Symbol:
Xpo6
Name:
exportin 6
RGD ID:
1311491
Description:
Predicted to enable nuclear export signal receptor activity. Predicted to be involved in protein export from nucleus. Predicted to be located in cytosol; nuclear lumen; and plasma membrane. Predicted to be part of protein-containing complex. Orthologous to human XPO6 (exportin 6); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; bisphenol A; flutamide.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
exportin-6; LOC293476
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
XPO6 (exportin 6) RGD
RGD
Mus musculus (house mouse):
Xpo6 (exportin 6) RGD
RGD
Chinchilla lanigera (long-tailed chinchilla):
Xpo6 (exportin 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
XPO6 (exportin 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
XPO6 (exportin 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Xpo6 (exportin 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
XPO6 (exportin 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
XPO6 (exportin 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Xpo6 (exportin 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
KPNB1 (karyopherin subunit beta 1) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
XPO6 (exportin 6)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Xpo6 (exportin 6)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
xpo6 (exportin 6)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
ebo
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
xpo6
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 190,102,719 - 190,192,138 (-) NCBI GRCr8 mRatBN7.2 1 180,672,114 - 180,761,543 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 180,672,119 - 180,761,543 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 189,003,284 - 189,092,561 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 196,189,323 - 196,278,608 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 188,872,436 - 188,961,827 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 197,500,509 - 197,590,382 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 197,500,514 - 197,590,277 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 204,484,091 - 204,574,002 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 185,179,733 - 185,269,588 NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 1 178,332,154 - 178,421,776 (-) NCBI Celera Cytogenetic Map 1 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Xpo6 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO XPO6 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of XPO6 mRNA CTD PMID:22079256 Xpo6 Rat 1,2-dimethylhydrazine increases expression ISO Xpo6 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of XPO6 mRNA CTD PMID:22206623 Xpo6 Rat 17beta-estradiol increases expression ISO XPO6 (Homo sapiens) 6480464 Estradiol results in increased expression of XPO6 mRNA CTD PMID:23019147 and PMID:31614463 Xpo6 Rat 17beta-estradiol increases expression ISO Xpo6 (Mus musculus) 6480464 Estradiol results in increased expression of XPO6 mRNA CTD PMID:39298647 Xpo6 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Xpo6 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of XPO6 mRNA CTD PMID:21570461 Xpo6 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of XPO6 mRNA CTD PMID:34747641 Xpo6 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO XPO6 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of XPO6 mRNA CTD PMID:22903824 Xpo6 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Xpo6 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of XPO6 mRNA CTD PMID:19770486 Xpo6 Rat 2-methylcholine affects expression ISO XPO6 (Homo sapiens) 6480464 beta-methylcholine affects the expression of XPO6 mRNA CTD PMID:21179406 Xpo6 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO XPO6 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of XPO6 mRNA more ... CTD PMID:28628672 Xpo6 Rat 4,4'-sulfonyldiphenol multiple interactions ISO XPO6 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of XPO6 mRNA CTD