Symbol:
Exosc4
Name:
exosome component 4
RGD ID:
1310986
Description:
Predicted to enable mRNA 3'-UTR AU-rich region binding activity. Predicted to be involved in DNA deamination; RNA metabolic process; and positive regulation of cell growth. Predicted to act upstream of or within defense response to virus. Predicted to be located in cytosol; euchromatin; and nucleoplasm. Predicted to be part of cytoplasmic exosome (RNase complex) and nuclear exosome (RNase complex). Predicted to be active in nucleolus. Orthologous to human EXOSC4 (exosome component 4); PARTICIPATES IN RNA degradation pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 2,6-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
exosome complex component RRP41; exosome complex exonuclease RRP41; LOC300045
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
EXOSC4 (exosome component 4) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Exosc4 (exosome component 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Exosc4 (exosome component 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
EXOSC4 (exosome component 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
EXOSC4 (exosome component 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Exosc4 (exosome component 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
EXOSC4 (exosome component 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
EXOSC4 (exosome component 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Exosc4 (exosome component 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
EXOSC4 (exosome component 4)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Exosc4 (exosome component 4)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
exosc4 (exosome component 4)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
SKI6
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Ski6
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
exos-4.1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
exosc4
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 109,928,491 - 109,931,233 (+) NCBI GRCr8 mRatBN7.2 7 108,047,831 - 108,050,573 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 108,047,831 - 108,050,573 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 109,791,502 - 109,794,243 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 112,015,196 - 112,017,937 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 111,973,644 - 111,976,386 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 117,390,302 - 117,393,044 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 117,390,285 - 117,393,719 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 117,377,932 - 117,380,674 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 114,374,913 - 114,377,655 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 114,409,175 - 114,411,600 (+) NCBI Celera 7 104,400,183 - 104,402,925 (+) NCBI Celera Cytogenetic Map 7 q34 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Exosc4 Rat (1->4)-beta-D-glucan multiple interactions ISO Exosc4 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of EXOSC4 mRNA CTD PMID:36331819 Exosc4 Rat 1,2-dimethylhydrazine increases expression ISO Exosc4 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of EXOSC4 mRNA CTD PMID:22206623 Exosc4 Rat 1,2-dimethylhydrazine multiple interactions ISO Exosc4 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of EXOSC4 mRNA] CTD PMID:22206623 Exosc4 Rat 17alpha-ethynylestradiol increases expression ISO Exosc4 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of EXOSC4 mRNA CTD PMID:17942748 Exosc4 Rat 17alpha-ethynylestradiol multiple interactions ISO Exosc4 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of EXOSC4 mRNA CTD PMID:17942748 Exosc4 Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Exosc4 (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Exosc4 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Exosc4 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of EXOSC4 mRNA CTD PMID:17942748 Exosc4 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of EXOSC4 mRNA CTD PMID:33387578 Exosc4 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Exosc4 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of EXOSC4 mRNA CTD PMID:24680724 Exosc4 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Exosc4 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of