Symbol:
XPO6
Name:
exportin 6
RGD ID:
1322976
HGNC Page
HGNC:19733
Description:
Enables nuclear export signal receptor activity. Involved in protein export from nucleus. Located in cytosol; nuclear lumen; and plasma membrane. Part of protein-containing complex.
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
EXP6; exportin-6; FLJ22519; KIAA0370; RAN binding protein 20; ran-binding protein 20; RANBP20
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Mus musculus (house mouse):
Xpo6 (exportin 6) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Xpo6 (exportin 6) RGD
RGD
Chinchilla lanigera (long-tailed chinchilla):
Xpo6 (exportin 6) NCBI
Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):
XPO6 (exportin 6) NCBI
Ortholog
Canis lupus familiaris (dog):
XPO6 (exportin 6) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Xpo6 (exportin 6) NCBI
Ortholog
Sus scrofa (pig):
XPO6 (exportin 6) HGNC
EggNOG, Ensembl, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Chlorocebus sabaeus (green monkey):
XPO6 (exportin 6) NCBI
Ortholog
Heterocephalus glaber (naked mole-rat):
Xpo6 (exportin 6) NCBI
Ortholog
Other homologs 2
Rattus norvegicus (Norway rat):
Sh3d21 (SH3 domain containing 21) HGNC
OMA
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Xpo6 (exportin 6)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Xpo6 (exportin 6)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
xpo6 (exportin 6)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Drosophila melanogaster (fruit fly):
ebo
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
xpo6
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus laevis (African clawed frog):
xpo6.S
Alliance
DIOPT (Xenbase)
Xenopus laevis (African clawed frog):
xpo6.L
Alliance
DIOPT (Xenbase)
Related Pseudogenes:
RANBP20P
Allele / Splice:
See ClinVar data
Latest Assembly:
GRCh38 - Human Genome Assembly GRCh38
Position:
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 16 28,097,976 - 28,211,965 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 16 28,097,976 - 28,211,965 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 16 28,109,297 - 28,223,286 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 16 28,016,817 - 28,130,691 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 16 26,887,565 - 27,001,783 (-) NCBI Celera Cytogenetic Map 16 p12.1 NCBI HuRef 16 26,200,209 - 26,314,563 (-) NCBI HuRef CHM1_1 16 29,122,254 - 29,236,228 (-) NCBI CHM1_1 T2T-CHM13v2.0 16 28,378,417 - 28,492,441 (-) NCBI T2T-CHM13v2.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
XPO6 Human (-)-epigallocatechin 3-gallate multiple interactions EXP 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of XPO6 mRNA CTD PMID:22079256 XPO6 Human 1,2-dimethylhydrazine increases expression ISO Xpo6 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of XPO6 mRNA CTD PMID:22206623 XPO6 Human 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of XPO6 mRNA CTD PMID:23019147 and PMID:31614463 XPO6 Human 17beta-estradiol increases expression ISO Xpo6 (Mus musculus) 6480464 Estradiol results in increased expression of XPO6 mRNA CTD PMID:39298647 XPO6 Human 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Xpo6 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of XPO6 mRNA CTD PMID:19770486 XPO6 Human 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Xpo6 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in increased expression of XPO6 mRNA CTD PMID:34747641 XPO6 Human 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of XPO6 mRNA