PMID:28628672 Xpo6 Rat 4,4'-sulfonyldiphenol decreases expression ISO Xpo6 (Mus musculus) 6480464 bisphenol S results in decreased expression of XPO6 mRNA CTD PMID:39298647 Xpo6 Rat acrolein multiple interactions ISO XPO6 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of XPO6 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of XPO6 mRNA CTD PMID:32699268 Xpo6 Rat all-trans-retinoic acid decreases expression ISO XPO6 (Homo sapiens) 6480464 Tretinoin results in decreased expression of XPO6 mRNA CTD PMID:18614847 Xpo6 Rat alpha-pinene multiple interactions ISO XPO6 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of XPO6 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of XPO6 mRNA CTD PMID:32699268 Xpo6 Rat antirheumatic drug decreases expression ISO XPO6 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of XPO6 mRNA CTD PMID:24449571 Xpo6 Rat benzo[a]pyrene increases methylation ISO XPO6 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of XPO6 promoter CTD PMID:27901495 Xpo6 Rat benzo[a]pyrene diol epoxide I decreases expression ISO XPO6 (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 Xpo6 Rat beta-lapachone increases expression ISO XPO6 (Homo sapiens) 6480464 beta-lapachone results in increased expression of XPO6 mRNA CTD PMID:38218311 Xpo6 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of XPO6 mRNA CTD PMID:25181051 Xpo6 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of XPO6 mRNA CTD PMID:30816183 and PMID:32528016 Xpo6 Rat bisphenol A multiple interactions ISO XPO6 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of XPO6 gene and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of XPO6 mRNA CTD PMID:28628672 and PMID:31601247 Xpo6 Rat bisphenol F multiple interactions ISO XPO6 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of XPO6 mRNA CTD PMID:28628672 Xpo6 Rat caffeine affects phosphorylation ISO XPO6 (Homo sapiens) 6480464 Caffeine affects the phosphorylation of XPO6 protein CTD PMID:35688186 Xpo6 Rat chlorpyrifos increases expression ISO Xpo6 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of XPO6 mRNA CTD PMID:37019170 Xpo6 Rat cisplatin decreases expression ISO XPO6 (Homo sapiens) 6480464 Cisplatin results in decreased expression of XPO6 mRNA CTD PMID:27594783 Xpo6 Rat cyclosporin A decreases expression ISO Xpo6 (Mus musculus) 6480464 Cyclosporine results in decreased expression of XPO6 mRNA CTD PMID:19770486 Xpo6 Rat cyclosporin A increases expression ISO XPO6 (Homo sapiens) 6480464 Cyclosporine results in increased expression of XPO6 mRNA CTD PMID:20106945 and PMID:25562108 Xpo6 Rat cylindrospermopsin increases expression ISO XPO6 (Homo sapiens) 6480464 cylindrospermopsin results in increased expression of XPO6 mRNA CTD PMID:24921660 Xpo6 Rat dexamethasone multiple interactions ISO XPO6 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of XPO6 mRNA more ... CTD PMID:28628672 Xpo6 Rat Dibutyl phosphate affects expression ISO XPO6 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of XPO6 mRNA CTD PMID:37042841 Xpo6 Rat dicrotophos increases expression ISO XPO6 (Homo sapiens) 6480464 dicrotophos results in increased expression of XPO6 mRNA CTD PMID:28302478 Xpo6 Rat elemental selenium decreases expression ISO XPO6 (Homo sapiens) 6480464 Selenium results in decreased expression of XPO6 mRNA CTD PMID:19244175 Xpo6 Rat elemental selenium multiple interactions ISO XPO6 (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in decreased expression of XPO6 mRNA CTD PMID:19244175 Xpo6 Rat epoxiconazole decreases expression ISO Xpo6 (Mus musculus) 6480464 epoxiconazole results in decreased expression of XPO6 mRNA CTD PMID:35436446 Xpo6 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of XPO6 mRNA CTD PMID:24136188 Xpo6 Rat folic acid decreases expression ISO XPO6 (Homo sapiens) 6480464 Folic Acid results in decreased expression of XPO6 mRNA CTD PMID:21867686 Xpo6 Rat fulvestrant multiple interactions ISO XPO6 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of XPO6 gene CTD PMID:31601247 Xpo6 