EXOSC4 mRNA CTD PMID:19465110 Exosc4 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of EXOSC4 mRNA CTD PMID:21346803 Exosc4 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of EXOSC4 mRNA CTD PMID:21346803 Exosc4 Rat 4,4'-diaminodiphenylmethane decreases expression ISO Exosc4 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of EXOSC4 mRNA CTD PMID:18648102 Exosc4 Rat 4,4'-sulfonyldiphenol increases expression ISO Exosc4 (Mus musculus) 6480464 bisphenol S results in increased expression of EXOSC4 mRNA CTD PMID:39298647 Exosc4 Rat aflatoxin B1 increases expression ISO Exosc4 (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of EXOSC4 mRNA CTD PMID:19770486 Exosc4 Rat aristolochic acid A increases expression ISO EXOSC4 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of EXOSC4 mRNA CTD PMID:33212167 Exosc4 Rat Aroclor 1254 decreases expression ISO Exosc4 (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of EXOSC4 mRNA CTD PMID:25270620 Exosc4 Rat atrazine decreases expression ISO EXOSC4 (Homo sapiens) 6480464 Atrazine results in decreased expression of EXOSC4 mRNA CTD PMID:22378314 Exosc4 Rat benzo[a]pyrene increases expression ISO EXOSC4 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of EXOSC4 mRNA CTD PMID:21632981 Exosc4 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of EXOSC4 mRNA CTD PMID:25181051 Exosc4 Rat bisphenol F decreases expression ISO Exosc4 (Mus musculus) 6480464 bisphenol F results in decreased expression of EXOSC4 mRNA CTD PMID:38685157 Exosc4 Rat cadmium atom increases expression ISO EXOSC4 (Homo sapiens) 6480464 Cadmium results in increased expression of EXOSC4 mRNA CTD PMID:24376830 Exosc4 Rat cannabidiol increases expression ISO EXOSC4 (Homo sapiens) 6480464 Cannabidiol results in increased expression of EXOSC4 protein CTD PMID:34122009 Exosc4 Rat chlorpyrifos increases expression ISO Exosc4 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of EXOSC4 mRNA CTD PMID:37019170 Exosc4 Rat chromium(6+) multiple interactions ISO EXOSC4 (Homo sapiens) 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in decreased expression of EXOSC4 mRNA CTD PMID:38479592 Exosc4 Rat clofibrate decreases expression ISO Exosc4 (Mus musculus) 6480464 Clofibrate results in decreased expression of EXOSC4 mRNA CTD PMID:17585979 and PMID:25270620 Exosc4 Rat clozapine increases expression ISO EXOSC4 (Homo sapiens) 6480464 Clozapine results in increased expression of EXOSC4 protein CTD PMID:34122009 Exosc4 Rat cobalt dichloride decreases expression ISO EXOSC4 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of EXOSC4 mRNA CTD PMID:19376846 Exosc4 Rat copper(II) sulfate decreases expression ISO EXOSC4 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of EXOSC4 mRNA CTD PMID:19549813 Exosc4 Rat cyclosporin A decreases expression ISO EXOSC4 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of EXOSC4 mRNA CTD PMID:22147139 and PMID:25562108 Exosc4 Rat deguelin decreases expression ISO EXOSC4 (Homo sapiens) 6480464 deguelin results in decreased expression of EXOSC4 mRNA CTD PMID:33512557 Exosc4 Rat diazinon increases methylation ISO EXOSC4 (Homo sapiens) 6480464 Diazinon results in increased methylation of EXOSC4 gene CTD PMID:22964155 Exosc4 Rat Dibutyl phosphate affects expression ISO EXOSC4 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of EXOSC4 mRNA CTD PMID:37042841 Exosc4 Rat dibutyl phthalate decreases expression ISO Exosc4 (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of EXOSC4 mRNA CTD PMID:17361019 and PMID:21266533 Exosc4 Rat elemental selenium increases expression ISO EXOSC4 (Homo sapiens) 6480464 Selenium results in increased expression of EXOSC4 mRNA CTD PMID:19244175 Exosc4 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of EXOSC4 mRNA CTD PMID:29391264 Exosc4 Rat epoxiconazole decreases expression ISO Exosc4 (Mus musculus) 6480464 epoxiconazole results in decreased expression of EXOSC4 mRNA CTD PMID:35436446 Exosc4 Rat ethyl methanesulfonate decreases expression ISO EXOSC4 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in decreased expression of EXOSC4 mRNA CTD PMID:23649840 Exosc4 Rat fenpyroximate decreases expression ISO EXOSC4 (Homo sapiens) 6480464 fenpyroximate results in decreased expression of EXOSC4 mRNA CTD PMID:33512557 Exosc4 Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of EXOSC4 mRNA