Symbol:
Pex16
Name:
peroxisomal biogenesis factor 16
RGD ID:
1311372
Description:
Predicted to be involved in peroxisome organization and protein to membrane docking. Predicted to act upstream of or within protein import into peroxisome matrix. Located in peroxisomal membrane. Human ortholog(s) of this gene implicated in Peroxisome biogenesis disorder 8B and peroxisome biogenesis disorder 8A. Orthologous to human PEX16 (peroxisomal biogenesis factor 16); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene; bisphenol A.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LOC311203; MGC109242; peroxisome biogenesis factor 16
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 98,800,357 - 98,808,091 (+) NCBI GRCr8 mRatBN7.2 3 78,347,212 - 78,352,603 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 78,343,164 - 78,353,207 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 81,823,035 - 81,828,381 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 90,422,076 - 90,427,422 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 88,273,171 - 88,278,517 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 81,283,137 - 81,292,575 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 81,283,137 - 81,292,573 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 87,986,605 - 87,996,042 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 76,769,618 - 76,779,051 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 76,666,045 - 76,675,478 (+) NCBI Celera 3 77,545,160 - 77,554,593 (+) NCBI Celera Cytogenetic Map 3 q24 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Pex16 Rat 1,2-dimethylhydrazine multiple interactions ISO Pex16 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of PEX16 mRNA CTD PMID:22206623 Pex16 Rat 17beta-estradiol increases expression ISO Pex16 (Mus musculus) 6480464 Estradiol results in increased expression of PEX16 mRNA CTD PMID:39298647 Pex16 Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Pex16 (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Pex16 Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO Pex16 (Mus musculus) 6480464 2 more ... CTD PMID:31388691 Pex16 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of PEX16 mRNA CTD PMID:21215274 Pex16 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of PEX16 mRNA CTD PMID:33387578 Pex16 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Pex16 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of PEX16 mRNA CTD PMID:21570461 Pex16 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of PEX16 mRNA CTD PMID:21346803 Pex16 Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Pex16 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of PEX16 mRNA CTD PMID:20188158 Pex16 Rat 4,4'-sulfonyldiphenol increases expression ISO Pex16 (Mus musculus) 6480464 bisphenol S results in increased expression of PEX16 mRNA CTD PMID:39298647 Pex16 Rat 4,4'-sulfonyldiphenol decreases methylation ISO PEX16 (Homo sapiens) 6480464 bisphenol S results in decreased methylation of PEX16 gene CTD PMID:31601247 Pex16 Rat acrylamide decreases expression ISO PEX16 (Homo sapiens) 6480464 Acrylamide results in decreased expression of PEX16 mRNA CTD PMID:32763439 Pex16 Rat antirheumatic drug decreases expression ISO PEX16 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of PEX16 mRNA CTD PMID:24449571 Pex16 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PEX16 mRNA CTD PMID:25181051 Pex16 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PEX16 mRNA CTD PMID:32145629 Pex16 Rat bisphenol F multiple interactions ISO PEX16 (Homo sapiens) 6480464 [bisphenol F co-treated with Fulvestrant] results in increased methylation of PEX16 gene CTD PMID:31601247 Pex16 Rat chlorpyrifos increases expression ISO Pex16 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of PEX16 mRNA CTD PMID:37019170 Pex16 Rat ciguatoxin CTX1B affects expression ISO Pex16 (Mus musculus) 6480464 Ciguatoxins affects the expression of PEX16 mRNA CTD PMID:18353800 Pex16 Rat cocaine increases expression EXP 6480464 Cocaine results in increased expression of PEX16 mRNA CTD PMID:17898221 Pex16 Rat dibutyl phthalate decreases expression ISO Pex16 (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of PEX16 mRNA CTD PMID:21266533 Pex16 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of PEX16 mRNA CTD PMID:24136188 Pex16 Rat folic acid multiple interactions ISO Pex16 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of PEX16 mRNA CTD PMID:22206623 Pex16 Rat FR900359 increases phosphorylation ISO PEX16 (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of PEX16 protein CTD PMID:37730182 Pex16 Rat fulvestrant multiple interactions ISO PEX16 (Homo sapiens) 6480464 [bisphenol F co-treated with Fulvestrant] results in increased methylation of PEX16 gene CTD PMID:31601247 Pex16 