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of XPO6 mRNA CTD PMID:22061828 and PMID:33387578 Xpo6 Rat indometacin multiple interactions ISO XPO6 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of XPO6 mRNA more ... CTD PMID:28628672 Xpo6 Rat ivermectin decreases expression ISO XPO6 (Homo sapiens) 6480464 Ivermectin results in decreased expression of XPO6 protein CTD PMID:32959892 Xpo6 Rat methamphetamine increases expression ISO Xpo6 (Mus musculus) 6480464 Methamphetamine results in increased expression of XPO6 mRNA CTD PMID:26307267 Xpo6 Rat methylparaben increases expression ISO XPO6 (Homo sapiens) 6480464 methylparaben results in increased expression of XPO6 mRNA CTD PMID:31745603 Xpo6 Rat nickel atom increases expression ISO XPO6 (Homo sapiens) 6480464 Nickel results in increased expression of XPO6 mRNA CTD PMID:25583101 Xpo6 Rat ozone multiple interactions ISO XPO6 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of XPO6 mRNA more ... CTD PMID:32699268 and PMID:35430440 Xpo6 Rat paracetamol affects expression ISO Xpo6 (Mus musculus) 6480464 Acetaminophen affects the expression of XPO6 mRNA CTD PMID:17562736 Xpo6 Rat pirinixic acid multiple interactions ISO Xpo6 (Mus musculus) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of XPO6 mRNA CTD PMID:19710929 Xpo6 Rat pirinixic acid increases expression ISO Xpo6 (Mus musculus) 6480464 pirinixic acid results in increased expression of XPO6 mRNA CTD PMID:18301758 Xpo6 Rat potassium chromate multiple interactions ISO XPO6 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of XPO6 mRNA CTD PMID:22079256 Xpo6 Rat potassium chromate decreases expression ISO XPO6 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of XPO6 mRNA CTD PMID:22079256 Xpo6 Rat quercetin increases phosphorylation ISO XPO6 (Homo sapiens) 6480464 Quercetin results in increased phosphorylation of XPO6 protein CTD PMID:35688186 Xpo6 Rat selenium atom decreases expression ISO XPO6 (Homo sapiens) 6480464 Selenium results in decreased expression of XPO6 mRNA CTD PMID:19244175 Xpo6 Rat selenium atom multiple interactions ISO XPO6 (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in decreased expression of XPO6 mRNA CTD PMID:19244175 Xpo6 Rat sunitinib increases expression ISO XPO6 (Homo sapiens) 6480464 Sunitinib results in increased expression of XPO6 mRNA CTD PMID:31533062 Xpo6 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of XPO6 mRNA CTD PMID:34492290 Xpo6 Rat titanium dioxide increases methylation ISO Xpo6 (Mus musculus) 6480464 titanium dioxide results in increased methylation of XPO6 promoter CTD PMID:35295148 Xpo6 Rat titanium dioxide decreases methylation ISO Xpo6 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of XPO6 gene CTD PMID:35295148 Xpo6 Rat triphenyl phosphate affects expression ISO XPO6 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of XPO6 mRNA CTD PMID:37042841 Xpo6 Rat triptonide increases expression ISO Xpo6 (Mus musculus) 6480464 triptonide results in increased expression of XPO6 mRNA CTD PMID:33045310 Xpo6 Rat troglitazone decreases expression ISO Xpo6 (Mus musculus) 6480464 troglitazone results in decreased expression of XPO6 mRNA CTD PMID:28973697 Xpo6 Rat urethane increases expression ISO XPO6 (Homo sapiens) 6480464 Urethane results in increased expression of XPO6 mRNA CTD PMID:28818685 Xpo6 Rat valproic acid affects expression ISO Xpo6 (Mus musculus) 6480464 Valproic Acid affects the expression of XPO6 mRNA CTD PMID:17292431 Xpo6 Rat valproic acid increases expression ISO XPO6 (Homo sapiens) 6480464 Valproic Acid results in increased expression of XPO6 mRNA CTD PMID:23179753 Xpo6 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of XPO6 mRNA CTD PMID:23034163 Xpo6 Rat vitamin E multiple interactions ISO XPO6 (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in decreased expression of XPO6 mRNA CTD PMID:19244175 Xpo6 Rat vitamin E decreases expression ISO XPO6 (Homo sapiens) 6480464 Vitamin E results in decreased expression of XPO6 mRNA CTD PMID:19244175 Xpo6 Rat zoledronic acid increases expression ISO XPO6 (Homo sapiens) 6480464 zoledronic acid results in increased expression of XPO6 protein CTD PMID:28871336
