATCTCAGAACTCAACAGGATGATCCAGAGGATACGGTCCGAGATTGAGAACATCAAGAAGCAG ACTCTGCAGGCATCTGTGGCTGATGCAGAGCAACGTGGAGAGCTGGCCCTCAAAGATGCCTACACCAAACGCGCAGACCTGGAGACTGCACTGCAGAAGGCCAAGGAGGACCTGGCCCGGCTGATGAG GGACTACCAGGAGCTCATGAATGTCAAGCTGGCCCTGGATGTGGAGATCGCCACCTACCGCAAGCTACTGGAGGGCGAGGAGTGCAGGATGTCTGGAGAATGCAAGAGTGCTGTGAGCATCTCCGTAG TTGGTGGCAGTGCCAGCATTGGTGGCAGCGGTGGCATCGGCCTTGGCCTGGGTAGCGGTTTTGGCTCTGGTTCCTGTTCTGGAAGTGGCTTCGGATTTGGTGGCGGTATTTATGGCAGCTCTGGTACC AAGATCACCTCTTCCGCCACCATCACCAAGAGATCCCCACGAACAAGACAGGATCCTGATGGCCTTCAGCCCTGA
hide sequence
RefSeq Acc Id:
XM_006242395 ⟹ XP_006242457
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 134,924,753 - 134,931,050 (-) NCBI mRatBN7.2 7 133,046,067 - 133,052,021 (-) NCBI Rnor_6.0 7 143,517,562 - 143,523,522 (-) NCBI Rnor_5.0 7 141,315,271 - 141,321,166 (-) NCBI
Sequence:
ATTCAGGACCTAGCTCTTGCTTCGCTTCGGTTCTACGCTCGTCGCAGCTGCCTCATCTCTCAGCCATGATCTCCAGACAGTCAAGCGTCCGCGGAGTCTCCCGGGGCTTTAGCAGTGGCTCAGCTGTT GCCGGTGGAGTCAAGCGGGTGGCCTTCAGCTCAGCCTCCATGTCTGGGGGTGCCGGGCGCTGCTCCTCTGGGGGTTTCGGCAGCAGGAGTCTTTACAACCTCGGGGGTCACAAGAGTATCTCCATGAG CGTGGCTGGGTCCTGCCAAGGCGGTGGCTACGGCGGTGCCGGAGGCTTCGGTGTTGGAGGATACGGTGCTGGGTTTGGTGCCGGTGGTTTTGGCGGTGGCTTTGGAGGCTCCTTCAACGGCCGAGGCG GTCCTGGTTTCCCTGTCTGTCCTGCTGGAGGTATTCAGGAAGTCACCATCAACCAGAGCCTGCTGACACCTCTTCAGGTGGAAATTGACCCAGAGATCCAGAAAATCCGCACAGCAGAGCGCGAGCAG ATCAAGACCCTCAACAACAAATTTGCTTCCTTCATCGACAAGGTGCGGTTTTTAGAGCAACAGAACAAAGTCCTGGAGACCAAATGGAACCTCCTCCAGCAGCAGACAACCACCACATCCCCCAGAAA CCTGGATCCTTTCTTTGAGACGTACATCAACGCCTTAAGGAAGAACCTGGACACTTTGAGCAATGACAAAGGTCGCCTACAGTCAGAGCTGAAGCTCATGCAGGACAGTGTGGAGGACTTCAAGACCA AGTATGAGGAAGAGATCAACAAGCGCACAGCTGCAGAGAACGACTTTGTGGTCCTCAAGAAAGATGTGGATGCTGCTTACATGATCAAGGTGGAGTTAGAGGCCAAAATGGAAAGCCTTAAGGATGAG ATCAACTTCATGAGAGTCCTCTATGAAGCGGAGCTGTCCCAGATGCAGACACATGTCTCAGACACATCTGTGGTGCTGTCCATGGATAATAACCGGAACCTGGACCTGGACGGCATCATCGCTGAGGT CCGAGCCCAGTATGAGGAGATTGCTCGGAAGAGCAAGGCTGAGGTTGAGTCCTGGTACCAGATCAAGGTCCAGCAGCTCCAGATGTCAGCTGACCAGCACGGAGATAGCCTGAAGAGCACCAAGAATG AGATCTCAGAACTCAACAGGATGATCCAGAGGATACGGTCCGAGATTGAGAACATCAAGAAGCAGTCCCAGACTCTGCAGGCATCTGTGGCTGATGCAGAGCAACGTGGAGAGCTGGCCCTCAAAGAT GCCTACACCAAACGCGCAGACCTGGAGACTGCACTGCAGAAGGCCAAGGAGGACCTGGCCCGGCTGATGAGGGACTACCAGGAGCTCATGAATGTCAAGCTGGCCCTGGATGTGGAGATCGCCACCTA CCGCAAGCTACTGGAGGGCGAGGAGTGCAGGATGTCTGGAGAATGCAAGAGTGCTGTGAGCATCTCCGTAGTTGGTGGCAGTGCCAGCATTGGTGGCAGCGGTGGCATCGGCCTTGGCCTGGGTAGCG GTTTTGGCTCTGGTTCCTGTTCTGGAAGTGGCTTCGGATTTGGTGGCGGTATTTATGGCAGCTCTGGTACCAAGATCACCTCTTCCGCCACCATCACCAAGAGATCCCCACGATAGACAAGACAGGAT CCTGATGGCCTTCAGCCCTGATATCTCTTGTGTATCCTTCACTTCACCCCCTACCCCCAGTCTTCCTTCCTGGTGCTCATCTTGTTAGTCTCCCTCCTCTGCCTTGGTTCCTCAGTTCCAGGATGACC TTCTTGGCCATGGTGTGGCCTCTGTCCTCCTGGAGCCTCGTAGCTTCTTCTCAACTTGGGCCGAGTGACCCCCCTGCATGGGAGGGGTGTCTGATTTCACCCCAATGGACAGAGGGAATGAAGAGCAG GAACTCCTTCTGCAGAAGTACAGGGTCACTCTCGGCCCCTCCAGTCACACCAGCCCCCACCTGATCCTGGACATCCATCTGCTACAACGACACTCATTCTCCATCCCCTGACAGCAACGGGCTCTGTC CGGTTGAGACAAAGACTGCTTGGTGTCCTGTTCAGCCCTGCTCCTCTCTCTACTCATCCCCAATAAAAATGCTTTTTGTCATTCA