CTD PMID:24136188 Exosc4 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of EXOSC4 mRNA CTD PMID:24136188 Exosc4 Rat folic acid multiple interactions ISO Exosc4 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of EXOSC4 mRNA] CTD PMID:22206623 Exosc4 Rat formaldehyde decreases expression ISO EXOSC4 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of EXOSC4 mRNA CTD PMID:23649840 Exosc4 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of EXOSC4 mRNA CTD PMID:33387578 Exosc4 Rat homocysteine multiple interactions ISO EXOSC4 (Homo sapiens) 6480464 [Methionine deficiency co-treated with Homocysteine] affects the expression of EXOSC4 protein CTD PMID:17116298 Exosc4 Rat hydrogen peroxide affects expression ISO EXOSC4 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of EXOSC4 mRNA CTD PMID:20044591 Exosc4 Rat hydrogen peroxide multiple interactions ISO EXOSC4 (Homo sapiens) 6480464 [Hydrogen Peroxide co-treated with Theophylline] results in decreased expression of EXOSC4 protein CTD PMID:18951874 Exosc4 Rat ivermectin decreases expression ISO EXOSC4 (Homo sapiens) 6480464 Ivermectin results in decreased expression of EXOSC4 protein CTD PMID:32959892 Exosc4 Rat L-methionine multiple interactions ISO EXOSC4 (Homo sapiens) 6480464 [Methionine deficiency co-treated with Homocysteine] affects the expression of EXOSC4 protein CTD PMID:17116298 Exosc4 Rat leflunomide increases expression EXP 6480464 leflunomide results in increased expression of EXOSC4 mRNA CTD PMID:24136188 Exosc4 Rat methapyrilene decreases expression EXP 6480464 Methapyrilene results in decreased expression of EXOSC4 mRNA CTD PMID:30467583 Exosc4 Rat methyl methanesulfonate decreases expression ISO EXOSC4 (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of EXOSC4 mRNA CTD PMID:23649840 Exosc4 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of EXOSC4 mRNA CTD PMID:24136188 Exosc4 Rat nimesulide increases expression EXP 6480464 nimesulide results in increased expression of EXOSC4 mRNA CTD PMID:24136188 Exosc4 Rat nitrates multiple interactions ISO Exosc4 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of EXOSC4 mRNA CTD PMID:35964746 Exosc4 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of EXOSC4 mRNA CTD PMID:33387578 Exosc4 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Exosc4 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of EXOSC4 mRNA CTD PMID:36331819 Exosc4 Rat pirinixic acid decreases expression ISO Exosc4 (Mus musculus) 6480464 pirinixic acid results in decreased expression of EXOSC4 mRNA CTD PMID:17426115 Exosc4 Rat rotenone increases expression ISO EXOSC4 (Homo sapiens) 6480464 Rotenone results in increased expression of EXOSC4 mRNA CTD PMID:33512557 Exosc4 Rat selenium atom increases expression ISO EXOSC4 (Homo sapiens) 6480464 Selenium results in increased expression of EXOSC4 mRNA CTD PMID:19244175 Exosc4 Rat sodium arsenite increases expression ISO EXOSC4 (Homo sapiens) 6480464 sodium arsenite results in increased expression of EXOSC4 mRNA CTD PMID:34032870 Exosc4 Rat sunitinib decreases expression ISO EXOSC4 (Homo sapiens) 6480464 Sunitinib results in decreased expression of EXOSC4 mRNA CTD PMID:31533062 Exosc4 Rat tacrolimus hydrate decreases expression ISO Exosc4 (Mus musculus) 6480464 Tacrolimus results in decreased expression of EXOSC4 mRNA CTD PMID:25270620 Exosc4 Rat temozolomide increases expression ISO EXOSC4 (Homo sapiens) 6480464 Temozolomide results in increased expression of EXOSC4 mRNA CTD PMID:31758290 Exosc4 Rat tetrachloroethene decreases expression ISO Exosc4 (Mus musculus) 6480464 Tetrachloroethylene results in decreased expression of EXOSC4 mRNA CTD PMID:28973375 Exosc4 Rat theophylline multiple interactions ISO EXOSC4 (Homo sapiens) 6480464 [Hydrogen Peroxide co-treated with Theophylline] results in decreased expression of EXOSC4 protein CTD PMID:18951874 Exosc4 Rat thifluzamide decreases expression ISO EXOSC4 (Homo sapiens) 6480464 thifluzamide results in decreased expression of EXOSC4 mRNA CTD PMID:33512557 Exosc4 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of EXOSC4 mRNA CTD PMID:34492290 Exosc4 Rat thiram decreases expression ISO EXOSC4 (Homo sapiens) 6480464 Thiram results in decreased expression of EXOSC4 mRNA CTD PMID:38568856 Exosc4 Rat trichloroethene increases methylation EXP 6480464 Trichloroethylene results in increased