CTD PMID:22903824 XPO6 Human 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Xpo6 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of XPO6 mRNA CTD PMID:21570461 XPO6 Human 2-methylcholine affects expression EXP 6480464 beta-methylcholine affects the expression of XPO6 mRNA CTD PMID:21179406 XPO6 Human 3-isobutyl-1-methyl-7H-xanthine multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of XPO6 mRNA more ... CTD PMID:28628672 XPO6 Human 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of XPO6 mRNA CTD PMID:28628672 XPO6 Human 4,4'-sulfonyldiphenol decreases expression ISO Xpo6 (Mus musculus) 6480464 bisphenol S results in decreased expression of XPO6 mRNA CTD PMID:39298647 XPO6 Human acrolein multiple interactions EXP 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of XPO6 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of XPO6 mRNA CTD PMID:32699268 XPO6 Human all-trans-retinoic acid decreases expression EXP 6480464 Tretinoin results in decreased expression of XPO6 mRNA CTD PMID:18614847 XPO6 Human alpha-pinene multiple interactions EXP 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of XPO6 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of XPO6 mRNA CTD PMID:32699268 XPO6 Human antirheumatic drug decreases expression EXP 6480464 Antirheumatic Agents results in decreased expression of XPO6 mRNA CTD PMID:24449571 XPO6 Human benzo[a]pyrene increases methylation EXP 6480464 Benzo(a)pyrene results in increased methylation of XPO6 promoter CTD PMID:27901495 XPO6 Human benzo[a]pyrene diol epoxide I decreases expression EXP 6480464 7 more ... CTD PMID:19150397 XPO6 Human beta-lapachone increases expression EXP 6480464 beta-lapachone results in increased expression of XPO6 mRNA CTD PMID:38218311 XPO6 Human bisphenol A affects expression ISO Xpo6 (Rattus norvegicus) 6480464 bisphenol A affects the expression of XPO6 mRNA CTD PMID:25181051 XPO6 Human bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of XPO6 gene and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of XPO6 mRNA CTD PMID:28628672 and PMID:31601247 XPO6 Human bisphenol A increases expression ISO Xpo6 (Rattus norvegicus) 6480464 bisphenol A results in increased expression of XPO6 mRNA CTD PMID:30816183 and PMID:32528016 XPO6 Human bisphenol F multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of XPO6 mRNA CTD PMID:28628672 XPO6 Human caffeine affects phosphorylation EXP 6480464 Caffeine affects the phosphorylation of XPO6 protein CTD PMID:35688186 XPO6 Human chlorpyrifos increases expression ISO Xpo6 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of XPO6 mRNA CTD PMID:37019170 XPO6 Human cisplatin decreases expression EXP 6480464 Cisplatin results in decreased expression of XPO6 mRNA CTD PMID:27594783 XPO6 Human cyclosporin A decreases expression ISO Xpo6 (Mus musculus) 6480464 Cyclosporine results in decreased expression of XPO6 mRNA CTD PMID:19770486 XPO6 Human cyclosporin A increases expression EXP 6480464 Cyclosporine results in increased expression of XPO6 mRNA CTD PMID:20106945 and PMID:25562108 XPO6 Human cylindrospermopsin increases expression EXP 6480464 cylindrospermopsin results in increased expression of XPO6 mRNA CTD PMID:24921660 XPO6 Human dexamethasone multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of XPO6 mRNA more ... CTD PMID:28628672 XPO6 Human Dibutyl phosphate affects expression EXP 6480464 di-n-butylphosphoric acid affects the expression of XPO6 mRNA CTD PMID:37042841 XPO6 Human dicrotophos increases expression EXP 6480464 dicrotophos