Xpo6 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 190,102,719 - 190,192,138 (-) NCBI GRCr8 mRatBN7.2 1 180,672,114 - 180,761,543 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 180,672,119 - 180,761,543 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 189,003,284 - 189,092,561 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 196,189,323 - 196,278,608 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 188,872,436 - 188,961,827 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 197,500,509 - 197,590,382 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 197,500,514 - 197,590,277 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 204,484,091 - 204,574,002 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 185,179,733 - 185,269,588 NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 1 178,332,154 - 178,421,776 (-) NCBI Celera Cytogenetic Map 1 q36 NCBI
XPO6 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 16 28,097,976 - 28,211,965 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 16 28,097,976 - 28,211,965 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 16 28,109,297 - 28,223,286 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 16 28,016,817 - 28,130,691 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 16 26,887,565 - 27,001,783 (-) NCBI Celera Cytogenetic Map 16 p12.1 NCBI HuRef 16 26,200,209 - 26,314,563 (-) NCBI HuRef CHM1_1 16 29,122,254 - 29,236,228 (-) NCBI CHM1_1 T2T-CHM13v2.0 16 28,378,417 - 28,492,441 (-) NCBI T2T-CHM13v2.0
Xpo6 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 125,700,890 - 125,799,715 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 125,700,887 - 125,799,673 (-) Ensembl GRCm39 Ensembl GRCm38 7 126,101,718 - 126,200,539 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 126,101,715 - 126,200,501 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 133,245,232 - 133,343,922 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 125,892,866 - 125,991,556 (-) NCBI MGSCv36 mm8 Celera 7 125,956,010 - 126,054,617 (-) NCBI Celera Cytogenetic Map 7 F3 NCBI cM Map 7 69.01 NCBI
Xpo6 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955493 6,172,860 - 6,299,451 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955493 6,172,860 - 6,265,269 (-) NCBI ChiLan1.0 ChiLan1.0
XPO6 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 18 29,495,054 - 29,609,022 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 16 34,031,603 - 34,145,576 (-) NCBI NHGRI_mPanPan1 PanPan1.1 16 28,465,138 - 28,579,109 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 16 28,462,546 - 28,579,109 (-) Ensembl panpan1.1 panPan2
XPO6 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 6 18,569,500 - 18,671,100 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 6 18,569,213 - 18,671,095 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 6 20,145,666 - 20,247,248 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 6 18,703,290 - 18,806,739 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 6 18,703,256 - 18,806,739 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 6 18,502,928 - 18,604,931 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 6 18,417,857 - 18,519,851 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 6 18,734,168 - 18,836,172 (+) NCBI UU_Cfam_GSD_1.0
Xpo6 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409344 123,429,188 - 123,533,879 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936501 11,527,032 - 11,631,745 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936501 11,527,038 - 11,631,739 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
XPO6 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 3 18,772,096 - 18,880,067 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 3 18,772,058 - 18,880,650 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 3 19,004,241 - 19,112,483 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
XPO6
Xpo6
.