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of PEX16 mRNA CTD PMID:33387578 Pex16 Rat isotretinoin decreases expression ISO PEX16 (Homo sapiens) 6480464 Isotretinoin results in decreased expression of PEX16 mRNA CTD PMID:20436886 Pex16 Rat mono(2-ethylhexyl) phthalate increases expression ISO Pex16 (Mus musculus) 6480464 mono-(2-ethylhexyl)phthalate results in increased expression of PEX16 mRNA CTD PMID:32522588 Pex16 Rat Muraglitazar increases expression EXP 6480464 muraglitazar results in increased expression of PEX16 mRNA CTD PMID:21515302 Pex16 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of PEX16 mRNA CTD PMID:24136188 Pex16 Rat nickel atom decreases expression ISO Pex16 (Mus musculus) 6480464 Nickel results in decreased expression of PEX16 mRNA CTD PMID:12540486 Pex16 Rat paracetamol affects expression ISO Pex16 (Mus musculus) 6480464 Acetaminophen affects the expression of PEX16 mRNA CTD PMID:17562736 Pex16 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of PEX16 mRNA CTD PMID:33387578 Pex16 Rat perfluorooctane-1-sulfonic acid increases expression ISO Pex16 (Mus musculus) 6480464 perfluorooctane sulfonic acid results in increased expression of PEX16 mRNA CTD PMID:19429403 and PMID:20936131 Pex16 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Pex16 (Mus musculus) 6480464 PPARA protein promotes the reaction [perfluorooctane sulfonic acid results in increased expression of PEX16 mRNA] CTD PMID:20936131 Pex16 Rat perfluorooctanoic acid increases expression ISO Pex16 (Mus musculus) 6480464 perfluorooctanoic acid results in increased expression of PEX16 mRNA CTD PMID:19429403 Pex16 Rat phenformin increases expression EXP 6480464 Phenformin results in increased expression of PEX16 mRNA CTD PMID:31324951 Pex16 Rat pirinixic acid multiple interactions ISO Pex16 (Mus musculus) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of PEX16 mRNA CTD PMID:19710929 Pex16 Rat pirinixic acid increases expression ISO Pex16 (Mus musculus) 6480464 pirinixic acid results in increased expression of PEX16 mRNA CTD PMID:17426115 more ... Pex16 Rat quercitrin decreases expression ISO PEX16 (Homo sapiens) 6480464 quercitrin results in decreased expression of PEX16 mRNA CTD PMID:25193878 Pex16 Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of PEX16 mRNA CTD PMID:28374803 Pex16 Rat silicon dioxide increases expression ISO PEX16 (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of PEX16 mRNA CTD PMID:23806026 Pex16 Rat sodium arsenite increases expression ISO PEX16 (Homo sapiens) 6480464 sodium arsenite results in increased expression of PEX16 mRNA CTD PMID:38568856 Pex16 Rat sunitinib decreases expression ISO PEX16 (Homo sapiens) 6480464 Sunitinib results in decreased expression of PEX16 mRNA CTD PMID:31533062 Pex16 Rat temozolomide increases expression ISO PEX16 (Homo sapiens) 6480464 Temozolomide results in increased expression of PEX16 mRNA CTD PMID:31758290 Pex16 Rat Tesaglitazar increases expression EXP 6480464 tesaglitazar results in increased expression of PEX16 mRNA CTD PMID:21515302 Pex16 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of PEX16 mRNA CTD PMID:30690589 Pex16 Rat tetrachloromethane decreases expression ISO Pex16 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of PEX16 mRNA CTD PMID:31919559 Pex16 Rat tetrachloromethane increases methylation EXP 6480464 Carbon Tetrachloride results in increased methylation of PEX16 promoter CTD PMID:30690589 Pex16 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of PEX16 mRNA CTD PMID:33387578 Pex16 Rat triphenyl phosphate affects expression ISO PEX16 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of PEX16 mRNA CTD PMID:37042841 Pex16 Rat triptonide increases expression ISO Pex16 (Mus musculus) 6480464 triptonide results in increased expression of PEX16 mRNA CTD PMID:33045310 Pex16 Rat troglitazone increases expression EXP 6480464 troglitazone results in increased expression of PEX16 mRNA CTD PMID:21515302 Pex16 Rat valproic acid affects expression ISO Pex16 (Mus musculus) 6480464 Valproic Acid affects the expression of PEX16 mRNA CTD PMID:17963808 Pex16 Rat valproic acid increases methylation ISO PEX16 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of PEX16 gene CTD PMID:29154799 Pex16 Rat vitamin E decreases expression ISO PEX16 (Homo sapiens) 6480464 Vitamin E results in decreased expression of PEX16 mRNA CTD PMID:19244175
