Advanced Search (OLGA)

Gene: Plekho1 (pleckstrin homology domain containing O1) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Plekho1

Name:

pleckstrin homology domain containing O1

RGD ID:

1311487

Description:

Predicted to be involved in regulation of myoblast fusion. Predicted to act upstream of or within several processes, including lamellipodium morphogenesis; myoblast fusion; and myoblast migration. Predicted to be located in cytoplasm and nucleus. Predicted to be active in muscle cell projection membrane and ruffle membrane. Orthologous to human PLEKHO1 (pleckstrin homology domain containing O1); INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 3,3',4,4',5-pentachlorobiphenyl.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

CK2 interacting protein 1; Ckip1; LOC310674; MGC109581; PH domain-containing family O member 1; pleckstrin homology domain containing, family O member 1; pleckstrin homology domain-containing family O member 1; RGD1311487; similar to TNF intracellular domain-interacting protein

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	186,233,435 - 186,242,114 (-)	NCBI		GRCr8
mRatBN7.2	2	183,544,487 - 183,552,928 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	183,544,499 - 183,552,785 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	191,208,081 - 191,216,052 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	189,012,540 - 189,020,482 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	183,840,633 - 183,848,604 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	198,112,104 - 198,120,202 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	198,112,076 - 198,120,120 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	217,601,880 - 217,609,978 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	190,787,503 - 190,796,057 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	190,750,270 - 190,758,811 (-)	NCBI
Celera	2	176,073,021 - 176,080,794 (-)	NCBI		Celera
Cytogenetic Map	2	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Plekho1	Rat	gastrointestinal stromal tumor		ISO	RGD:1606003	8554872	ClinVar Annotator: match by term: Gastrointestinal stromal tumor	ClinVar	PMID:28492532
Plekho1	Rat	immunodeficiency 42		ISO	RGD:1606003	8554872	ClinVar Annotator: match by term: Autosomal recessive mendelian susceptibility to mycobacterial diseases due to complete more ...	ClinVar	PMID:28492532
Plekho1	Rat	MHC class II deficiency		ISO	RGD:1606003	8554872	ClinVar Annotator: match by term: MHC class II deficiency	ClinVar	PMID:28492532
Plekho1	Rat	parathyroid carcinoma		ISO	RGD:1606003	8554872	ClinVar Annotator: match by term: Parathyroid carcinoma	ClinVar	PMID:28492532
Plekho1	Rat	severe congenital neutropenia 3		ISO	RGD:1606003	8554872	ClinVar Annotator: match by term: Kostmann syndrome	ClinVar	PMID:28492532
Plekho1	Rat	severe congenital neutropenia 5		ISO	RGD:1606003	8554872	ClinVar Annotator: match by term: Congenital neutropenia-myelofibrosis-nephromegaly syndrome	ClinVar	PMID:28492532

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Plekho1	Rat	bipolar disorder		ISO	RGD:1606003	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:31043756