hide sequence
RefSeq Acc Id:
XM_039079345 ⟹ XP_038935273
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 134,924,753 - 134,927,631 (-) NCBI mRatBN7.2 7 133,046,067 - 133,048,946 (-) NCBI
RefSeq Acc Id:
NP_001008806 ⟸ NM_001008806
- UniProtKB:
Q6IG00 (UniProtKB/Swiss-Prot)
- Sequence:
MISRQSSVRGVSRGFSSGSAVAGGVKRVAFSSASMSGGAGRCSSGGFGSRSLYNLGGHKSISMSVAGSCQGGGYGGAGGFGVGGYGAGFGAGGFGGGFGGSFNGRGGPGFPVCPAGGIQEVTINQSLL TPLQVEIDPEIQKIRTAEREQIKTLNNKFASFIDKVRFLEQQNKVLETKWNLLQQQTTTTSPRNLDPFFETYINALRKNLDTLSNDKGRLQSELKLMQDSVEDFKTKYEEEINKRTAAENDFVVLKKD VDAAYMIKVELEAKMESLKDEINFMRVLYEAELSQMQTHVSDTSVVLSMDNNRNLDLDGIIAEVRAQYEEIARKSKAEVESWYQIKVQQLQMSADQHGDSLKSTKNEISELNRMIQRIRSEIENIKKQ TLQASVADAEQRGELALKDAYTKRADLETALQKAKEDLARLMRDYQELMNVKLALDVEIATYRKLLEGEECRMSGECKSAVSISVVGGSASIGGSGGIGLGLGSGFGSGSCSGSGFGFGGGIYGSSGT KITSSATITKRSPRTRQDPDGLQP
hide sequence
RefSeq Acc Id:
XP_006242457 ⟸ XM_006242395
- Peptide Label:
isoform X1
- UniProtKB:
Q6IG00 (UniProtKB/Swiss-Prot), A0A0G2K6P7 (UniProtKB/TrEMBL)
- Sequence:
MISRQSSVRGVSRGFSSGSAVAGGVKRVAFSSASMSGGAGRCSSGGFGSRSLYNLGGHKSISMS VAGSCQGGGYGGAGGFGVGGYGAGFGAGGFGGGFGGSFNGRGGPGFPVCPAGGIQEVTINQSLLTPLQVEIDPEIQKIRTAEREQIKTLNNKFASFIDKVRFLEQQNKVLETKWNLLQQQTTTTSPRN LDPFFETYINALRKNLDTLSNDKGRLQSELKLMQDSVEDFKTKYEEEINKRTAAENDFVVLKKDVDAAYMIKVELEAKMESLKDEINFMRVLYEAELSQMQTHVSDTSVVLSMDNNRNLDLDGIIAEV RAQYEEIARKSKAEVESWYQIKVQQLQMSADQHGDSLKSTKNEISELNRMIQRIRSEIENIKKQSQTLQASVADAEQRGELALKDAYTKRADLETALQKAKEDLARLMRDYQELMNVKLALDVEIATY RKLLEGEECRMSGECKSAVSISVVGGSASIGGSGGIGLGLGSGFGSGSCSGSGFGFGGGIYGSSGTKITSSATITKRSPR
hide sequence
Ensembl Acc Id:
ENSRNOP00000073894 ⟸ ENSRNOT00000082264
Ensembl Acc Id:
ENSRNOP00000012943 ⟸ ENSRNOT00000012943
RefSeq Acc Id:
XP_038935273 ⟸ XM_039079345
- Peptide Label:
isoform X2
- UniProtKB:
A6KCR8 (UniProtKB/TrEMBL)
RGD ID: 13695684
Promoter ID: EPDNEW_R6208
Type: single initiation site
Name: Krt4_1
Description: keratin 4
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 7 143,523,528 - 143,523,588 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-03-15
Krt4
keratin 4
Krt4
keratin 4, type II
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2015-01-28
Krt4
keratin 4, type II
Krt4
keratin 4
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2008-03-04
Krt4
keratin 4
Kb4
type II keratin Kb4
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2006-03-30
Kb4
type II keratin Kb4
Symbol and Name status set to approved
1299863
APPROVED
2005-07-29
Kb4
type II keratin Kb4
Symbol and Name status set to provisional
70820
PROVISIONAL