methylation of EXOSC4 gene CTD PMID:27618143 Exosc4 Rat triphenyl phosphate affects expression ISO EXOSC4 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of EXOSC4 mRNA CTD PMID:37042841 Exosc4 Rat valproic acid affects expression ISO Exosc4 (Mus musculus) 6480464 Valproic Acid affects the expression of EXOSC4 mRNA CTD PMID:17292431 Exosc4 Rat valproic acid increases expression ISO EXOSC4 (Homo sapiens) 6480464 Valproic Acid results in increased expression of EXOSC4 mRNA CTD PMID:23179753 Exosc4 Rat valproic acid affects expression ISO EXOSC4 (Homo sapiens) 6480464 Valproic Acid affects the expression of EXOSC4 mRNA CTD PMID:25979313 Exosc4 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of EXOSC4 mRNA CTD PMID:23034163 Exosc4 Rat vitamin E increases expression ISO EXOSC4 (Homo sapiens) 6480464 Vitamin E results in increased expression of EXOSC4 mRNA CTD PMID:19244175 Exosc4 Rat vorinostat decreases expression ISO EXOSC4 (Homo sapiens) 6480464 vorinostat results in decreased expression of EXOSC4 mRNA CTD PMID:22083351
Imported Annotations - KEGG (archival)
(1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (EXP) 2,6-dinitrotoluene (EXP) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) aflatoxin B1 (ISO) aristolochic acid A (ISO) Aroclor 1254 (ISO) atrazine (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP) bisphenol F (ISO) cadmium atom (ISO) cannabidiol (ISO) chlorpyrifos (ISO) chromium(6+) (ISO) clofibrate (ISO) clozapine (ISO) cobalt dichloride (ISO) copper(II) sulfate (ISO) cyclosporin A (ISO) deguelin (ISO) diazinon (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (ISO) elemental selenium (ISO) endosulfan (EXP) epoxiconazole (ISO) ethyl methanesulfonate (ISO) fenpyroximate (ISO) finasteride (EXP) flutamide (EXP) folic acid (ISO) formaldehyde (ISO) gentamycin (EXP) homocysteine (ISO) hydrogen peroxide (ISO) ivermectin (ISO) L-methionine (ISO) leflunomide (EXP) methapyrilene (EXP) methyl methanesulfonate (ISO) nefazodone (EXP) nimesulide (EXP) nitrates (ISO) paracetamol (EXP) perfluorooctane-1-sulfonic acid (ISO) pirinixic acid (ISO) rotenone (ISO) selenium atom (ISO) sodium arsenite (ISO) sunitinib (ISO) tacrolimus hydrate (ISO) temozolomide (ISO) tetrachloroethene (ISO) theophylline (ISO) thifluzamide (ISO) thioacetamide (EXP) thiram (ISO) trichloroethene (EXP) triphenyl phosphate (ISO) valproic acid (ISO) vinclozolin (EXP) vitamin E (ISO) vorinostat (ISO)
Biological Process
defense response to virus (IEA,ISO) DNA deamination (IEA,ISO) gene expression (IEA) histone mRNA catabolic process (IEA,ISO) maturation of 5.8S rRNA (IEA,ISO) nuclear mRNA surveillance (IBA,IEA,ISO) nuclear-transcribed mRNA catabolic process (IEA,ISO) poly(A)-dependent snoRNA 3'-end processing (IBA) positive regulation of cell growth (IEA,ISO) RNA catabolic process (IEA,ISO) RNA processing (IEA,ISO) rRNA catabolic process (IBA) U4 snRNA 3'-end processing (IBA)
Exosc4 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 109,928,491 - 109,931,233 (+) NCBI GRCr8 mRatBN7.2 7 108,047,831 - 108,050,573 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 108,047,831 - 108,050,573 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 109,791,502 - 109,794,243 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 112,015,196 - 112,017,937 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 111,973,644 - 111,976,386 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 117,390,302 - 117,393,044 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 117,390,285 - 117,393,719 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 117,377,932 - 117,380,674 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 114,374,913 - 114,377,655 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 114,409,175 - 114,411,600 (+) NCBI Celera 7 104,400,183 - 104,402,925 (+) NCBI Celera Cytogenetic Map 7 q34 NCBI
EXOSC4 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 8 144,064,056 - 144,080,648 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 8 144,078,648 - 144,080,648 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 8 145,133,575 - 145,135,551 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 8 145,205,510 - 145,207,539 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 8 145,205,509 - 145,207,538 NCBI Celera 8 141,471,120 - 141,473,149 (+) NCBI Celera Cytogenetic Map 8 q24.3 NCBI HuRef 8 140,409,424 - 140,411,453 (+) NCBI HuRef CHM1_1 8 145,173,774 - 145,175,803 (+) NCBI CHM1_1 T2T-CHM13v2.0 8 145,239,523 - 145,241,499 (+) NCBI T2T-CHM13v2.0