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Plekho1	Rat	1,1-dichloroethene	increases expression	ISO	RGD:1322972	6480464	vinylidene chloride results in increased expression of PLEKHO1 mRNA	CTD	PMID:26682919
Plekho1	Rat	1,2-dichloroethane	decreases expression	ISO	RGD:1322972	6480464	ethylene dichloride results in decreased expression of PLEKHO1 mRNA	CTD	PMID:28960355
Plekho1	Rat	1,2-dimethylhydrazine	increases expression	ISO	RGD:1322972	6480464	1,2-Dimethylhydrazine results in increased expression of PLEKHO1 mRNA	CTD	PMID:22206623
Plekho1	Rat	17beta-estradiol	multiple interactions	ISO	RGD:1606003	6480464	[Estradiol co-treated with Progesterone] results in decreased expression of PLEKHO1 mRNA; [Estradiol co-treated with TGFB1 more ...	CTD	PMID:20660070\|PMID:30165855
Plekho1	Rat	17beta-estradiol	increases expression	EXP		6480464	Estradiol results in increased expression of PLEKHO1 mRNA	CTD	PMID:32145629
Plekho1	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	RGD:1322972	6480464	Tetrachlorodibenzodioxin affects the expression of PLEKHO1 mRNA	CTD	PMID:21570461
Plekho1	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	EXP		6480464	Tetrachlorodibenzodioxin affects the expression of PLEKHO1 mRNA	CTD	PMID:34747641
Plekho1	Rat	3,3',4,4',5-pentachlorobiphenyl	increases expression	EXP		6480464	3,4,5,3',4'-pentachlorobiphenyl results in increased expression of PLEKHO1 mRNA	CTD	PMID:23196670
Plekho1	Rat	4,4'-sulfonyldiphenol	multiple interactions	ISO	RGD:1606003	6480464	[bisphenol S co-treated with Fulvestrant] results in increased methylation of PLEKHO1 gene	CTD	PMID:31601247
Plekho1	Rat	4,4'-sulfonyldiphenol	affects methylation	ISO	RGD:1322972	6480464	bisphenol S affects the methylation of PLEKHO1 gene	CTD	PMID:31683443
Plekho1	Rat	4-hydroxynon-2-enal	decreases expression	ISO	RGD:1322972	6480464	4-hydroxy-2-nonenal results in decreased expression of PLEKHO1 mRNA	CTD	PMID:19191707
Plekho1	Rat	4-hydroxynon-2-enal	increases expression	ISO	RGD:1322972	6480464	4-hydroxy-2-nonenal results in increased expression of PLEKHO1 mRNA	CTD	PMID:19191707
Plekho1	Rat	5-fluorouracil	affects response to substance	ISO	RGD:1606003	6480464	PLEKHO1 protein affects the susceptibility to Fluorouracil	CTD	PMID:16217747
Plekho1	Rat	6-propyl-2-thiouracil	decreases expression	EXP		6480464	Propylthiouracil results in decreased expression of PLEKHO1 mRNA	CTD	PMID:24780913
Plekho1	Rat	acetamide	increases expression	EXP		6480464	acetamide results in increased expression of PLEKHO1 mRNA	CTD	PMID:31881176
Plekho1	Rat	aflatoxin B1	increases expression	ISO	RGD:1606003	6480464	Aflatoxin B1 results in increased expression of PLEKHO1 mRNA	CTD	PMID:22100608
Plekho1	Rat	aflatoxin B1	decreases methylation	ISO	RGD:1606003	6480464	Aflatoxin B1 results in decreased methylation of PLEKHO1 exon	CTD	PMID:30157460
Plekho1	Rat	all-trans-retinoic acid	increases expression	ISO	RGD:1322972	6480464	Tretinoin results in increased expression of PLEKHO1 mRNA	CTD	PMID:16604517
Plekho1	Rat	amitrole	increases expression	EXP		6480464	Amitrole results in increased expression of PLEKHO1 mRNA	CTD	PMID:30047161
Plekho1	Rat	antirheumatic drug	decreases expression	ISO	RGD:1606003	6480464	Antirheumatic Agents results in decreased expression of PLEKHO1 mRNA	CTD	PMID:24449571
Plekho1	Rat	arsane	multiple interactions	ISO	RGD:1606003	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ...	CTD	PMID:39836092
Plekho1	Rat	arsenic atom	multiple interactions	ISO	RGD:1606003	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ...	CTD	PMID:39836092
Plekho1	Rat	arsenous acid	decreases expression	ISO	RGD:1606003	6480464	Arsenic Trioxide results in decreased expression of PLEKHO1 mRNA	CTD	PMID:15761015
Plekho1	Rat	arsenous acid	increases response to substance	ISO	RGD:1606003	6480464	PLEKHO1 protein results in increased susceptibility to Arsenic Trioxide	CTD	PMID:20707922
Plekho1	Rat	atrazine	decreases expression	ISO	RGD:1606003	6480464	Atrazine results in decreased expression of PLEKHO1 mRNA	CTD	PMID:22378314
Plekho1	Rat	benzo[a]pyrene	decreases expression	ISO	RGD:1322972	6480464	Benzo(a)pyrene results in decreased expression of PLEKHO1 mRNA	CTD	PMID:21569818
Plekho1	Rat	benzo[a]pyrene	decreases methylation	ISO	RGD:1606003	6480464	Benzo(a)pyrene results in decreased methylation of PLEKHO1 promoter	CTD	PMID:27901495
Plekho1	Rat	benzo[a]pyrene	increases expression	ISO	RGD:1606003	6480464	Benzo(a)pyrene results in increased expression of PLEKHO1 mRNA	CTD	PMID:20106945\|PMID:22316170\|PMID:26238291\|PMID:32234424
Plekho1	Rat	bisphenol A	increases expression	ISO	RGD:1606003	6480464	bisphenol A results in increased expression of PLEKHO1 mRNA	CTD	PMID:25047013
Plekho1	Rat	bisphenol A	increases expression	ISO	RGD:1322972	6480464	bisphenol A results in increased expression of PLEKHO1 mRNA	CTD	PMID:32156529
Plekho1	Rat	bisphenol A	decreases expression	ISO	RGD:1322972	6480464	bisphenol A results in decreased expression of PLEKHO1 mRNA	CTD	PMID:35598803
Plekho1	Rat	bisphenol A	decreases methylation	ISO	RGD:1606003	6480464	bisphenol A results in decreased methylation of PLEKHO1 gene	CTD	PMID:31601247
Plekho1	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of PLEKHO1 mRNA	CTD	PMID:25181051\|PMID:30816183\|PMID:32145629\|PMID:32528016\|PMID:34947998
Plekho1	Rat	bisphenol F	decreases expression	ISO	RGD:1322972	6480464	bisphenol F results in decreased expression of PLEKHO1 mRNA	CTD	PMID:38685157
Plekho1	Rat	cadmium dichloride	affects expression	EXP		6480464	Cadmium Chloride affects the expression of PLEKHO1 mRNA	CTD	PMID:22110744
Plekho1	Rat	cadmium dichloride	increases expression	ISO	RGD:1606003	6480464	Cadmium Chloride results in increased expression of PLEKHO1 mRNA	CTD	PMID:38568856
Plekho1	Rat	CGP 52608	multiple interactions	ISO	RGD:1606003	6480464	CGP 52608 promotes the reaction [RORA protein binds to PLEKHO1 gene]	CTD	PMID:28238834
Plekho1	Rat	chromium(6+)	multiple interactions	ISO	RGD:1606003	6480464	[zinc chromate results in increased abundance of chromium hexavalent ion] which results in decreased expression more ...	CTD	PMID:38479592
Plekho1	Rat	cisplatin	decreases expression	EXP		6480464	Cisplatin results in decreased expression of PLEKHO1 mRNA	CTD	PMID:22023808
Plekho1	Rat	cisplatin	decreases expression	ISO	RGD:1606003	6480464	Cisplatin results in decreased expression of PLEKHO1 mRNA	CTD	PMID:27392435
Plekho1	Rat	clotrimazole	increases expression	EXP		6480464	Clotrimazole results in increased expression of PLEKHO1 mRNA	CTD	PMID:30047161
Plekho1	Rat	copper(II) sulfate	increases expression	ISO	RGD:1606003	6480464	Copper Sulfate results in increased expression of PLEKHO1 mRNA	CTD	PMID:19549813
Plekho1	Rat	cyclosporin A	increases expression	ISO	RGD:1606003	6480464	Cyclosporine results in increased expression of PLEKHO1 mRNA	CTD	PMID:20106945\|PMID:25562108
Plekho1	Rat	D-mannitol	increases expression	ISO	RGD:1322972	6480464	Mannitol results in increased expression of PLEKHO1 mRNA	CTD	PMID:25270620
Plekho1	Rat	diarsenic trioxide	decreases expression	ISO	RGD:1606003	6480464	Arsenic Trioxide results in decreased expression of PLEKHO1 mRNA	CTD	PMID:15761015