results in increased expression of XPO6 mRNA CTD PMID:28302478 XPO6 Human elemental selenium decreases expression EXP 6480464 Selenium results in decreased expression of XPO6 mRNA CTD PMID:19244175 XPO6 Human elemental selenium multiple interactions EXP 6480464 [Selenium co-treated with Vitamin E] results in decreased expression of XPO6 mRNA CTD PMID:19244175 XPO6 Human epoxiconazole decreases expression ISO Xpo6 (Mus musculus) 6480464 epoxiconazole results in decreased expression of XPO6 mRNA CTD PMID:35436446 XPO6 Human flutamide increases expression ISO Xpo6 (Rattus norvegicus) 6480464 Flutamide results in increased expression of XPO6 mRNA CTD PMID:24136188 XPO6 Human folic acid decreases expression EXP 6480464 Folic Acid results in decreased expression of XPO6 mRNA CTD PMID:21867686 XPO6 Human fulvestrant multiple interactions EXP 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of XPO6 gene CTD PMID:31601247 XPO6 Human gentamycin increases expression ISO Xpo6 (Rattus norvegicus) 6480464 Gentamicins results in increased expression of XPO6 mRNA CTD PMID:22061828 and PMID:33387578 XPO6 Human GSK-J4 increases expression EXP 6480464 GSK-J4 results in increased expression of XPO6 mRNA CTD PMID:29301935 XPO6 Human indometacin multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of XPO6 mRNA more ... CTD PMID:28628672 XPO6 Human ivermectin decreases expression EXP 6480464 Ivermectin results in decreased expression of XPO6 protein CTD PMID:32959892 XPO6 Human methamphetamine increases expression ISO Xpo6 (Mus musculus) 6480464 Methamphetamine results in increased expression of XPO6 mRNA CTD PMID:26307267 XPO6 Human methylparaben increases expression EXP 6480464 methylparaben results in increased expression of XPO6 mRNA CTD PMID:31745603 XPO6 Human nickel atom increases expression EXP 6480464 Nickel results in increased expression of XPO6 mRNA CTD PMID:25583101 XPO6 Human ozone multiple interactions EXP 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of XPO6 mRNA more ... CTD PMID:32699268 and PMID:35430440 XPO6 Human paracetamol affects expression ISO Xpo6 (Mus musculus) 6480464 Acetaminophen affects the expression of XPO6 mRNA CTD PMID:17562736 XPO6 Human pirinixic acid multiple interactions ISO Xpo6 (Mus musculus) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of XPO6 mRNA CTD PMID:19710929 XPO6 Human pirinixic acid increases expression ISO Xpo6 (Mus musculus) 6480464 pirinixic acid results in increased expression of XPO6 mRNA CTD PMID:18301758 XPO6 Human potassium chromate multiple interactions EXP 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of XPO6 mRNA CTD PMID:22079256 XPO6 Human potassium chromate decreases expression EXP 6480464 potassium chromate(VI) results in decreased expression of XPO6 mRNA CTD PMID:22079256 XPO6 Human quercetin increases phosphorylation EXP 6480464 Quercetin results in increased phosphorylation of XPO6 protein CTD PMID:35688186 XPO6 Human selenium atom decreases expression EXP 6480464 Selenium results in decreased expression of XPO6 mRNA CTD PMID:19244175 XPO6 Human selenium atom multiple interactions EXP 6480464 [Selenium co-treated with Vitamin E] results in decreased expression of XPO6 mRNA CTD PMID:19244175 XPO6 Human sunitinib increases expression EXP 6480464 Sunitinib results in increased expression of XPO6 mRNA CTD PMID:31533062 XPO6 Human thioacetamide increases expression ISO Xpo6 (Rattus norvegicus) 6480464 Thioacetamide results in increased expression of XPO6 mRNA CTD PMID:34492290 XPO6 Human titanium