Predicted Target Of
Count of predictions: 734 Count of miRNA genes: 297 Interacting mature miRNAs: 366 Transcripts: ENSRNOT00000022502, ENSRNOT00000043433 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1578778 Pur4 Proteinuria QTL 4 3.3 0.003 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 1 150700247 252085048 Rat 1354646 Kidm18 Kidney mass QTL 18 5.7 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 256448636 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 1354652 Kidm20 Kidney mass QTL 20 4.3 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 177227632 256448636 Rat 2302378 Insul11 Insulin level QTL 11 3.25 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 1 144267353 251128347 Rat 1354653 Despr9 Despair related QTL 9 0.00019 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 167909849 212909849 Rat 1578770 Stresp23 Stress response QTL 23 kidney sympathetic nerve activity (VT:0004050) stimulated renal sympathetic nerve activity to basal renal sympathetic nerve activity ratio (CMO:0001786) 1 123350408 182418476 Rat 2293673 Bss27 Bone structure and strength QTL 27 18.63 0.0001 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 1 171629477 216629477 Rat 61326 Eae6 Experimental allergic encephalomyelitis QTL 6 5.3 body mass (VT:0001259) change in body weight (CMO:0002045) 1 172949660 181830018 Rat 2293677 Bss41 Bone structure and strength QTL 41 9.38 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 1 171629477 216629477 Rat 1302787 Stl25 Serum triglyceride level QTL 25 2.7 0.0073 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 1 180359209 210702199 Rat 70160 Bw18 Body weight QTL 18 5.7 body mass (VT:0001259) body weight (CMO:0000012) 1 144267353 196383668 Rat 1549830 Bss1 Bone structure and strength QTL 1 4.8 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 1 172609619 217609619 Rat 7794788 Mcs32 Mammary carcinoma susceptibility QTL 32 2.61 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 1 115540693 238914717 Rat 70163 Bw20 Body weight QTL 20 5.1 body mass (VT:0001259) body weight (CMO:0000012) 1 174133260 219133260 Rat 1578763 Kidm29 Kidney mass QTL 29 3.3 0.0001 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 1 179567751 260522016 Rat 1354624 Cm35 Cardiac mass QTL35 5.7 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 177227632 256448636 Rat 1558658 Bw59 Body weight QTL 59 3.5 0.0003 body mass (VT:0001259) body weight (CMO:0000012) 1 178784622 223784622 Rat 1354636 Lmblg1 Limb length QTL 1 6.4 tibia length (VT:0004357) tibia length (CMO:0000450) 1 151162512 201278233 Rat 1549837 Hcar15 Hepatocarcinoma resistance QTL 15 0.05 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 153136852 260522016 Rat 2293689 Bss47 Bone structure and strength QTL 47 7.25 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra trabecular cross-sectional area (CMO:0001692) 1 171629477 216629477 Rat 152025235 Bw194 Body weight QTL 194 4.86 body mass (VT:0001259) 1 123556856 242907031 Rat 1598853 Memor3 Memory QTL 3 4.5 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 1 143506580 212458660 Rat 61341 Bp26 Blood pressure QTL 26 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 169537671 214537671 Rat 1354634 Kidm12 Kidney mass QTL 12 3.9 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 1 151162512 201278233 Rat 4889428 Stresp24 Stress response QTL 24 0.05 heart pumping trait (VT:2000009) absolute change in electrocardiographic low frequency R-R spectral component to high frequency R-R spectral component ratio (CMO:0002162) 1 155866514 200866514 Rat 152025232 Bw192 Body weight QTL 192 3.93 body mass (VT:0001259) 1 117917486 196963478 Rat 1578759 Uae30 Urinary albumin excretion QTL 30 3.3 0.003 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 150700247 252085048 Rat 61343 Bp28 Blood pressure QTL 28 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 151646613 196646613 Rat 2293693 Bss22 Bone structure and strength QTL 22 33.52 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 1 171629477 216629477 Rat 2300161 Bmd43 Bone mineral density QTL 43 8.4 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 171629477 216629477 Rat 61347 Bp197 Blood pressure QTL 197 4.2 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 1 158633083 203633083 Rat 61348 Bp30 Blood pressure QTL 30 2.