1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,6-dinitrotoluene (EXP) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-sulfonyldiphenol (ISO) acrylamide (ISO) antirheumatic drug (ISO) bisphenol A (EXP) bisphenol F (ISO) chlorpyrifos (ISO) ciguatoxin CTX1B (ISO) cocaine (EXP) dibutyl phthalate (ISO) flutamide (EXP) folic acid (ISO) FR900359 (ISO) fulvestrant (ISO) gentamycin (EXP) isotretinoin (ISO) mono(2-ethylhexyl) phthalate (ISO) Muraglitazar (EXP) nefazodone (EXP) nickel atom (ISO) paracetamol (EXP,ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phenformin (EXP) pirinixic acid (ISO) quercitrin (ISO) rotenone (EXP) silicon dioxide (ISO) sodium arsenite (ISO) sunitinib (ISO) temozolomide (ISO) Tesaglitazar (EXP) tetrachloromethane (EXP,ISO) trichloroethene (EXP) triphenyl phosphate (ISO) triptonide (ISO) troglitazone (EXP) valproic acid (ISO) vitamin E (ISO)
Pex16 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 98,800,357 - 98,808,091 (+) NCBI GRCr8 mRatBN7.2 3 78,347,212 - 78,352,603 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 78,343,164 - 78,353,207 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 81,823,035 - 81,828,381 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 90,422,076 - 90,427,422 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 88,273,171 - 88,278,517 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 81,283,137 - 81,292,575 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 81,283,137 - 81,292,573 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 87,986,605 - 87,996,042 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 76,769,618 - 76,779,051 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 76,666,045 - 76,675,478 (+) NCBI Celera 3 77,545,160 - 77,554,593 (+) NCBI Celera Cytogenetic Map 3 q24 NCBI
PEX16 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 11 45,909,663 - 45,918,822 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 11 45,909,663 - 45,918,812 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 11 45,931,214 - 45,939,428 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 11 45,887,796 - 45,896,182 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 11 45,887,796 - 45,896,182 NCBI Celera 11 46,078,825 - 46,087,276 (-) NCBI Celera Cytogenetic Map 11 p11.2 NCBI HuRef 11 45,638,073 - 45,646,496 (-) NCBI HuRef CHM1_1 11 45,928,639 - 45,937,093 (-) NCBI CHM1_1 T2T-CHM13v2.0 11 46,065,593 - 46,074,744 (-) NCBI T2T-CHM13v2.0
Pex16 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 92,205,043 - 92,211,563 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 92,205,021 - 92,211,562 (+) Ensembl GRCm39 Ensembl GRCm38 2 92,374,676 - 92,381,220 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 92,374,676 - 92,381,217 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 92,214,833 - 92,221,377 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 92,176,337 - 92,182,056 (+) NCBI MGSCv36 mm8 Celera 2 93,767,804 - 93,774,348 (+) NCBI Celera Cytogenetic Map 2 E1 NCBI cM Map 2 50.98 NCBI
Pex16 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955422 2,055,446 - 2,061,729 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955422 2,054,867 - 2,060,871 (+) NCBI ChiLan1.0 ChiLan1.0
PEX16 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 9 48,118,114 - 48,127,750 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 11 48,125,265 - 48,134,598 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 11 45,864,220 - 45,872,263 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 11 46,355,950 - 46,364,552 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 11 46,355,950 - 46,364,543 (-) Ensembl panpan1.1 panPan2
PEX16 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 18 43,506,531 - 43,513,735 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 18 43,507,193 - 43,516,235 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 18 42,234,570 - 42,241,718 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 18 44,162,508 - 44,169,656 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 18 44,163,163 - 44,169,650 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 18 43,646,760 - 43,653,908 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 18 43,199,709 - 43,206,857 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 18 43,931,997 - 43,939,145 (+) NCBI UU_Cfam_GSD_1.0
Pex16 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 20,991,610 - 20,998,245 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936562 3,103,349 - 3,109,887 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936562 3,103,332 - 3,109,884 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PEX16 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 16,555,051 - 16,561,685 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 16,555,045 - 16,560,777 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 17,952,994 - 17,958,743 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PEX16 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 1 19,424,155 - 19,432,430 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 1 19,423,581 - 19,431,948 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 116,700,492 - 116,709,316 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Pex16
.