Plekho1	Rat	diarsenic trioxide	increases response to substance	ISO	RGD:1606003	6480464	PLEKHO1 protein results in increased susceptibility to Arsenic Trioxide	CTD	PMID:20707922
Plekho1	Rat	dibutyl phthalate	increases expression	EXP		6480464	Dibutyl Phthalate results in increased expression of PLEKHO1 mRNA	CTD	PMID:21266533
Plekho1	Rat	diuron	decreases expression	ISO	RGD:1606003	6480464	Diuron results in decreased expression of PLEKHO1 mRNA	CTD	PMID:35967413
Plekho1	Rat	doxorubicin	increases expression	ISO	RGD:1606003	6480464	Doxorubicin results in increased expression of PLEKHO1 mRNA	CTD	PMID:29803840
Plekho1	Rat	elemental selenium	increases expression	ISO	RGD:1606003	6480464	Selenium results in increased expression of PLEKHO1 mRNA	CTD	PMID:19244175
Plekho1	Rat	epoxiconazole	decreases expression	ISO	RGD:1322972	6480464	epoxiconazole results in decreased expression of PLEKHO1 mRNA	CTD	PMID:35436446
Plekho1	Rat	ferroheme b	increases expression	ISO	RGD:1322972	6480464	Heme metabolite results in increased expression of PLEKHO1 mRNA	CTD	PMID:19191707
Plekho1	Rat	FR900359	affects phosphorylation	ISO	RGD:1606003	6480464	FR900359 affects the phosphorylation of PLEKHO1 protein	CTD	PMID:37730182
Plekho1	Rat	fulvestrant	multiple interactions	ISO	RGD:1606003	6480464	[bisphenol S co-treated with Fulvestrant] results in increased methylation of PLEKHO1 gene	CTD	PMID:31601247
Plekho1	Rat	heme b	increases expression	ISO	RGD:1322972	6480464	Heme metabolite results in increased expression of PLEKHO1 mRNA	CTD	PMID:19191707
Plekho1	Rat	hydrogen peroxide	affects expression	ISO	RGD:1606003	6480464	Hydrogen Peroxide affects the expression of PLEKHO1 mRNA	CTD	PMID:23410634
Plekho1	Rat	lead diacetate	increases expression	ISO	RGD:1606003	6480464	lead acetate results in increased expression of PLEKHO1 mRNA	CTD	PMID:38568856
Plekho1	Rat	manganese atom	multiple interactions	ISO	RGD:1606003	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ...	CTD	PMID:39836092
Plekho1	Rat	manganese(0)	multiple interactions	ISO	RGD:1606003	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ...	CTD	PMID:39836092
Plekho1	Rat	manganese(II) chloride	multiple interactions	ISO	RGD:1606003	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ...	CTD	PMID:39836092
Plekho1	Rat	menadione	affects expression	ISO	RGD:1606003	6480464	Vitamin K 3 affects the expression of PLEKHO1 mRNA	CTD	PMID:23410634
Plekho1	Rat	methamphetamine	increases expression	ISO	RGD:1322972	6480464	Methamphetamine results in increased expression of PLEKHO1 mRNA	CTD	PMID:26307267
Plekho1	Rat	methimazole	increases expression	EXP		6480464	Methimazole results in increased expression of PLEKHO1 mRNA	CTD	PMID:30047161
Plekho1	Rat	methyl methanesulfonate	decreases expression	ISO	RGD:1606003	6480464	Methyl Methanesulfonate results in decreased expression of PLEKHO1 mRNA	CTD	PMID:23649840
Plekho1	Rat	Muraglitazar	decreases expression	EXP		6480464	muraglitazar results in decreased expression of PLEKHO1 mRNA	CTD	PMID:21515302
Plekho1	Rat	N,N-diethyl-m-toluamide	multiple interactions	EXP		6480464	[Permethrin co-treated with DEET] results in increased methylation of PLEKHO1 gene	CTD	PMID:33148267
Plekho1	Rat	N-nitrosodiethylamine	multiple interactions	ISO	RGD:1322972	6480464	[Piperonyl Butoxide co-treated with Diethylnitrosamine] affects the methylation of PLEKHO1 gene	CTD	PMID:23968726
Plekho1	Rat	nickel atom	increases expression	ISO	RGD:1606003	6480464	Nickel results in increased expression of PLEKHO1 mRNA	CTD	PMID:24768652\|PMID:25583101
Plekho1	Rat	nitrates	multiple interactions	ISO	RGD:1322972	6480464	[Particulate Matter results in increased abundance of Nitrates] which results in increased expression of PLEKHO1 more ...	CTD	PMID:35964746
Plekho1	Rat	okadaic acid	increases expression	ISO	RGD:1606003	6480464	Okadaic Acid results in increased expression of PLEKHO1 mRNA	CTD	PMID:38832940
Plekho1	Rat	ozone	multiple interactions	ISO	RGD:1606003	6480464	[Air Pollutants results in increased abundance of Ozone] which affects the expression of PLEKHO1 mRNA	CTD	PMID:35430440
Plekho1	Rat	paracetamol	decreases expression	EXP		6480464	Acetaminophen results in decreased expression of PLEKHO1 mRNA	CTD	PMID:33387578
Plekho1	Rat	perfluorohexanesulfonic acid	increases expression	ISO	RGD:1322972	6480464	perfluorohexanesulfonic acid results in increased expression of PLEKHO1 mRNA	CTD	PMID:37995155
Plekho1	Rat	permethrin	multiple interactions	EXP		6480464	[Permethrin co-treated with DEET] results in increased methylation of PLEKHO1 gene	CTD	PMID:33148267
Plekho1	Rat	phenobarbital	affects expression	ISO	RGD:1606003	6480464	Phenobarbital affects the expression of PLEKHO1 mRNA	CTD	PMID:19159669
Plekho1	Rat	piperonyl butoxide	multiple interactions	ISO	RGD:1322972	6480464	[Piperonyl Butoxide co-treated with Diethylnitrosamine] affects the methylation of PLEKHO1 gene	CTD	PMID:23968726
Plekho1	Rat	potassium chromate	decreases expression	ISO	RGD:1606003	6480464	potassium chromate(VI) results in decreased expression of PLEKHO1 mRNA	CTD	PMID:22714537
Plekho1	Rat	progesterone	multiple interactions	ISO	RGD:1606003	6480464	[Estradiol co-treated with Progesterone] results in decreased expression of PLEKHO1 mRNA	CTD	PMID:20660070
Plekho1	Rat	quercetin	increases expression	ISO	RGD:1606003	6480464	Quercetin results in increased expression of PLEKHO1 mRNA	CTD	PMID:21632981
Plekho1	Rat	selenium atom	increases expression	ISO	RGD:1606003	6480464	Selenium results in increased expression of PLEKHO1 mRNA	CTD	PMID:19244175
Plekho1	Rat	sodium arsenite	multiple interactions	ISO	RGD:1606003	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ...	CTD	PMID:39836092
Plekho1	Rat	Soman	increases expression	EXP		6480464	Soman results in increased expression of PLEKHO1 mRNA	CTD	PMID:19281266
Plekho1	Rat	sulfadimethoxine	increases expression	EXP		6480464	Sulfadimethoxine results in increased expression of PLEKHO1 mRNA	CTD	PMID:30047161
Plekho1	Rat	sunitinib	decreases expression	ISO	RGD:1606003	6480464	Sunitinib results in decreased expression of PLEKHO1 mRNA	CTD	PMID:31533062
Plekho1	Rat	temozolomide	decreases expression	ISO	RGD:1606003	6480464	Temozolomide results in decreased expression of PLEKHO1 mRNA	CTD	PMID:31758290
Plekho1	Rat	tert-butyl hydroperoxide	affects expression	ISO	RGD:1606003	6480464	tert-Butylhydroperoxide affects the expression of PLEKHO1 mRNA	CTD	PMID:23410634
Plekho1	Rat	titanium dioxide	decreases methylation	ISO	RGD:1322972	6480464	titanium dioxide results in decreased methylation of PLEKHO1 promoter	CTD	PMID:35295148
Plekho1	Rat	triphenyl phosphate	affects expression	ISO	RGD:1606003	6480464	triphenyl phosphate affects the expression of PLEKHO1 mRNA	CTD	PMID:37042841
Plekho1	Rat	triptonide	decreases expression	ISO	RGD:1322972	6480464	triptonide results in decreased expression of PLEKHO1 mRNA	CTD	PMID:33045310
Plekho1	Rat	valproic acid	decreases expression	ISO	RGD:1606003	6480464	Valproic Acid results in decreased expression of PLEKHO1 mRNA	CTD	PMID:28001369
Plekho1	Rat	vinclozolin	decreases expression	EXP		6480464	vinclozolin results in decreased expression of PLEKHO1 mRNA	CTD	PMID:23034163
Plekho1	Rat	vitamin E	increases expression	ISO	RGD:1606003	6480464	Vitamin E results in increased expression of PLEKHO1 mRNA	CTD	PMID:19244175