dioxide decreases methylation ISO Xpo6 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of XPO6 gene CTD PMID:35295148 XPO6 Human titanium dioxide increases methylation ISO Xpo6 (Mus musculus) 6480464 titanium dioxide results in increased methylation of XPO6 promoter CTD PMID:35295148 XPO6 Human triphenyl phosphate affects expression EXP 6480464 triphenyl phosphate affects the expression of XPO6 mRNA CTD PMID:37042841 XPO6 Human triptonide increases expression ISO Xpo6 (Mus musculus) 6480464 triptonide results in increased expression of XPO6 mRNA CTD PMID:33045310 XPO6 Human troglitazone decreases expression ISO Xpo6 (Mus musculus) 6480464 troglitazone results in decreased expression of XPO6 mRNA CTD PMID:28973697 XPO6 Human urethane increases expression EXP 6480464 Urethane results in increased expression of XPO6 mRNA CTD PMID:28818685 XPO6 Human valproic acid affects expression ISO Xpo6 (Mus musculus) 6480464 Valproic Acid affects the expression of XPO6 mRNA CTD PMID:17292431 XPO6 Human valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of XPO6 mRNA CTD PMID:23179753 XPO6 Human vinclozolin increases expression ISO Xpo6 (Rattus norvegicus) 6480464 vinclozolin results in increased expression of XPO6 mRNA CTD PMID:23034163 XPO6 Human vitamin E multiple interactions EXP 6480464 [Selenium co-treated with Vitamin E] results in decreased expression of XPO6 mRNA CTD PMID:19244175 XPO6 Human vitamin E decreases expression EXP 6480464 Vitamin E results in decreased expression of XPO6 mRNA CTD PMID:19244175 XPO6 Human zoledronic acid increases expression EXP 6480464 zoledronic acid results in increased expression of XPO6 protein CTD PMID:28871336
(-)-epigallocatechin 3-gallate (EXP) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-methylcholine (EXP) 3-isobutyl-1-methyl-7H-xanthine (EXP) 4,4'-sulfonyldiphenol (EXP,ISO) acrolein (EXP) all-trans-retinoic acid (EXP) alpha-pinene (EXP) antirheumatic drug (EXP) benzo[a]pyrene (EXP) benzo[a]pyrene diol epoxide I (EXP) beta-lapachone (EXP) bisphenol A (EXP,ISO) bisphenol F (EXP) caffeine (EXP) chlorpyrifos (ISO) cisplatin (EXP) cyclosporin A (EXP,ISO) cylindrospermopsin (EXP) dexamethasone (EXP) Dibutyl phosphate (EXP) dicrotophos (EXP) elemental selenium (EXP) epoxiconazole (ISO) flutamide (ISO) folic acid (EXP) fulvestrant (EXP) gentamycin (ISO) GSK-J4 (EXP) indometacin (EXP) ivermectin (EXP) methamphetamine (ISO) methylparaben (EXP) nickel atom (EXP) ozone (EXP) paracetamol (ISO) pirinixic acid (ISO) potassium chromate (EXP) quercetin (EXP) selenium atom (EXP) sunitinib (EXP) thioacetamide (ISO) titanium dioxide (ISO) triphenyl phosphate (EXP) triptonide (ISO) troglitazone (ISO) urethane (EXP) valproic acid (EXP,ISO) vinclozolin (ISO) vitamin E (EXP) zoledronic acid (EXP)
XPO6 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 16 28,097,976 - 28,211,965 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 16 28,097,976 - 28,211,965 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 16 28,109,297 - 28,223,286 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 16 28,016,817 - 28,130,691 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 16 26,887,565 - 27,001,783 (-) NCBI Celera Cytogenetic Map 16 p12.1 NCBI HuRef 16 26,200,209 - 26,314,563 (-) NCBI HuRef CHM1_1 16 29,122,254 - 29,236,228 (-) NCBI CHM1_1 T2T-CHM13v2.0 16 28,378,417 - 28,492,441 (-) NCBI T2T-CHM13v2.0