Predicted Target Of
Count of predictions: 121 Count of miRNA genes: 105 Interacting mature miRNAs: 111 Transcripts: ENSRNOT00000008986 Prediction methods: Microtar, Rnahybrid, Targetscan Result types: miRGate_prediction
1300178 Hrtrt4 Heart rate QTL 4 3.74 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 3 43827364 90905114 Rat 61377 Edpm3 Estrogen-dependent pituitary mass QTL 3 7.05 0.038 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 3 53184692 89878207 Rat 2301414 Kidm37 Kidney mass QTL 37 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 3 70653097 121056321 Rat 1582238 Bw68 Body weight QTL 68 3.2 0.0064 body mass (VT:0001259) body weight (CMO:0000012) 3 53184593 115665732 Rat 1331795 Rf30 Renal function QTL 30 3.708 urine potassium amount (VT:0010539) urine potassium level (CMO:0000128) 3 39454637 89115240 Rat 1582239 Epfw1 Epididymal fat weight QTL 1 4.5 0.0006 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 3 53184593 115665732 Rat 70216 Cm14 Cardiac mass QTL 14 2.1 heart mass (VT:0007028) heart wet weight (CMO:0000069) 3 31172320 163586636 Rat 2292591 Esta4 Estrogen-induced thymic atrophy QTL 4 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 3 47233211 147415807 Rat 1358362 Srcrt2 Stress Responsive Cort QTL 2 2.78 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 3 38192233 133483320 Rat 737818 Hcar12 Hepatocarcinoma resistance QTL 12 2.6 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 3 29463235 118376539 Rat 1582218 Bw74 Body weight QTL 74 3.9 0.0021 body mass (VT:0001259) body weight (CMO:0000012) 3 53184593 115665732 Rat 1331777 Bw24 Body weight QTL 24 3.503 body mass (VT:0001259) body weight (CMO:0000012) 3 39454637 89115240 Rat 1582221 Kidm30 Kidney mass QTL 30 3.5 0.0008 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 3 64655305 115665732 Rat 1581568 Rf53 Renal function QTL 53 urine total protein amount (VT:0000032) urine protein excretion rate to body weight ratio (CMO:0001099) 3 56395968 161299569 Rat 1582210 Bw71 Body weight QTL 71 3.3 0.0012 body mass (VT:0001259) body weight (CMO:0000012) 3 64655305 115665732 Rat 1300111 Rf12 Renal function QTL 12 3.78 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 3 61017749 121056321 Rat 724523 Tsu1 Thymus enlargement suppressive QTL 1 3.84 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 3 50437504 115638231 Rat 1600376 Arunc5 Aerobic running capacity QTL 5 0.21 exercise endurance trait (VT:0002332) maximum distance run on treadmill (CMO:0001406) 3 73376539 118376539 Rat 8662816 Vetf4 Vascular elastic tissue fragility QTL 4 4 renal artery integrity trait (VT:0010642) number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563) 3 59242096 157323038 Rat 1559282 Emca5 Estrogen-induced mammary cancer QTL 5 3.9 mammary gland integrity trait (VT:0010552) percentage of study population developing mammary tumors during a period of time (CMO:0000948) 3 43827364 169034231 Rat 1581503 Cm58 Cardiac mass QTL 58 2.7 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 3 43827364 121056321 Rat 2292613 Ept16 Estrogen-induced pituitary tumorigenesis QTL 16 8.3 