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 144017057 197814409 Rat 8655649 Arrd1 Age-related retinal degeneration QTL 1 4.89 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 100357752 183970443 Rat 2303622 Vencon6 Ventilatory control QTL 6 0.001 respiration trait (VT:0001943) respiration rate (CMO:0000289) 1 154561505 199561505 Rat 631214 Bw61 Body weight QTL61 3.4 0.0001 intramuscular adipose amount (VT:0010044) intramuscular fat area (CMO:0001162) 1 173108781 218108781 Rat 7771612 Cm80 Cardiac mass QTL 80 8.4 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 1 149448574 221264292 Rat 731168 Bp154 Blood pressure QTL 154 3.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94642644 214537671 Rat 631205 Bp196 Blood pressure QTL 196 4 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118944897 199050459 Rat 1300158 Bp173 Blood pressure QTL 173 3.48 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 1 115540693 185145286 Rat 2300174 Bmd42 Bone mineral density QTL 42 8.4 0.0001 lumbar vertebra mineral mass (VT:0010511) bone mineral density (CMO:0001226) 1 171629477 216629477 Rat 737828 Hcas3 Hepatocarcinoma susceptibility QTL 3 4.9 liver integrity trait (VT:0010547) liver tumorous lesion volume to total liver volume ratio (CMO:0001082) 1 144267353 222987745 Rat 1331749 Hrtrt11 Heart rate QTL 11 2.973 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 94494440 198211706 Rat 1354661 Bw33 Body weight QTL 33 5.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1358886 Bp260 Blood pressure QTL 260 3.67 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 151162766 225824951 Rat 1331751 Bp199 Blood pressure QTL 199 3.60022 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 94494440 181830018 Rat 2293654 Bss30 Bone structure and strength QTL 30 32.65 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 1 171629477 216629477 Rat 724531 Uae5 Urinary albumin excretion QTL 5 4 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 1 150700142 252085212 Rat 2300187 Bmd41 Bone mineral density QTL 41 8.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 171629477 216629477 Rat 737974 Bp161 Blood pressure QTL 161 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 164747558 181133855 Rat 1641895 Bp298 Blood pressure QTL 298 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 123350408 182418476 Rat 70209 Niddm23 Non-insulin dependent diabetes mellitus QTL 23 2.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 94494440 198324465 Rat 1354580 Scort1 Serum corticosterone level QTL 1 3.4 blood corticosterone amount (VT:0005345) blood corticosterone level (CMO:0001172) 1 156677124 256448636 Rat 1358294 Bw37 Body weight QTL 37 5 0.000011 body mass (VT:0001259) body weight (CMO:0000012) 1 171310381 216310381 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 2312420 Pur17 Proteinuria QTL 17 7.1 0.0001 urine protein amount (VT:0005160) urine total protein excretion rate (CMO:0000756) 1 156677124 218753816 Rat 10059600 Bp378 Blood pressure QTL 378 3.08 0.05 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 176869060 221869060 Rat 1354591 Cm36 Cardiac mass QTL 36 4.1 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 102813953 201278233 Rat 724550 Thym3 Thymus enlargement QTL 3 7.82 0.001 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 1 136829932 181829932 Rat 2312558 Glom17 Glomerulus QTL 17 3.9 0.001 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 1 166532971 191278129 Rat 7421630 Bp362 Blood pressure QTL 362 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118608292 241799120 Rat 71118 Thym1 Thymus enlargement QTL 1 10.17 0.001 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 1 136829932 181829932 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 619613 Bp77 