Xpo6 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 125,700,890 - 125,799,715 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 125,700,887 - 125,799,673 (-) Ensembl GRCm39 Ensembl GRCm38 7 126,101,718 - 126,200,539 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 126,101,715 - 126,200,501 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 133,245,232 - 133,343,922 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 125,892,866 - 125,991,556 (-) NCBI MGSCv36 mm8 Celera 7 125,956,010 - 126,054,617 (-) NCBI Celera Cytogenetic Map 7 F3 NCBI cM Map 7 69.01 NCBI
Xpo6 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 190,102,719 - 190,192,138 (-) NCBI GRCr8 mRatBN7.2 1 180,672,114 - 180,761,543 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 180,672,119 - 180,761,543 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 189,003,284 - 189,092,561 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 196,189,323 - 196,278,608 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 188,872,436 - 188,961,827 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 197,500,509 - 197,590,382 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 197,500,514 - 197,590,277 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 204,484,091 - 204,574,002 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 185,179,733 - 185,269,588 NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 1 178,332,154 - 178,421,776 (-) NCBI Celera Cytogenetic Map 1 q36 NCBI
Xpo6 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955493 6,172,860 - 6,299,451 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955493 6,172,860 - 6,265,269 (-) NCBI ChiLan1.0 ChiLan1.0
XPO6 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 18 29,495,054 - 29,609,022 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 16 34,031,603 - 34,145,576 (-) NCBI NHGRI_mPanPan1 PanPan1.1 16 28,465,138 - 28,579,109 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 16 28,462,546 - 28,579,109 (-) Ensembl panpan1.1 panPan2
XPO6 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 6 18,569,500 - 18,671,100 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 6 18,569,213 - 18,671,095 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 6 20,145,666 - 20,247,248 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 6 18,703,290 - 18,806,739 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 6 18,703,256 - 18,806,739 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 6 18,502,928 - 18,604,931 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 6 18,417,857 - 18,519,851 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 6 18,734,168 - 18,836,172 (+) NCBI UU_Cfam_GSD_1.0
Xpo6 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409344 123,429,188 - 123,533,879 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936501 11,527,032 - 11,631,745 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936501 11,527,038 - 11,631,739 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
XPO6 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 3 18,772,096 - 18,880,067 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 3 18,772,058 - 18,880,650 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 3 19,004,241 - 19,112,483 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
XPO6
Xpo6
.
Confirmed Target Of
Predicted Target Of
Count of predictions: 5085 Count of miRNA genes: 1189 Interacting mature miRNAs: 1541 Transcripts: ENST00000304658, ENST00000561488, ENST00000562408, ENST00000563138, ENST00000564337, ENST00000564905, ENST00000565284, ENST00000565698, ENST00000566073, ENST00000566175, ENST00000567038, ENST00000567842, ENST00000568065, ENST00000569216, ENST00000569315, ENST00000569951, ENST00000569973, ENST00000570007, ENST00000570033, ENST00000570294, ENST00000573275, ENST00000573645, ENST00000574435 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