Exosc4 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 15 76,211,597 - 76,214,870 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 15 76,211,597 - 76,214,877 (+) Ensembl GRCm39 Ensembl GRCm38 15 76,327,397 - 76,330,670 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 15 76,327,397 - 76,330,677 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 15 76,157,827 - 76,161,100 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 15 76,154,652 - 76,157,925 (+) NCBI MGSCv36 mm8 Celera 15 77,827,457 - 77,830,730 (+) NCBI Celera Cytogenetic Map 15 D3 NCBI cM Map 15 35.72 NCBI
Exosc4 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955454 2,732,308 - 2,734,398 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955454 2,732,308 - 2,734,398 (+) NCBI ChiLan1.0 ChiLan1.0
EXOSC4 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 7 161,567,694 - 161,570,332 (+) NCBI NHGRI_mPanPan1-v2 PanPan1.1 Ensembl 8 143,837,256 - 143,839,292 (+) Ensembl panpan1.1 panPan2
EXOSC4 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 13 37,574,359 - 37,576,331 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 13 37,574,527 - 37,577,380 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 13 37,538,000 - 37,539,976 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 13 38,050,575 - 38,052,551 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 13 38,050,749 - 38,052,547 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 13 37,722,667 - 37,724,645 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 13 37,850,873 - 37,852,853 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 13 38,327,465 - 38,329,442 (+) NCBI UU_Cfam_GSD_1.0
Exosc4 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405303 671,119 - 673,221 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936470 8,097,267 - 8,099,201 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936470 8,097,218 - 8,099,319 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
EXOSC4
EXOSC4 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 8 138,290,581 - 138,292,621 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 8 138,290,705 - 138,292,570 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666039 1,580,358 - 1,582,396 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Exosc4
.
Predicted Target Of
Count of predictions: 56 Count of miRNA genes: 52 Interacting mature miRNAs: 55 Transcripts: ENSRNOT00000016464 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
1300179 Kidm5 Kidney mass QTL 5 3.51 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 43747012 135012528 Rat 1331728 Bp214 Blood pressure QTL 214 2.825 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 80221299 124373579 Rat 1331731 Bp216 Blood pressure QTL 216 2.851 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 102297359 133492884 Rat 2298475 Eau6 Experimental allergic uveoretinitis QTL 6 0.0029 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 7 84257275 129257275 Rat 71114 Niddm14 Non-insulin dependent diabetes mellitus QTL 14 4.5 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 7 84257275 129257275 Rat 1357336 Gluco6 Glucose level QTL 6 3.4 blood glucose amount (VT:0000188) serum glucose level (CMO:0000543) 7 94811326 116294265 Rat 1358361 Sradr5 Stress Responsive Adrenal Weight QTL 5 5.55 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 7 43747012 108555253 Rat 1357338 Stl17 Serum triglyceride level QTL 17 3.23 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 7 69736356 112729554 Rat 631687 Hcas1 Hepatocarcinoma susceptibility QTL 1 3.9 0.001 liver integrity trait (VT:0010547) liver tumorous lesion volume to total liver volume ratio (CMO:0001082) 7 91412594 129807172 Rat 70159 Bp61 Blood pressure QTL 61 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 103146217 116738842 Rat 634331 Pia17 Pristane induced arthritis QTL 17 4.7 joint integrity trait (VT:0010548) arthritic paw count (CMO:0001460) 7 73829340 130221005 Rat 1358914 Bp266 Blood pressure QTL 266 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 83591953 134666232 Rat 631504 Cm27 Cardiac mass QTL 27 3.45 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 7 44421311 118198041 Rat 634322 Bw12 Body