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 3 47233430 110362260 Rat 731180 Bp152 Blood pressure QTL 152 0.03 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 53781112 91609953 Rat 738019 Anxrr10 Anxiety related response QTL 10 3.9 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 3 38517803 83517803 Rat 631200 Cm25 Cardiac mass QTL 25 4.8 0.0001 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 3 61134348 89115068 Rat 61419 Cia11 Collagen induced arthritis QTL 11 5.6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 3 30356773 98535386 Rat 12879848 Bw181 Body weght QTL 181 0.015 body mass (VT:0001259) body weight (CMO:0000012) 3 70348525 121056321 Rat 1358905 Hrtrt17 Heart rate QTL 17 5.9 0.000014 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 3 10861912 89878372 Rat 2301971 Cm71 Cardiac mass QTL 71 4.63 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 3 41874578 155617519 Rat 1358885 Bp251 Blood pressure QTL 251 3.8 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 14489145 121056321 Rat 1354597 Kidm13 Kidney mass QTL 13 2.9 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 3 41874578 104104347 Rat 2301970 Bw81 Body weight QTL 81 5.19 body mass (VT:0001259) body weight (CMO:0000012) 3 41874578 155617519 Rat 1581546 Pur13 Proteinuria QTL 13 2.93 0.0335 urine total protein amount (VT:0000032) urine protein excretion rate (CMO:0000759) 3 78196190 146592722 Rat 2290452 Scl56 Serum cholesterol level QTL 56 2.26 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 3 1 91609953 Rat 1354604 Bw36 Body weight QTL 36 2.9 body mass (VT:0001259) body weight (CMO:0000012) 3 33703347 104104347 Rat 631665 Bw8 Body weight QTL 8 5.5 body mass (VT:0001259) body weight (CMO:0000012) 3 50437042 119183768 Rat 1358888 Bp264 Blood pressure QTL 264 4.43 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 14489145 121056321 Rat 1358186 Ept2 Estrogen-induced pituitary tumorigenesis QTL 2 8.3 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 3 47233430 110362260 Rat
BE100549
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 78,350,639 - 78,350,734 (+) MAPPER mRatBN7.2 Rnor_6.0 3 81,290,612 - 81,290,706 NCBI Rnor6.0 Rnor_5.0 3 87,994,080 - 87,994,174 UniSTS Rnor5.0 RGSC_v3.4 3 76,777,093 - 76,777,187 UniSTS RGSC3.4 Celera 3 77,552,635 - 77,552,729 UniSTS RH 3.4 Map 3 706.7 UniSTS Cytogenetic Map 3 q24 UniSTS
AI171187
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 78,345,092 - 78,345,192 (+) MAPPER mRatBN7.2 Rnor_6.0 3 81,285,065 - 81,285,164 NCBI Rnor6.0 Rnor_5.0 3 87,988,533 - 87,988,632 UniSTS Rnor5.0 RGSC_v3.4 3 76,771,546 - 76,771,645 UniSTS RGSC3.4 Celera 3 77,547,088 - 77,547,187 UniSTS Cytogenetic Map 3 q24 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000008986 ⟹ ENSRNOP00000008986
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 78,343,164 - 78,352,597 (+) Ensembl Rnor_6.0 Ensembl 3 81,283,137 - 81,292,569 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000086217 ⟹ ENSRNOP00000069312
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 78,347,297 - 78,353,207 (+) Ensembl Rnor_6.0 Ensembl 3 81,283,281 - 81,292,445 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000086530 ⟹ ENSRNOP00000070009