597334874 GWAS1430948_H R-warfarin measurement QTL GWAS1430948 (human) 0.000004 R-warfarin measurement 16 28167995 28167996 Human 597039719 GWAS1135793_H apolipoprotein A 1 measurement QTL GWAS1135793 (human) 3e-13 apolipoprotein A 1 measurement blood apolipoprotein AI level (CMO:0000520) 16 28127756 28127757 Human 596960469 GWAS1079988_H glomerular filtration rate QTL GWAS1079988 (human) 2e-08 glomerular filtration rate 16 28155796 28155797 Human 597082258 GWAS1178332_H monocyte count QTL GWAS1178332 (human) 1e-11 monocyte quantity (VT:0000223) blood monocyte count (CMO:0000032) 16 28148860 28148861 Human 597084866 GWAS1180940_H response to ketamine QTL GWAS1180940 (human) 0.000007 response to ketamine 16 28200424 28200425 Human 597270670 GWAS1366744_H educational attainment QTL GWAS1366744 (human) 3e-13 educational attainment 16 28120189 28120190 Human 407000762 GWAS649738_H monocyte count QTL GWAS649738 (human) 6e-14 monocyte quantity (VT:0000223) blood monocyte count (CMO:0000032) 16 28148860 28148861 Human 596960877 GWAS1080396_H glomerular filtration rate QTL GWAS1080396 (human) 6e-09 glomerular filtration rate 16 28155796 28155797 Human 597213891 GWAS1309965_H self reported educational attainment QTL GWAS1309965 (human) 5e-09 self reported educational attainment 16 28121831 28121832 Human 597089389 GWAS1185463_H monocyte count QTL GWAS1185463 (human) 2e-13 monocyte quantity (VT:0000223) blood monocyte count (CMO:0000032) 16 28148860 28148861 Human
AFM234XE9
Human Assembly Chr Position (strand) Source JBrowse GRCh37 16 28,217,439 - 28,217,552 UniSTS GRCh37 Build 36 16 28,124,940 - 28,125,053 RGD NCBI36 Celera 16 26,995,761 - 26,995,874 RGD Cytogenetic Map 16 p11.2 UniSTS HuRef 16 26,308,753 - 26,308,866 UniSTS
RH11596
Human Assembly Chr Position (strand) Source JBrowse GRCh37 16 28,109,419 - 28,109,555 UniSTS GRCh37 Build 36 16 28,016,920 - 28,017,056 RGD NCBI36 Celera 16 26,887,668 - 26,887,804 RGD Cytogenetic Map 16 p11.2 UniSTS HuRef 16 26,200,331 - 26,200,467 UniSTS
D16S721
Human Assembly Chr Position (strand) Source JBrowse GRCh37 16 28,192,974 - 28,193,165 UniSTS GRCh37 Build 36 16 28,100,475 - 28,100,666 RGD NCBI36 Celera 16 26,971,248 - 26,971,439 RGD Cytogenetic Map 16 p11.2 UniSTS HuRef 16 26,283,909 - 26,284,100 UniSTS
RH125206
Human Assembly Chr Position (strand) Source JBrowse GRCh37 14 21,189,536 - 21,189,636 UniSTS GRCh37 GRCh37 16 28,137,019 - 28,137,119 UniSTS GRCh37 Build 36 14 20,259,376 - 20,259,476 RGD NCBI36 Celera 14 1,050,416 - 1,050,516 RGD Celera 16 26,915,271 - 26,915,371 UniSTS HuRef 16 26,227,935 - 26,228,035 UniSTS HuRef 14 1,310,550 - 1,310,650 UniSTS
SHGC-141994
Human Assembly Chr Position (strand) Source JBrowse GRCh37 16 28,175,298 - 28,175,618 UniSTS GRCh37 Build 36 16 28,082,799 - 28,083,119 RGD NCBI36 Celera 16 26,953,569 - 26,953,889 RGD Cytogenetic Map 16 p11.2 UniSTS HuRef 16 26,266,229 - 26,266,549 UniSTS TNG Radiation Hybrid Map 16 15464.0 UniSTS
SHGC-6754
Human Assembly Chr Position (strand) Source JBrowse GRCh37 16 28,179,793 - 28,179,914 UniSTS GRCh37 Build 36 16 28,087,294 - 28,087,415 RGD NCBI36 Celera 16 26,958,064 - 26,958,185 RGD Cytogenetic Map 16 p11.2 UniSTS HuRef 16 26,270,724 - 26,270,845 UniSTS TNG Radiation Hybrid Map 16 15468.0 UniSTS Stanford-G3 RH Map 16 1528.0 UniSTS NCBI RH Map 16 232.2 UniSTS