Blood pressure QTL 77 0.01 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 164747424 209747424 Rat 631519 Pia11 Pristane induced arthritis QTL 11 5.3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 1 136830018 181830018 Rat 619614 Bp78 Blood pressure QTL 78 0.001 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 169112897 197261052 Rat 634321 Hc1 Hypercalciuria QTL 1 2.91 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 1 178810256 240830002 Rat 724562 Rends1 Renal damage susceptibility QTL 1 0.05 kidney glomerulus integrity trait (VT:0010546) index of glomerular damage (CMO:0001135) 1 169537671 214537671 Rat 2292222 Bp307 Blood pressure QTL 307 3.06 0.0014 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 213533942 Rat 2292220 Bp306 Blood pressure QTL 306 3.47 0.00087 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 243914901 Rat 1354615 Cm32 Cardiac mass QTL 32 5.2 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 1 102813953 201278233 Rat 1600380 Niddm70 Non-insulin dependent diabetes mellitus QTL 70 3.1 0.0008 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 176550523 221550523 Rat 1354610 Bw34 Body weight QTL 34 4.1 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1354620 Kidm19 Kidney mass QTL 19 4 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 201278233 Rat 1354618 Kidm15 Kidney mass QTL 15 5 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 1 156677124 201278233 Rat 6903303 Scl34 Serum cholesterol QTL 34 2.5 0.0033 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 180359209 218108781 Rat 631544 Bp84 Blood pressure QTL 84 5.6 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123350408 181759564 Rat 152025212 Bw190 Body weight QTL 190 5.7 body mass (VT:0001259) 1 123556856 196963478 Rat 631549 Bp89 Blood pressure QTL 89 5.7 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123350581 201284552 Rat 1358189 Cstrr1 Cold stress response QTL 1 0.0001 catecholamine amount (VT:0010543) urine norepinephrine level (CMO:0001629) 1 123350408 182418476 Rat 1354606 Bp246 Blood pressure QTL 246 3.6 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 102813953 218753816 Rat 738032 Hcas5 Hepatocarcinoma susceptibility QTL 5 3.12 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 176426412 257976495 Rat 2325727 Pia41 Pristane induced arthritis QTL 41 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 1 178810256 180814005 Rat 1354602 Bw35 Body weight QTL 35 12.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 201278233 Rat 2325725 Eae31 Experimental allergic encephalomyelitis QTL 31 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis severity score (CMO:0001419) 1 178810256 188377506 Rat 631670 Iddm10 Insulin dependent diabetes mellitus QTL 10 1.9 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 1 174133260 196383668 Rat
D1Smu10
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 182,657,959 - 182,658,086 (+) MAPPER mRatBN7.2 Rnor_6.0 1 199,494,211 - 199,494,337 NCBI Rnor6.0 Rnor_5.0 1 206,521,673 - 206,521,799 UniSTS Rnor5.0 RGSC_v3.4 1 187,333,197 - 187,333,323 UniSTS RGSC3.4 Celera 1 180,307,674 - 180,307,800 UniSTS Cytogenetic Map 1 q36 UniSTS
D1Got166
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 182,657,961 - 182,658,182 (+) MAPPER mRatBN7.2 Rnor_6.0 1 199,494,213 - 199,494,433 NCBI Rnor6.0 Rnor_5.0 1 206,521,675 - 206,521,895 UniSTS Rnor5.0 RGSC_v3.4 1 187,333,198 - 187,333,419 RGD RGSC3.4 RGSC_v3.4 1 187,333,199 - 187,333,419 UniSTS RGSC3.4 RGSC_v3.1 1 187,483,080 - 187,483,300 RGD Celera 1 180,307,676 - 180,307,896 UniSTS RH 2.0 Map 1 974.9 RGD Cytogenetic Map 1 q36 UniSTS
RH130571
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 180,719,599 - 180,719,750 (+) MAPPER mRatBN7.2 Rnor_6.0 1 197,547,952 - 197,548,102 NCBI Rnor6.0 Rnor_5.0 1 206,504,318 - 206,504,468 UniSTS Rnor5.0 Rnor_5.0 1 204,531,625 - 204,531,775 UniSTS Rnor5.0 RGSC_v3.4 1 185,227,266 - 185,227,416 UniSTS RGSC3.4 Celera 1 178,379,584 - 178,379,734 UniSTS Cytogenetic Map 1 q36 UniSTS
AI010231