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Plekho1	Rat	lamellipodium morphogenesis	acts_upstream_of_or_within	ISO	RGD:1322972	1624291	PMID:22553210	RGD	PMID:22553210
Plekho1	Rat	myoblast fusion	acts_upstream_of_or_within	ISO	RGD:1322972	1624291	PMID:22553210	RGD	PMID:22553210
Plekho1	Rat	myoblast migration	acts_upstream_of_or_within	ISO	RGD:1322972	1624291	PMID:22553210	RGD	PMID:22553210
Plekho1	Rat	regulation of cell shape	acts_upstream_of_or_within	ISO	RGD:1322972	1624291	PMID:22553210	RGD	PMID:22553210
Plekho1	Rat	regulation of myoblast fusion	involved_in	IBA	PANTHER:PTN002697595\|ZFIN:ZDB-GENE-100609-2	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Plekho1	Rat	cytoplasm	located_in	IEA	UniProtKB-SubCell:SL-0086	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Plekho1	Rat	cytoplasm	located_in	IEA	UniProtKB-KW:KW-0963	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Plekho1	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Plekho1	Rat	membrane	located_in	IEA	UniProtKB-SubCell:SL-0162	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Plekho1	Rat	muscle cell projection membrane	is_active_in	IBA	MGI:1914470\|PANTHER:PTN002697595	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Plekho1	Rat	muscle cell projection membrane	located_in	ISO	RGD:1322972	1624291	PMID:22553210	RGD	PMID:22553210
Plekho1	Rat	nucleus	located_in	IEA	UniProtKB-SubCell:SL-0191	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Plekho1	Rat	nucleus	located_in	IEA	UniProtKB-KW:KW-0539	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Plekho1	Rat	plasma membrane	located_in	IEA	UniProtKB-SubCell:SL-0039	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Plekho1	Rat	plasma membrane	located_in	IEA	UniProtKB-KW:KW-1003	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Plekho1	Rat	ruffle membrane	located_in	ISO	RGD:1322972	1624291	PMID:22553210	RGD	PMID:22553210
Plekho1	Rat	ruffle membrane	is_active_in	IBA	MGI:1914470\|PANTHER:PTN002697595	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Plekho1	Rat	protein binding	enables	ISO	RGD:1606003	1624291	UniProtKB:A2RU14\|UniProtKB:O95159\|UniProtKB:P01375\|UniProtKB:P62195\|UniProtKB:P78329\|UniProtKB:Q08AM2\|UniProtKB:Q12982\|UniProtKB:Q15546\|UniProtKB:Q15836\|UniProtKB:Q4VAQ0\|UniProtKB:Q5TGU0\|UniProtKB:Q6PL45-2\|UniProtKB:Q7Z4F1\|UniProtKB:Q86UF1\|UniProtKB:Q8N609\|UniProtKB:Q8WVX3-2\|UniProtKB:Q96LK0\|UniProtKB:Q9C0I4\|UniProtKB:Q9H115\|UniProtKB:Q9HCE7\|UniProtKB:Q9HCE7-2\|UniProtKB:Q9Y228 PMID:20580715, PMID:21382345, PMID:23032291, PMID:32296183	RGD	PMID:20580715\|PMID:21382345\|PMID:23032291\|PMID:32296183
Plekho1	Rat	protein binding	enables	ISO	RGD:1322972	1624291	PR:P47757\|PR:Q9CVB6\|PR:Q9R0Q6 PMID:22553210	RGD	PMID:22553210