G36825
Human Assembly Chr Position (strand) Source JBrowse GRCh37 16 28,138,137 - 28,138,308 UniSTS GRCh37 Build 36 16 28,045,638 - 28,045,809 RGD NCBI36 Celera 16 26,916,389 - 26,916,560 RGD Cytogenetic Map 16 p11.2 UniSTS HuRef 16 26,229,053 - 26,229,224 UniSTS
XPO6__4913
Human Assembly Chr Position (strand) Source JBrowse GRCh37 16 28,109,307 - 28,109,911 UniSTS GRCh37 Build 36 16 28,016,808 - 28,017,412 RGD NCBI36 Celera 16 26,887,556 - 26,888,160 RGD HuRef 16 26,200,219 - 26,200,823 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
entire extraembryonic component
1204
2436
2788
2248
4969
1725
2351
5
622
1951
465
2269
7297
6464
53
3731
850
1742
1617
175
1
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENST00000304658 ⟹ ENSP00000302790
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 16 28,097,976 - 28,211,965 (-) Ensembl
Ensembl Acc Id:
ENST00000561488
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 16 28,155,597 - 28,156,332 (-) Ensembl
Ensembl Acc Id:
ENST00000562408
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 16 28,117,037 - 28,132,363 (-) Ensembl
Ensembl Acc Id:
ENST00000563138
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 16 28,125,769 - 28,146,303 (-) Ensembl
Ensembl Acc Id:
ENST00000564337
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 16 28,132,398 - 28,155,975 (-) Ensembl
Ensembl Acc Id:
ENST00000564905 ⟹ ENSP00000455310
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 16 28,107,588 - 28,133,925 (-) Ensembl
Ensembl Acc Id:
ENST00000565284
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 16 28,125,829 - 28,152,918 (-) Ensembl
Ensembl Acc Id:
ENST00000565698 ⟹ ENSP00000457341
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 16 28,097,979 - 28,211,550 (-) Ensembl
Ensembl Acc Id:
ENST00000566073 ⟹ ENSP00000456273
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 16 28,180,941 - 28,211,920 (-) Ensembl
Ensembl Acc Id:
ENST00000566175 ⟹ ENSP00000459591
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 16 28,146,162 - 28,156,117 (-) Ensembl
Ensembl Acc Id:
ENST00000567038
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 16 28,101,270 - 28,101,986 (-) Ensembl
Ensembl Acc Id:
ENST00000567842
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 16 28,125,832 - 28,146,249 (-) Ensembl
Ensembl Acc Id:
ENST00000568065 ⟹ ENSP00000456422
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 16 28,097,995 - 28,101,933 (-) Ensembl
Ensembl Acc Id:
ENST00000569216
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 16 28,107,529 - 28,112,958 (-) Ensembl
Ensembl Acc Id:
ENST00000569315 ⟹ ENSP00000454586
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 16 28,101,055 - 28,101,915 (-) Ensembl
Ensembl Acc Id:
ENST00000569951 ⟹ ENSP00000457742
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 16 28,176,058 - 28,211,476 (-) Ensembl
Ensembl Acc Id:
ENST00000569973
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 16 28,156,133 - 28,165,419 (-) Ensembl
Ensembl Acc Id:
ENST00000570007
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 16 28,105,689 - 28,106,422 (-) Ensembl
Ensembl Acc Id:
ENST00000570033 ⟹ ENSP00000456066
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 16 28,169,845 - 28,181,122 (-) Ensembl
Ensembl Acc Id:
ENST00000570294
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 16 28,146,091 - 28,153,209 (-) Ensembl
Ensembl Acc Id:
ENST00000573275 ⟹ ENSP00000458314
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 16 28,106,112 - 28,111,890 (-) Ensembl
Ensembl Acc Id:
ENST00000573645
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 16 28,156,315 - 28,173,122 (-) Ensembl
Ensembl Acc Id:
ENST00000574435 ⟹ ENSP00000459736
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 16 28,146,172 - 28,169,901 (-) Ensembl
RefSeq Acc Id:
NM_001270940 ⟹ NP_001257869
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 16 28,097,976 - 28,211,965 (-) NCBI GRCh37 16 28,109,297 - 28,223,281 (-) NCBI HuRef 16 26,200,209 - 26,314,563 (-) NCBI CHM1_1 16 29,122,254 - 29,236,228 (-) NCBI T2T-CHM13v2.0 16 28,378,417 - 28,492,441 (-) NCBI
Sequence:
ACTTCCGGCGCGTTGGGGCTGTTGGTCGGGGGCGGCCGCGCGGTACTAGCGGGCGGCTCCAGGGCGGGCGCGCGCAAGGATGCTCTAGGGGGCGGCGGCAGTGGCCGTGTGGGTTGAGGCTGCGAGGA
hide sequence
RefSeq Acc Id:
NM_015171 ⟹ NP_055986
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 16 28,097,976 - 28,211,965 (-) NCBI GRCh37 16 28,109,297 - 28,223,281 (-) NCBI Build 36 16 28,016,817 - 28,130,691 (-) NCBI Archive Celera 16 26,887,565 - 27,001,783 (-) RGD HuRef 16 26,200,209 - 26,314,563 (-) NCBI CHM1_1 16 29,122,254 - 29,236,228 (-) NCBI T2T-CHM13v2.0 16 28,378,417 - 28,492,441 (-) NCBI
Sequence:
ACTTCCGGCGCGTTGGGGCTGTTGGTCGGGGGCGGCCGCGCGGTACTAGCGGGCGGCTCCAGGGCGGGCGCGCGCAAGGATGCTCTAGGGGGCGGCGGCAGTGGCCGTGTGGGTTGAGGCTGCGAGGA
hide sequence
RefSeq Acc Id:
NP_055986 ⟸ NM_015171
- Peptide Label:
isoform 2
- UniProtKB:
Q96CP8 (UniProtKB/Swiss-Prot), Q76N88 (UniProtKB/Swiss-Prot), Q68G50 (UniProtKB/Swiss-Prot), Q53G88 (UniProtKB/Swiss-Prot), Q2YDX3 (UniProtKB/Swiss-Prot), D3DWF9 (UniProtKB/Swiss-Prot), A1L3W4 (UniProtKB/Swiss-Prot), Q9BT21 (UniProtKB/Swiss-Prot), Q96QU8 (UniProtKB/Swiss-Prot), B7ZM10 (UniProtKB/TrEMBL)
- Sequence:
MASEEASLRALESLMTEFFHDCTTNERKREIEELLNNFAQQIGAWRFCLYFLSSTRNDYVMMYSLTVFENLINKMWLGVPSQDKMEIRSCLPKLLLAHHKTLPYFIRNKLCKVIVDIGRQDWPMFYHD
hide sequence
RefSeq Acc Id:
NP_001257869 ⟸ NM_001270940
- Peptide Label:
isoform 1
- UniProtKB:
B3KW08 (UniProtKB/TrEMBL)
- Sequence:
MTEFFHDCTTNERKREIEELLNNFAQQIGAWRFCLYFLSSTRNDYVMMYSLTVFENLINKMWLGVPSQDKMEIRSCLPKLLLAHHKTLPYFIRNKLCKVIVDIGRQDWPMFYHDFFTNILQLIQSPVT
hide sequence
Ensembl Acc Id:
ENSP00000457742 ⟸ ENST00000569951
Ensembl Acc Id:
ENSP00000456066 ⟸ ENST00000570033
Ensembl Acc Id:
ENSP00000458314 ⟸ ENST00000573275
Ensembl Acc Id:
ENSP00000459736 ⟸ ENST00000574435
Ensembl Acc Id:
ENSP00000455310 ⟸ ENST00000564905
Ensembl Acc Id:
ENSP00000457341 ⟸ ENST00000565698
Ensembl Acc Id:
ENSP00000459591 ⟸ ENST00000566175
Ensembl Acc Id:
ENSP00000456273 ⟸ ENST00000566073
Ensembl Acc Id:
ENSP00000456422 ⟸ ENST00000568065
Ensembl Acc Id:
ENSP00000302790 ⟸ ENST00000304658
Ensembl Acc Id:
ENSP00000454586 ⟸ ENST00000569315
RGD ID: 6793609 Promoter ID: HG_KWN:23387 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: CD4+TCell, CD4+TCell_12Hour, HeLa_S3, Jurkat, K562, Lymphoblastoid, NB4 Transcripts: NM_015171, UC002DPB.1 Position: Human Assembly Chr Position (strand) Source Build 36 16 28,130,676 - 28,131,182 (-) MPROMDB
RGD ID: 7231683 Promoter ID: EPDNEW_H21588 Type: initiation region Name: XPO6_2 Description: exportin 6 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_H21589 EPDNEW_H21598 Experiment Methods: Single-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 16 28,211,580 - 28,211,640 EPDNEW
RGD ID: 7231685 Promoter ID: EPDNEW_H21589 Type: initiation region Name: XPO6_1 Description: exportin 6 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_H21588 EPDNEW_H21598 Experiment Methods: Single-end sequencing.; Paired-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 16 28,211,964 - 28,212,024 EPDNEW