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 78,347,118 - 78,352,603 (+) Ensembl Rnor_6.0 Ensembl 3 81,287,242 - 81,292,573 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000103955 ⟹ ENSRNOP00000086386
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 78,347,118 - 78,352,602 (+) Ensembl
RefSeq Acc Id:
NM_001012088 ⟹ NP_001012088
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 98,802,745 - 98,808,091 (+) NCBI mRatBN7.2 3 78,347,256 - 78,352,602 (+) NCBI Rnor_6.0 3 81,283,137 - 81,292,570 (+) NCBI Rnor_5.0 3 87,986,605 - 87,996,042 (+) NCBI RGSC_v3.4 3 76,769,618 - 76,779,051 (+) RGD Celera 3 77,545,160 - 77,554,593 (+) RGD
Sequence:
CCCTGCCCTTCCTCCTGGAATGTAGTTTTCTCTACATCCCTTACTTATTTCCCCAGGCCCTCAAGGGAAGCTGAAGGTACCTGTTTGTTCAGGAGGTAGCCCCCACCTCCCACACCTCCACACACATT
hide sequence
RefSeq Acc Id:
XM_039104907 ⟹ XP_038960835
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 98,802,678 - 98,805,818 (+) NCBI mRatBN7.2 3 78,347,215 - 78,350,333 (+) NCBI
RefSeq Acc Id:
XM_063283672 ⟹ XP_063139742
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 98,800,357 - 98,806,142 (+) NCBI
RefSeq Acc Id:
XM_063283673 ⟹ XP_063139743
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 98,803,148 - 98,808,091 (+) NCBI
RefSeq Acc Id:
XM_063283674 ⟹ XP_063139744
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 98,802,678 - 98,806,190 (+) NCBI
RefSeq Acc Id:
XR_010064615
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 98,802,678 - 98,807,358 (+) NCBI
RefSeq Acc Id:
NP_001012088 ⟸ NM_001012088
- UniProtKB:
A0A0G2JWT6 (UniProtKB/TrEMBL), A6HNG5 (UniProtKB/TrEMBL), A0A0G2JV14 (UniProtKB/TrEMBL)
- Sequence:
MRKLGGNLDLPFKVASPIPTSCLSWCTLPLTCLCCSMTGSFGRSFEKKLPVSLSQQKLLTWLSVLECVEVFMEMGAAKVWGEVGRWLVIALIQLAKAVLRMFLLIWFKTGIQTSPPIVPLDRETQAQP
hide sequence
Ensembl Acc Id:
ENSRNOP00000008986 ⟸ ENSRNOT00000008986
Ensembl Acc Id:
ENSRNOP00000070009 ⟸ ENSRNOT00000086530
Ensembl Acc Id:
ENSRNOP00000069312 ⟸ ENSRNOT00000086217
RefSeq Acc Id:
XP_038960835 ⟸ XM_039104907
- Peptide Label:
isoform X4
Ensembl Acc Id:
ENSRNOP00000086386 ⟸ ENSRNOT00000103955
RefSeq Acc Id:
XP_063139742 ⟸ XM_063283672
- Peptide Label:
isoform X1
- UniProtKB:
A0A0G2JV14 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063139744 ⟸ XM_063283674
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_063139743 ⟸ XM_063283673
- Peptide Label:
isoform X2
- UniProtKB:
A6HNG6 (UniProtKB/TrEMBL)
RGD ID: 13692231 Promoter ID: EPDNEW_R2747 Type: initiation region Name: Pex16_1 Description: peroxisomal biogenesis factor 16 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 3 81,287,259 - 81,287,319 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-09-03
Pex16
peroxisomal biogenesis factor 16
Pex16
peroxisome biogenesis factor 16
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-12-06
Pex16
peroxisome biogenesis factor 16
Pex16_predicted
peroxisome biogenesis factor 16 (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-12
Pex16_predicted
peroxisome biogenesis factor 16 (predicted)
Symbol and Name status set to approved
70820 APPROVED