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:12477932	PMID:22553210	PMID:28083909	PMID:31201843

Plekho1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	186,233,435 - 186,242,114 (-)	NCBI		GRCr8
mRatBN7.2	2	183,544,487 - 183,552,928 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	183,544,499 - 183,552,785 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	191,208,081 - 191,216,052 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	189,012,540 - 189,020,482 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	183,840,633 - 183,848,604 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	198,112,104 - 198,120,202 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	198,112,076 - 198,120,120 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	217,601,880 - 217,609,978 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	190,787,503 - 190,796,057 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	190,750,270 - 190,758,811 (-)	NCBI
Celera	2	176,073,021 - 176,080,794 (-)	NCBI		Celera
Cytogenetic Map	2	q34	NCBI

PLEKHO1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	150,149,646 - 150,160,065 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	150,149,183 - 150,164,720 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	150,121,836 - 150,132,260 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	148,388,794 - 148,398,449 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	1	123,237,889 - 123,247,544 (+)	NCBI		Celera
Cytogenetic Map	1	q21.2	NCBI
HuRef	1	121,502,507 - 121,511,229 (+)	NCBI		HuRef
CHM1_1	1	151,518,106 - 151,527,756 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	149,274,323 - 149,284,749 (+)	NCBI		T2T-CHM13v2.0

Plekho1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	95,896,110 - 95,903,258 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	95,895,741 - 95,903,313 (-)	Ensembl		GRCm39 Ensembl
GRCm38	3	95,988,809 - 95,999,355 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	95,988,429 - 95,996,001 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	3	95,792,751 - 95,799,762 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	3	96,074,233 - 96,081,244 (-)	NCBI		MGSCv36	mm8
Celera	3	97,422,723 - 97,429,850 (-)	NCBI		Celera
Cytogenetic Map	3	F2.1	NCBI
cM Map	3	41.65	NCBI

Plekho1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955413	603,128 - 616,015 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955413	603,011 - 606,487 (-)	NCBI	ChiLan1.0	ChiLan1.0

PLEKHO1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	99,678,952 - 99,689,026 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	99,433,905 - 99,443,656 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	125,494,740 - 125,504,990 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	129,147,114 - 129,157,401 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	129,146,459 - 129,157,401 (+)	Ensembl	panpan1.1		panPan2

PLEKHO1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	17	59,402,758 - 59,411,906 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	17	59,402,834 - 59,411,788 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	17	58,849,824 - 58,858,981 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	17	60,398,910 - 60,408,051 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	17	60,398,979 - 60,408,250 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	17	59,248,504 - 59,257,633 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	17	59,332,396 - 59,341,732 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	17	60,059,457 - 60,068,599 (+)	NCBI		UU_Cfam_GSD_1.0