weight QTL 12 0 body mass (VT:0001259) body weight (CMO:0000012) 7 83153392 128153392 Rat 70173 Niddm19 Non-insulin dependent diabetes mellitus QTL 19 4.33 0.00005 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 7 64002457 135012528 Rat 1549899 Stresp8 Stress response QTL 8 4.37 0.0008 stress-related behavior trait (VT:0010451) defensive burying duration (CMO:0001961) 7 90482196 135012528 Rat 2317052 Aia17 Adjuvant induced arthritis QTL 17 2.13 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 7 81737938 126737938 Rat 631529 Tls2 T-lymphoma susceptibility QTL 2 0 0.001 thymus integrity trait (VT:0010555) percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911) 7 80221299 109401111 Rat 731176 Glom5 Glomerulus QTL 5 2.5 0.0035 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 7 96670164 135012528 Rat 7411607 Foco15 Food consumption QTL 15 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 7 75918751 120918751 Rat 2306821 Bp335 Blood pressure QTL 335 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 106571501 135012528 Rat 1558655 Swd4 Spike wave discharge measurement QTL 4 3.68 0.0002 brain electrophysiology trait (VT:0010557) brain spike-and-wave discharge severity grade (CMO:0001988) 7 86983365 131983365 Rat 634336 Anxrr17 Anxiety related response QTL 17 3.66 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 924703 115097879 Rat 1331768 Kidm10 Kidney mass QTL 10 4.62096 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 80221299 125221299 Rat 61357 Bp38 Blood pressure QTL 38 1.6 0.052 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 41333674 119109060 Rat 2313102 Bmd79 Bone mineral density QTL 79 2.3 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 7 94811085 116738842 Rat 731174 Uae23 Urinary albumin excretion QTL 23 2.4 0.0042 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 7 104603555 135012528 Rat 2316947 Rf58 Renal function QTL 58 7.8 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 7 68938720 113886318 Rat 1331746 Kidm9 Kidney mass QTL 9 3.934 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 7 80221299 112308525 Rat 7411654 Foco25 Food consumption QTL 25 9.3 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 7 75918751 120918751 Rat 2316955 Stl24 Serum triglyceride level QTL 24 7.1 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 7 68938720 113886318 Rat 2299163 Iddm34 Insulin dependent diabetes mellitus QTL 34 2.71 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 7 91281130 135012528 Rat 2316952 Pur22 Proteinuria QTL 22 5.2 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 7 68938720 113886318 Rat 631540 Bw9 Body weight QTL 9 4.5 body mass (VT:0001259) body weight (CMO:0000012) 7 69736226 117455174 Rat 1358891 Bp265 Blood pressure QTL 265 2.21 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 83591953 134666232 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000016464 ⟹ ENSRNOP00000016464
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 108,047,831 - 108,050,573 (+) Ensembl Rnor_6.0 Ensembl 7 117,390,285 - 117,393,719 (+) Ensembl
RefSeq Acc Id:
NM_001134860 ⟹ NP_001128332
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 109,928,491 - 109,931,233 (+) NCBI mRatBN7.2 7 108,047,831 - 108,050,573 (+) NCBI Rnor_6.0 7 117,390,302 - 117,393,044 (+) NCBI Rnor_5.0 7 117,377,932 - 117,380,674 (+) NCBI RGSC_v3.4 7 114,374,913 - 114,377,655 (+) RGD Celera 7 104,400,183 - 104,402,925 (+) RGD
Sequence:
GGGTCGTGCTCTCGGAGGCGGAGCGAGGACTGCGCAACATGGCCGGGCTGGAGCTCCTGTCCGATCAGGGTTACCGGATAGACGGTCGCCGCGCGGGGGAGCTGCGCAAGATTCAGGCGCGGATGGGC
hide sequence
RefSeq Acc Id:
NP_001128332 ⟸ NM_001134860
- UniProtKB:
D4A4Y0 (UniProtKB/TrEMBL)
- Sequence:
MAGLELLSDQGYRIDGRRAGELRKIQARMGVFAQADGSAYIEQGNTKALAVVYGPHEIRGSRSRALPDRALVNCQYSSATFSTGERKRRPHGDRKSCEMGLQLRQTFEAAILTQLHPRSQIDIYVQVL
hide sequence
Ensembl Acc Id:
ENSRNOP00000016464 ⟸ ENSRNOT00000016464
RGD ID: 13695413 Promoter ID: EPDNEW_R5937 Type: multiple initiation site Name: Exosc4_1 Description: exosome component 4 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 7 117,390,326 - 117,390,386 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-04-30
Exosc4
exosome component 4
Exosc4_predicted
exosome component 4 (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Exosc4_predicted
exosome component 4 (predicted)
Symbol and Name status set to approved
70820 APPROVED