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 182,656,409 - 182,657,281 (+) MAPPER mRatBN7.2 Rnor_6.0 1 199,492,662 - 199,493,532 NCBI Rnor6.0 Rnor_5.0 1 206,519,934 - 206,520,804 UniSTS Rnor5.0 RGSC_v3.4 1 187,331,648 - 187,332,518 UniSTS RGSC3.4 Cytogenetic Map 1 q36 UniSTS
RH125206
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 180,694,294 - 180,694,395 (+) MAPPER mRatBN7.2 Rnor_6.0 1 197,522,688 - 197,522,788 NCBI Rnor6.0 Rnor_5.0 1 204,506,270 - 204,506,370 UniSTS Rnor5.0 RGSC_v3.4 1 185,201,912 - 185,202,012 UniSTS RGSC3.4 Celera 1 178,354,302 - 178,354,402 UniSTS Cytogenetic Map 1 q36 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000022502 ⟹ ENSRNOP00000022502
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 180,672,119 - 180,761,543 (-) Ensembl Rnor_6.0 Ensembl 1 197,500,514 - 197,590,277 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000043433 ⟹ ENSRNOP00000047098
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 180,719,952 - 180,761,543 (-) Ensembl Rnor_6.0 Ensembl 1 197,548,304 - 197,590,277 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000079044 ⟹ ENSRNOP00000074811
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 180,672,119 - 180,739,808 (-) Ensembl Rnor_6.0 Ensembl 1 197,549,097 - 197,568,165 (-) Ensembl
RefSeq Acc Id:
NM_001011935 ⟹ NP_001011935
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 190,102,719 - 190,192,138 (-) NCBI mRatBN7.2 1 180,672,114 - 180,761,543 (-) NCBI Rnor_6.0 1 197,500,509 - 197,590,277 (-) NCBI Rnor_5.0 1 204,484,091 - 204,574,002 (-) NCBI RGSC_v3.4 1 185,179,733 - 185,269,588 (-) RGD Celera 1 178,332,154 - 178,421,776 (-) RGD
Sequence:
CGAGGACAGCGCGGGCCCGTGGGCCTCTCTTCTGAGCCGGCCGCGCCGCCCAGGCCCAGGCAGCCTCTGCCCCTTCAGTCTTAGCTGGGGCCCGTCGCCGCCTCGGGCCGCGGAGGCCAGGGAGTCCC
hide sequence
RefSeq Acc Id:
XM_008759870 ⟹ XP_008758092
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 190,102,719 - 190,191,833 (-) NCBI mRatBN7.2 1 180,672,114 - 180,761,232 (-) NCBI Rnor_6.0 1 197,500,509 - 197,590,382 (-) NCBI
Sequence:
TTCCGGCGCGTTGGGCTGTTGGCAGGGGCTGGTCGCGAGGGGCGAGCGGCCGCTGCGGGTAGCG
hide sequence
RefSeq Acc Id:
XM_039107197 ⟹ XP_038963125
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 190,102,719 - 190,191,833 (-) NCBI mRatBN7.2 1 180,672,114 - 180,761,232 (-) NCBI
RefSeq Acc Id:
XM_039107205 ⟹ XP_038963133
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 190,102,719 - 190,151,800 (-) NCBI mRatBN7.2 1 180,672,114 - 180,721,198 (-) NCBI
RefSeq Acc Id:
XM_063286040 ⟹ XP_063142110
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 190,102,719 - 190,191,833 (-) NCBI
RefSeq Acc Id:
NP_001011935 ⟸ NM_001011935
- UniProtKB:
G3V858 (UniProtKB/TrEMBL), A6I931 (UniProtKB/TrEMBL), A6I932 (UniProtKB/TrEMBL)
- Sequence:
MASEDASLRALESLMTEFFHDCTTNERKREIEELLNNFAQQVGAWRFCLYFLSSTRNDYVMMYSLTVFENLINKMWLGVPSQDKMEIRSCLPKLLLAHHKTLPYFIRNKLCKVIVDIGRQDWPMFYHD
hide sequence
RefSeq Acc Id:
XP_008758092 ⟸ XM_008759870
- Peptide Label:
isoform X1
- UniProtKB:
A6I932 (UniProtKB/TrEMBL)
- Sequence:
MASEDASLRALESLMTEFFHDCTTNERKREIEELLNNFAQQVGAWRFCLYFLSSTRNDYVMMYSLTVFENLINKMWLGVPSQDKMEIRSCLPKLLLAHHKTLPYFIRNKLCKVIVDIGRQDWPMFYHD
hide sequence
Ensembl Acc Id:
ENSRNOP00000047098 ⟸ ENSRNOT00000043433
Ensembl Acc Id:
ENSRNOP00000074811 ⟸ ENSRNOT00000079044
Ensembl Acc Id:
ENSRNOP00000022502 ⟸ ENSRNOT00000022502
RefSeq Acc Id:
XP_038963125 ⟸ XM_039107197
- Peptide Label:
isoform X2
- UniProtKB:
A6I932 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038963133 ⟸ XM_039107205
- Peptide Label:
isoform X4
RefSeq Acc Id:
XP_063142110 ⟸ XM_063286040
- Peptide Label:
isoform X3
- UniProtKB:
A6I932 (UniProtKB/TrEMBL)
RGD ID: 13690394 Promoter ID: EPDNEW_R917 Type: initiation region Name: Xpo6_1 Description: exportin 6 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 197,590,375 - 197,590,435 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2005-12-06
Xpo6
exportin 6
Xpo6_predicted
exportin 6 (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-12
Xpo6_predicted
exportin 6 (predicted)
Symbol and Name status set to approved
70820 APPROVED