Plekho1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	21,409,723 - 21,416,853 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936580	440,087 - 447,202 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936580	440,111 - 448,651 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PLEKHO1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	98,923,996 - 98,934,189 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	4	98,924,115 - 98,934,610 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	108,197,951 - 108,208,439 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PLEKHO1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Vero_WHO_p1.0	NW_023666038	13,137,552 - 13,148,013 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Plekho1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624772	17,889,560 - 17,901,213 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624772	17,889,528 - 17,898,739 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Plekho1
44 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	119
Count of miRNA genes:	98
Interacting mature miRNAs:	104
Transcripts:	ENSRNOT00000028747
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578648	Bss11	Bone structure and strength QTL 11	4.7		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	2	114837527	211674221	Rat
1358356	Srcrt1	Stress Responsive Cort QTL1	3.66		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	2	161699179	222436696	Rat
1331734	Bp204	Blood pressure QTL 204	3.61192		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	168358098	223265385	Rat
1298074	Bp164	Blood pressure QTL 164		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118463	226797303	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	81754530	227146641	Rat
10755499	Bp389	Blood pressure QTL 389	2.61		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	18960362	228801039	Rat
1298076	Bp166	Blood pressure QTL 166		0.0009	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	136445150	202447032	Rat
152025245	Scl81	Serum cholesterol level QTL 81	3.49		blood cholesterol amount (VT:0000180)		2	122609194	206936711	Rat
70162	Bp63	Blood pressure QTL 63	5.64		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	2	169745596	214745596	Rat
1554319	Bmd2	Bone mineral density QTL 2	13.4	0.0001	lumbar vertebra area (VT:0010570)	lumbar vertebra cross-sectional area (CMO:0001689)	2	114837675	212549332	Rat
12879836	Kidm61	Kidney mass QTL 61		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	152413072	185122374	Rat
1581569	Uae32	Urinary albumin excretion QTL 32		0.0001	urine protein amount (VT:0005160)	urine albumin excretion rate (CMO:0000757)	2	78665619	219826953	Rat
10043136	Iddm54	Insulin dependent diabetes mellitus QTL 54	3.4	0.0001	blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	2	143657411	190602963	Rat
12879837	Am2	Aortic mass QTL 2		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	2	152413072	185122374	Rat
12879838	Cm86	Cardiac mass QTL 86		0.002	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	152413072	185122374	Rat
1302793	Bw16	Body weight QTL 16	5	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	2	157142209	202446871	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	43154682	202446871	Rat
12879839	Cm85	Cardiac mass QTL 85		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	2	152413072	185122374	Rat
61469	Bp16	Blood pressure QTL 16	5.64		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	2	169745596	214745596	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	absolute change in systolic blood pressure (CMO:0000607)	2	135552573	202446871	Rat
1549833	Bp257	Blood pressure QTL 257		0.003	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	168354880	185122374	Rat
1358900	Bw48	Body weight QTL 48	4.88		body mass (VT:0001259)	body weight (CMO:0000012)	2	157142078	211086598	Rat
1359030	Bp277	Blood pressure QTL 277			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	114837527	185876470	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	56043031	202447032	Rat
12879840	Bw179	Body weight QTL 179		0.005	body mass (VT:0001259)	body weight (CMO:0000012)	2	152413072	185122374	Rat
1581502	Esta3	Estrogen-induced thymic atrophy QTL 3			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	2	136916935	189599348	Rat
9589044	Scfw1	Subcutaneous fat weight QTL 1	5.8	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	2	182171407	227171407	Rat
8694435	Bw166	Body weight QTL 166	14.08	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	2	182171407	227171407	Rat
1359032	Hrtrt18	Heart rate QTL 18			heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	2	157142078	192625452	Rat
2301966	Bp322	Blood pressure QTL 322	3.58		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	150540301	202447032	Rat
1298080	Bp163	Blood pressure QTL 163		0.02	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118275	202447032	Rat
8662832	Vetf7	Vascular elastic tissue fragility QTL 7	3.5		aorta elastin amount (VT:0003905)	aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002)	2	81689826	221035911	Rat
1298085	Bp165	Blood pressure QTL 165		0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
8694194	Abfw1	Abdominal fat weight QTL 1	11.7	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	2	182171407	227171407	Rat
1359022	Ppulsi1	Prepulse inhibition QTL 1	3.63		prepulse inhibition trait (VT:0003088)	acoustic startle response measurement (CMO:0001519)	2	136916935	213594495	Rat
1641891	Alcrsp17	Alcohol response QTL 17			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	149559561	249053267	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	78665619	249053267	Rat
61374	Edpm2	Estrogen-dependent pituitary mass QTL 2	4.42	0.86	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	76539322	202447032	Rat
2300189	Bmd48	Bone mineral density QTL 48	5.8	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	2	179335906	224335906	Rat
8662843	Vetf9	Vascular elastic tissue fragility QTL 9	2.05		thoracic aorta molecular composition trait (VT:0010568)	aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003)	2	157142078	226277316	Rat
631501	Bp101	Blood pressure QTL 101	2.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	150341684	202446871	Rat
2307174	Activ3	Activity QTL 3	4.83	0.000058	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	2	168594495	213594495	Rat
1331794	Bp202	Blood pressure QTL 202	3.66819		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	141194931	223265385	Rat
71113	Cari2	Carrageenan-induced inflammation QTL 2	2.7	0.009	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	2	141596551	202447032	Rat
1331805	Cm29	Cardiac mass QTL 29	3.50746		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	2	141194931	223265385	Rat
634308	Sach6	Saccharin preference QTL 6	4.9		taste sensitivity trait (VT:0001986)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	2	112456140	212696837	Rat
1598805	Memor8	Memory QTL 8	3		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	2	150341585	189039377	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
724568	Uae13	Urinary albumin excretion QTL 13	4.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	2	143157029	210020885	Rat
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
1300165	Rf9	Renal function QTL 9	3.28		kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	2	133914684	202447032	Rat
61401	Niddm2	Non-insulin dependent diabetes mellitus QTL 2	4.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	144599348	189599348	Rat
631507	Bp105	Blood pressure QTL 105		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	112456140	212696837	Rat
1641925	Alcrsp2	Alcohol response QTL 2			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	149559561	221167075	Rat
1354609	Niddm62	Non-insulin dependent diabetes mellitus QTL 62	4.72	0.000006	insulin secretion trait (VT:0003564)	plasma insulin level (CMO:0000342)	2	150540301	202447032	Rat
1598833	Bp295	Blood pressure QTL 295	3.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	147798556	192798556	Rat
61417	Cia10	Collagen induced arthritis QTL 10	3.4		joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	2	179946951	224946951	Rat
1354622	Kidm16	Kidney mass QTL 16	3		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	2	81754530	222436696	Rat
631266	Bp132	Blood pressure QTL 132		0.0005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	46123260	202447032	Rat
631522	Bp74	Blood pressure QTL 74		0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	172710921	184114403	Rat
8694383	Bw158	Body weight QTL 158	7.69	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	2	182171407	227171407	Rat
7488927	Bp365	Blood pressure QTL 365		0.008	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	162765032	207765032	Rat
1598838	Bp290	Blood pressure QTL 290	1.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	166539266	211539266	Rat
7488925	Bp364	Blood pressure QTL 364		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	160564068	205564068	Rat
2306901	Bp337	Blood pressure QTL 337		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	164073756	227146641	Rat
1354605	Rf48	Renal function QTL 48	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	2	74786664	206665859	Rat
6903312	Bw112	Body weight QTL 112	3.2	0.0013	body mass (VT:0001259)	body weight (CMO:0000012)	2	143657569	184114274	Rat
1354601	Slep1	Serum leptin concentration QTL 1	5.39		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	2	43171017	184114403	Rat
2293084	Iddm26	Insulin dependent diabetes mellitus QTL 26	2.9		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	174930955	213594495	Rat

RH141761

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	183,546,579 - 183,546,799 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	198,114,172 - 198,114,391	NCBI	Rnor6.0
Rnor_5.0	2	217,603,948 - 217,604,167	UniSTS	Rnor5.0
RGSC_v3.4	2	190,789,571 - 190,789,790	UniSTS	RGSC3.4
Celera	2	176,075,089 - 176,075,308	UniSTS
RH 3.4 Map	2	1218.8	UniSTS
Cytogenetic Map	2	q34	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001025119	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039102373	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039102374	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039102375	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063281879	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC091420	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474015	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ230444	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ230757	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ232601	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000028747 ⟹ ENSRNOP00000028747

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	2	198,112,076 - 198,120,120 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000079621 ⟹ ENSRNOP00000075725

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	183,544,499 - 183,552,785 (-)	Ensembl
Rnor_6.0 Ensembl	2	198,112,121 - 198,120,041 (-)	Ensembl

RefSeq Acc Id:

NM_001025119 ⟹ NP_001020290

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	186,233,435 - 186,241,294 (-)	NCBI
mRatBN7.2	2	183,544,512 - 183,552,372 (-)	NCBI
Rnor_6.0	2	198,112,104 - 198,120,202 (-)	NCBI
Rnor_5.0	2	217,601,880 - 217,609,978 (-)	NCBI
RGSC_v3.4	2	190,787,503 - 190,796,057 (-)	RGD
Celera	2	176,073,021 - 176,080,794 (-)	RGD

Sequence:

show sequence

CGCGACGTCAGCGGCGGTGGCCGGGGCCCGTGCAGCGGGGGCGGGCATGGGCGGCGGGGGCGGCGGGGGCAGCGGGGGCCTGGCCTGCGGCTAGCGCGAGCCGCCGAGCGAGCAGCGGGCGCGGTCGC
CCGATCCCGCCATGAAGAAGAGCGGCTCCGGCAAGCGGGGGCCTCCGGATGGAAACCATCAGTCTGTGGCTCCCGAGAAGGTCGGCTGGGTCCGGAAATTCTGCGGGAAAGGGATTTTCAGGGAGATT
TGGAAAAACCGCTATGTGGTGCTGAAAGGCGACCAGCTCTACGTCTCCGAGAAGGAGGTAAAAGATGAGAAAAATAGTCAAGAGGTGTTTGACCTGAGTGACTATGAGAAGTGCGAAGAGCTCCGGAA
ATCCAAGAGTAGGAGCAAGAAAAACCACAGCAAGTTCACACTGGCCCGATGCAGACAGCCGGGCACCACGGCCCCCAACCTCATCTTCCTGGCAGTAAGTCCTGAGGAAAAGGAATCATGGATCAACG
CCCTGAGTTCTGCCATTACTAGAGCTAAAAACCGCATCCTGGATGAGGTCACCGTTGAGGAGGACAGCTATCTTGCCCACCCTACCCGAGACAGAGCAAAAATCCAACACTCCCGCCGTCCTCCAACC
CGGGGACACCTCATGGCTGTGGCTTCCACCTCTACCTCAGATGGGATGCTAACATTAGACCTAATCCAAGAAGAAGACCCTTCCCCTGAGGAGCCAGCCTCTTGTGCTGAGAGCTTTCGGGTCGATCT
GGACAAGTCTGTGGCCCAGCTGGCTGGCAGTCGACGGAGAGCGGACTCAGACAGGATCCGTCCCTCTTCACACCGGGCAAGCAGCCTTTCTCGGCCTTGGGAAAGACCAGACAAGGGAGCCCCCTACA
CCCCACAAGCACTGAAGAAGTTACCCAGTACAGAGAAGAGCCGATGTGCCTCCCTGGAGGAGATCCTATCCCAGAGGGACACTGCCCCAGCCCACCCTCTCCACCTTCAAGCTGAGGAATCCCCAGCC
CCTGTCCCCTCCCAGCCGGGGCAGCTGTCCCGGATCCAGGACTTGGTAGCAAGGAAACTGGAGAAGACTCAGGAGCTGCTGGCAGAGGTTCAGGGACTGGGAGATGGCAAATGGAAGGCCAAGGACCC
CCCACGGTCTCCACCCGACTCCCAGTCAGAGCAGCTGCTGCTGGAGACAGAGAGGCTGCTGGGAGAGGCTTCGTCTAACTGGAGCCAGGCGAAGAGAGTGCTGCAGGAAGTCAGGGAGCTGAGAGACC
TGTACAGACAGATGGACCTGCAGACCCCGGACTCCCACCTCAGACAGACCTCTCAGCACAGTCAATACCGGAAGAGTCTGATGTGAAGGATGGGCTGGGCTGGGATTTTGAGGGGCACAGACTCTTTA
TCTCCAAATGTTGCAGGATAAAGCTTTTTTATTTACCTCAATCCAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039102373 ⟹ XP_038958301

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	186,233,491 - 186,242,114 (-)	NCBI
mRatBN7.2	2	183,544,487 - 183,552,928 (-)	NCBI

RefSeq Acc Id:

XM_039102374 ⟹ XP_038958302

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	186,233,491 - 186,242,114 (-)	NCBI
mRatBN7.2	2	183,544,487 - 183,552,928 (-)	NCBI

RefSeq Acc Id:

XM_039102375 ⟹ XP_038958303

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	186,233,491 - 186,242,114 (-)	NCBI
mRatBN7.2	2	183,544,487 - 183,552,928 (-)	NCBI

RefSeq Acc Id:

XM_063281879 ⟹ XP_063137949

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	186,233,491 - 186,241,828 (-)	NCBI


Protein RefSeqs	NP_001020290	(Get FASTA)	NCBI Sequence Viewer
	XP_038958301	(Get FASTA)	NCBI Sequence Viewer
	XP_038958302	(Get FASTA)	NCBI Sequence Viewer
	XP_038958303	(Get FASTA)	NCBI Sequence Viewer
	XP_063137949	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH91420	(Get FASTA)	NCBI Sequence Viewer
	EDL85653	(Get FASTA)	NCBI Sequence Viewer
	EDL85654	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000075725
	ENSRNOP00000108174
GenBank Protein	Q5BJM5	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001020290 ⟸ NM_001025119

- UniProtKB:

Q5BJM5 (UniProtKB/Swiss-Prot), A6K347 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MKKSGSGKRGPPDGNHQSVAPEKVGWVRKFCGKGIFREIWKNRYVVLKGDQLYVSEKEVKDEKNSQEVFDLSDYEKCEELRKSKSRSKKNHSKFTLARCRQPGTTAPNLIFLAVSPEEKESWINALSS
AITRAKNRILDEVTVEEDSYLAHPTRDRAKIQHSRRPPTRGHLMAVASTSTSDGMLTLDLIQEEDPSPEEPASCAESFRVDLDKSVAQLAGSRRRADSDRIRPSSHRASSLSRPWERPDKGAPYTPQA
LKKLPSTEKSRCASLEEILSQRDTAPAHPLHLQAEESPAPVPSQPGQLSRIQDLVARKLEKTQELLAEVQGLGDGKWKAKDPPRSPPDSQSEQLLLETERLLGEASSNWSQAKRVLQEVRELRDLYRQ
MDLQTPDSHLRQTSQHSQYRKSLM

hide sequence

Ensembl Acc Id:

ENSRNOP00000075725 ⟸ ENSRNOT00000079621

Ensembl Acc Id:

ENSRNOP00000028747 ⟸ ENSRNOT00000028747

RefSeq Acc Id:	XP_038958302 ⟸ XM_039102374
- Peptide Label:	isoform X3

RefSeq Acc Id:	XP_038958303 ⟸ XM_039102375
- Peptide Label:	isoform X4

Protein Domains

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5BJM5-F1-model_v2	AlphaFold	Q5BJM5	1-408	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13691572

Promoter ID:

EPDNEW_R2087

Type:

single initiation site

Name:

Plekho1_1

Description:

pleckstrin homology domain containing O1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	2	198,120,212 - 198,120,272	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-52057	BioCyc
Ensembl Genes	ENSRNOG00000021170	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000079621	ENTREZGENE
	ENSRNOT00000122271	ENTREZGENE
Gene3D-CATH	2.30.29.30	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7365370	IMAGE-MGC_LOAD
InterPro	PH-like_dom_sf	UniProtKB/Swiss-Prot
	PH_domain	UniProtKB/Swiss-Prot
	PKHO1/2	UniProtKB/Swiss-Prot
KEGG Report	rno:310674	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:109581	IMAGE-MGC_LOAD
NCBI Gene	310674	ENTREZGENE
PANTHER	PTHR15871	UniProtKB/Swiss-Prot
	PTHR15871:SF1	UniProtKB/Swiss-Prot
Pfam	PF00169	UniProtKB/Swiss-Prot
PhenoGen	Plekho1	PhenoGen
PROSITE	PH_DOMAIN	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000021170	RatGTEx
SMART	SM00233	UniProtKB/Swiss-Prot
Superfamily-SCOP	PH domain-like	UniProtKB/Swiss-Prot
UniProt	A0A0G2KBB3	ENTREZGENE, UniProtKB/TrEMBL
	A6K346	ENTREZGENE, UniProtKB/TrEMBL
	A6K347	ENTREZGENE, UniProtKB/TrEMBL
	PKHO1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-11-30	Plekho1	pleckstrin homology domain containing O1	Plekho1	pleckstrin homology domain containing, family O member 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-02-27	Plekho1	pleckstrin homology domain containing, family O member 1	RGD1311487	similar to TNF intracellular domain-interacting protein	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	RGD1311487	similar to TNF intracellular domain-interacting protein	RGD1311487_predicted	similar to TNF intracellular domain-interacting protein (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-20	RGD1311487_predicted	similar to TNF intracellular domain-interacting protein (predicted)	LOC310674_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC310674_predicted	similar to TNF intracellular domain-interacting protein (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD