Symbol:
Cibar1
Name:
CBY1 interacting BAR domain containing 1
RGD ID:
1310681
Description:
Predicted to enable phospholipid binding activity. Predicted to be involved in several processes, including inner mitochondrial membrane organization; membrane tubulation; and positive regulation of smoothened signaling pathway. Predicted to be located in several cellular components, including centriole; ciliary base; and mitochondrial crista. Predicted to be active in ciliary basal body and ciliary transition zone. Orthologous to human CIBAR1 (CBY1 interacting BAR domain containing 1); INTERACTS WITH 2,2',5,5'-tetrachlorobiphenyl; 2,3,7,8-tetrachlorodibenzodioxine; 3H-1,2-dithiole-3-thione.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
CBY1-interacting BAR domain-containing protein 1; Fam92a; Fam92a1; family with sequence similarity 92 member A; family with sequence similarity 92, member A1; LOC297903; RGD1310681; similar to RIKEN cDNA 6720467C03
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 30,411,325 - 30,429,770 (-) NCBI GRCr8 mRatBN7.2 5 25,613,993 - 25,632,440 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 25,614,033 - 25,632,489 (-) Ensembl mRatBN7.2 Ensembl Rnor_6.0 5 25,732,457 - 25,750,953 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 25,732,644 - 25,750,826 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 30,436,344 - 30,454,797 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 26,402,199 - 26,420,568 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 26,402,385 - 26,420,568 (-) NCBI Celera 5 24,943,561 - 24,962,057 (-) NCBI Celera Cytogenetic Map 5 q13 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Cibar1 Rat (1->4)-beta-D-glucan multiple interactions ISO Cibar1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of FAM92A mRNA CTD PMID:36331819 Cibar1 Rat 1,2-dimethylhydrazine multiple interactions ISO Cibar1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of CIBAR1 mRNA CTD PMID:22206623 Cibar1 Rat 1,2-dimethylhydrazine increases expression ISO Cibar1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of CIBAR1 mRNA CTD PMID:22206623 Cibar1 Rat 17beta-estradiol increases expression ISO Cibar1 (Mus musculus) 6480464 Estradiol results in increased expression of CIBAR1 mRNA CTD PMID:39298647 Cibar1 Rat 2,2',5,5'-tetrachlorobiphenyl increases expression EXP 6480464 2 more ... CTD PMID:23829299 Cibar1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of CIBAR1 mRNA CTD PMID:21215274 and PMID:22808131 Cibar1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Cibar1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of CIBAR1 mRNA CTD PMID:24680724 Cibar1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 AHR protein alternative form affects the reaction [Tetrachlorodibenzodioxin results in decreased expression of CIBAR1 mRNA] CTD PMID:21215274 Cibar1 Rat 3H-1,2-dithiole-3-thione decreases expression EXP 6480464 1 and 2-dithiol-3-thione results in decreased expression of CIBAR1 mRNA CTD PMID:19162173 Cibar1 Rat 4,4'-sulfonyldiphenol increases expression ISO Cibar1 (Mus musculus) 6480464 bisphenol S results in increased expression of CIBAR1 mRNA CTD PMID:39298647 Cibar1 Rat 4,4'-sulfonyldiphenol decreases methylation ISO CIBAR1 (Homo sapiens) 6480464 bisphenol S results in decreased methylation of CIBAR1 gene CTD PMID:31601247 Cibar1 Rat all-trans-retinoic acid decreases expression ISO CIBAR1 (Homo sapiens) 6480464 Tretinoin results in decreased expression of CIBAR1 mRNA CTD PMID:33167477 Cibar1 Rat arsane affects methylation ISO CIBAR1 (Homo sapiens) 6480464 Arsenic affects the methylation of CIBAR1 gene CTD PMID:25304211 Cibar1 Rat arsane multiple interactions ISO CIBAR1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of CIBAR1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of CIBAR1 mRNA CTD PMID:39836092 Cibar1 Rat arsenic atom affects methylation ISO CIBAR1 (Homo sapiens) 6480464 Arsenic affects the methylation of CIBAR1 gene CTD PMID:25304211 Cibar1 Rat arsenic atom multiple interactions ISO CIBAR1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of CIBAR1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of CIBAR1 mRNA CTD PMID:39836092 Cibar1 Rat benzo[a]pyrene decreases methylation ISO CIBAR1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of CIBAR1 promoter CTD PMID:27901495 Cibar1 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with tributyltin] results in increased expression of CIBAR1 mRNA CTD PMID:31129395 Cibar1 Rat bisphenol A decreases expression ISO Cibar1 (Mus musculus) 6480464 bisphenol A results in decreased expression of CIBAR1 mRNA CTD PMID:33221593 Cibar1 Rat carbon nanotube increases expression ISO Cibar1 (Mus musculus) 6480464 Nanotubes and Carbon results in increased expression of CIBAR1 mRNA CTD PMID:25554681 Cibar1 Rat copper(II) sulfate decreases expression ISO CIBAR1 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of CIBAR1 mRNA CTD PMID:19549813 Cibar1 Rat dicrotophos decreases expression ISO CIBAR1 (Homo sapiens) 6480464 dicrotophos results in decreased expression of CIBAR1 mRNA CTD PMID:28302478 Cibar1 Rat diethylstilbestrol decreases expression ISO CIBAR1 (Homo sapiens) 6480464 Diethylstilbestrol results in decreased expression of CIBAR1 mRNA CTD PMID:36621641 Cibar1 Rat epoxiconazole increases expression ISO Cibar1 (Mus musculus) 6480464 epoxiconazole results in increased expression of CIBAR1 mRNA CTD PMID:35436446 Cibar1 Rat folic acid multiple interactions ISO Cibar1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of CIBAR1 mRNA CTD PMID:22206623 Cibar1 Rat FR900359 decreases phosphorylation ISO CIBAR1 (Homo sapiens) 6480464 FR900359 results in decreased phosphorylation of CIBAR1 protein CTD PMID:37730182 Cibar1 Rat gallic acid decreases expression ISO CIBAR1 (Homo sapiens) 6480464 Gallic Acid results in decreased expression of CIBAR1 mRNA CTD PMID:34408198 Cibar1 Rat ketoconazole decreases expression ISO CIBAR1 (Homo sapiens) 6480464 Ketoconazole results in decreased expression of CIBAR1 mRNA CTD PMID:36621641 Cibar1 Rat kojic acid increases expression ISO CIBAR1 (Homo sapiens) 6480464 kojic acid results in increased expression of CIBAR1 mRNA CTD PMID:16595896 Cibar1 Rat manganese atom multiple interactions ISO CIBAR1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of CIBAR1 mRNA and [manganese chloride results in increased abundance of Manganese] which results in increased expression of CIBAR1 mRNA CTD PMID:39836092 Cibar1 Rat manganese(0) multiple interactions ISO CIBAR1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of CIBAR1 mRNA and [manganese chloride results in increased abundance of Manganese] which results in increased expression of CIBAR1 mRNA CTD PMID:39836092 Cibar1 Rat manganese(II) chloride multiple interactions ISO CIBAR1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of CIBAR1 mRNA and [manganese chloride results in increased abundance of Manganese] which results in increased expression of CIBAR1 mRNA CTD PMID:39836092 Cibar1 Rat mercury dichloride decreases expression ISO CIBAR1 (Homo sapiens) 6480464 Mercuric Chloride results in decreased expression of CIBAR1 mRNA CTD PMID:27188386 Cibar1 Rat methylparaben decreases expression ISO CIBAR1 (Homo sapiens) 6480464 methylparaben results in decreased expression of CIBAR1 mRNA CTD PMID:31745603 Cibar1 Rat oxaliplatin multiple interactions EXP 6480464 [Oxaliplatin co-treated with Topotecan] results in decreased expression of CIBAR1 mRNA CTD PMID:25729387 Cibar1 Rat oxaliplatin decreases expression EXP 6480464 Oxaliplatin results in decreased expression of CIBAR1 mRNA CTD PMID:25729387 Cibar1 Rat ozone multiple interactions ISO Cibar1 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of CIBAR1 mRNA CTD PMID:34911549 Cibar1 Rat PCB138 decreases expression EXP 6480464 2 more ... CTD PMID:23829299 Cibar1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Cibar1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of FAM92A mRNA CTD PMID:36331819 Cibar1 Rat silicon dioxide increases expression ISO CIBAR1 (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of CIBAR1 mRNA CTD PMID:25895662 Cibar1 Rat silicon dioxide decreases expression ISO Cibar1 (Mus musculus) 6480464 Silicon Dioxide results in decreased expression of CIBAR1 mRNA CTD PMID:19073995 and PMID:33720480 Cibar1 Rat sodium arsenite multiple interactions ISO CIBAR1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of CIBAR1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of CIBAR1 mRNA CTD PMID:39836092 Cibar1 Rat sunitinib decreases expression ISO CIBAR1 (Homo sapiens) 6480464 Sunitinib results in decreased expression of CIBAR1 mRNA CTD PMID:31533062 Cibar1 Rat tetrachloromethane increases expression ISO Cibar1 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of CIBAR1 mRNA CTD PMID:31919559 Cibar1 Rat thimerosal decreases expression ISO CIBAR1 (Homo sapiens) 6480464 Thimerosal results in decreased expression of CIBAR1 mRNA CTD PMID:27188386 Cibar1 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of CIBAR1 mRNA CTD PMID:34492290 Cibar1 Rat topotecan multiple interactions EXP 6480464 [Oxaliplatin co-treated with Topotecan] results in decreased expression of CIBAR1 mRNA CTD PMID:25729387 Cibar1 Rat topotecan decreases expression EXP 6480464 Topotecan results in decreased expression of CIBAR1 mRNA CTD PMID:25729387 Cibar1 Rat tributylstannane increases expression EXP 6480464 tributyltin results in increased expression of CIBAR1 mRNA CTD PMID:31129395 Cibar1 Rat tributylstannane multiple interactions EXP 6480464 [bisphenol A co-treated with tributyltin] results in increased expression of CIBAR1 mRNA CTD PMID:31129395 Cibar1 Rat triptonide decreases expression ISO Cibar1 (Mus musculus) 6480464 triptonide results in decreased expression of CIBAR1 mRNA CTD PMID:33045310 Cibar1 Rat tungsten increases expression ISO Cibar1 (Mus musculus) 6480464 Tungsten results in increased expression of CIBAR1 mRNA CTD PMID:30912803 Cibar1 Rat valproic acid increases methylation ISO CIBAR1 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of CIBAR1 gene CTD PMID:29154799 Cibar1 Rat vorinostat decreases expression ISO CIBAR1 (Homo sapiens) 6480464 Vorinostat results in decreased expression of CIBAR1 mRNA CTD PMID:27188386
(1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,2',5,5'-tetrachlorobiphenyl (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3H-1,2-dithiole-3-thione (EXP) 4,4'-sulfonyldiphenol (ISO) all-trans-retinoic acid (ISO) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) carbon nanotube (ISO) copper(II) sulfate (ISO) dicrotophos (ISO) diethylstilbestrol (ISO) epoxiconazole (ISO) folic acid (ISO) FR900359 (ISO) gallic acid (ISO) ketoconazole (ISO) kojic acid (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) mercury dichloride (ISO) methylparaben (ISO) oxaliplatin (EXP) ozone (ISO) PCB138 (EXP) perfluorooctane-1-sulfonic acid (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sunitinib (ISO) tetrachloromethane (ISO) thimerosal (ISO) thioacetamide (EXP) topotecan (EXP) tributylstannane (EXP) triptonide (ISO) tungsten (ISO) valproic acid (ISO) vorinostat (ISO)
Cellular Component
centriole (IEA,ISO) ciliary basal body (IBA,ISO) ciliary base (IEA,ISO) ciliary transition zone (IBA,ISO) cilium (ISO) cytoplasm (IEA,ISO,ISS) cytoskeleton (IEA) mitochondrial crista (IEA,ISO) mitochondrial inner membrane (IEA,ISO,ISS) mitochondrion (IEA,ISO) nucleus (IEA,ISO,ISS)
Cibar1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 30,411,325 - 30,429,770 (-) NCBI GRCr8 mRatBN7.2 5 25,613,993 - 25,632,440 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 25,614,033 - 25,632,489 (-) Ensembl mRatBN7.2 Ensembl Rnor_6.0 5 25,732,457 - 25,750,953 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 25,732,644 - 25,750,826 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 30,436,344 - 30,454,797 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 26,402,199 - 26,420,568 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 26,402,385 - 26,420,568 (-) NCBI Celera 5 24,943,561 - 24,962,057 (-) NCBI Celera Cytogenetic Map 5 q13 NCBI
CIBAR1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 8 93,700,550 - 93,731,527 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 8 93,698,561 - 93,731,527 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 8 94,712,778 - 94,743,755 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 8 94,781,949 - 94,809,850 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 8 90,898,882 - 90,926,735 (+) NCBI Celera Cytogenetic Map 8 q22.1 NCBI HuRef 8 89,920,298 - 89,948,209 (+) NCBI HuRef CHM1_1 8 94,753,060 - 94,780,964 (+) NCBI CHM1_1 T2T-CHM13v2.0 8 94,825,618 - 94,856,535 (+) NCBI T2T-CHM13v2.0
Cibar1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 12,153,142 - 12,172,047 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 12,153,409 - 12,172,015 (-) Ensembl GRCm39 Ensembl GRCm38 4 12,153,142 - 12,172,023 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 12,153,409 - 12,172,015 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 12,080,869 - 12,099,162 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 12,080,871 - 12,099,144 (-) NCBI MGSCv36 mm8 Celera 4 11,963,141 - 11,981,484 (-) NCBI Celera Cytogenetic Map 4 A1 NCBI cM Map 4 5.58 NCBI
Cibar1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955417 10,059,844 - 10,079,192 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955417 10,060,500 - 10,080,119 (+) NCBI ChiLan1.0 ChiLan1.0
CIBAR1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 7 111,033,523 - 111,062,356 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 8 86,570,386 - 86,599,408 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 8 90,324,158 - 90,353,161 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 8 92,270,482 - 92,298,846 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 8 92,270,538 - 92,298,846 (+) Ensembl panpan1.1 panPan2
CIBAR1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 29 38,604,389 - 38,630,482 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 29 38,603,965 - 38,630,171 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 29 38,765,543 - 38,793,446 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 29 38,807,621 - 38,835,652 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 29 38,807,607 - 38,836,194 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 29 38,821,457 - 38,849,431 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 29 38,816,102 - 38,844,102 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 29 39,257,385 - 39,285,597 (+) NCBI UU_Cfam_GSD_1.0
Cibar1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405303 40,923,864 - 40,944,622 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936544 6,848,221 - 6,868,088 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936544 6,848,026 - 6,868,522 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CIBAR1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 4 42,957,712 - 42,985,459 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 4 42,957,848 - 42,985,482 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 4 46,381,548 - 46,407,873 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
CIBAR1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 8 88,670,290 - 88,700,834 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 8 88,670,298 - 88,699,883 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666039 52,144,662 - 52,178,844 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Cibar1
.
Predicted Target Of
Count of predictions: 24 Count of miRNA genes: 20 Interacting mature miRNAs: 23 Transcripts: ENSRNOT00000022249 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2293666 Bmd38 Bone mineral density QTL 38 4.4 femur size trait (VT:1000369) femoral neck cortical cross-sectional area (CMO:0001702) 5 8948228 53948228 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 70212 Niddm25 Non-insulin dependent diabetes mellitus QTL 25 3.54 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 5 1 131345958 Rat 1358353 Srcrtb2 Stress Responsive Cort Basal QTL 2 3.48 0.003 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 5 18873947 74251464 Rat 1300117 Hrtrt8 Heart rate QTL 8 3.49 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 5 3844018 47869213 Rat 7394712 Emca13 Estrogen-induced mammary cancer QTL 13 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 9823266 99753708 Rat 634305 Mamtr1 Mammary tumor resistance QTL 1 0.0001 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 12789751 113558310 Rat 1331771 Rf35 Renal function QTL 35 4.36965 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 5 729470 86724018 Rat 2312562 Pur18 Proteinuria QTL 18 2.6 0.001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 5 2138965 32656739 Rat 8662454 Vetf3 Vascular elastic tissue fragility QTL 3 27.4 artery integrity trait (VT:0010639) number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562) 5 2282226 69540447 Rat 61462 Niddm10 Non-insulin dependent diabetes mellitus QTL 10 3.9 0.001 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 5 5112159 47171491 Rat 1641903 Alcrsp3 Alcohol response QTL 3 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 5 12689285 57689285 Rat 1331756 Rf34 Renal function QTL 34 4.16275 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 5 1 90450412 Rat 8552954 Pigfal14 Plasma insulin-like growth factor 1 level QTL 14 9 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 21226744 66226744 Rat 1549901 Neudeg2 Neurodegradation QTL 2 4 0 nervous system integrity trait (VT:0010566) mononuclear cell count (CMO:0002119) 5 24838710 44045280 Rat 2313085 Bss59 Bone structure and strength QTL 59 2.9 0.0001 long bone metaphysis morphology trait (VT:0000133) tibia midshaft total cross-sectional area (CMO:0001715) 5 3844018 26141981 Rat 1600358 Mamtr5 Mammary tumor resistance QTL 5 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 18873947 63873947 Rat
RH139815
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 25,613,753 - 25,613,948 (+) MAPPER mRatBN7.2 Rnor_6.0 5 25,732,218 - 25,732,412 NCBI Rnor6.0 Rnor_5.0 5 30,436,105 - 30,436,299 UniSTS Rnor5.0 RGSC_v3.4 5 26,401,960 - 26,402,154 UniSTS RGSC3.4 Celera 5 24,943,322 - 24,943,516 UniSTS RH 3.4 Map 5 151.8 UniSTS Cytogenetic Map 5 q13 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000022249 ⟹ ENSRNOP00000022249
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 25,614,033 - 25,632,489 (-) Ensembl Rnor_6.0 Ensembl 5 25,732,644 - 25,750,826 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000115551 ⟹ ENSRNOP00000084687
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 25,614,033 - 25,632,489 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000117295 ⟹ ENSRNOP00000092728
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 25,615,154 - 25,632,489 (-) Ensembl
RefSeq Acc Id:
XM_002729463 ⟹ XP_002729509
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 30,423,484 - 30,429,759 (-) NCBI mRatBN7.2 5 25,613,993 - 25,632,419 (-) NCBI Rnor_6.0 5 25,732,457 - 25,750,949 (-) NCBI Rnor_5.0 5 30,436,344 - 30,454,797 (-) NCBI RGSC_v3.4 5 26,402,199 - 26,420,568 (-) RGD
Sequence:
TCACCTTTATTTTCACATTCCCCTTCCGGTTGCTGGTGGGTTGTTTTTCCTCCTTTGCTTCCAGCGGCCCCGAAGGGCTAGAGAGCTGCACTGAAGGAGGATGCTTGATGTTCCATCAGCCCAATGCC
hide sequence
RefSeq Acc Id:
XM_039110944 ⟹ XP_038966872
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 30,426,871 - 30,429,768 (-) NCBI mRatBN7.2 5 25,629,555 - 25,632,440 (-) NCBI
RefSeq Acc Id:
XM_063261262 ⟹ XP_063117332
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 30,411,325 - 30,429,757 (-) NCBI
RefSeq Acc Id:
XM_063261263 ⟹ XP_063117333
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 30,411,325 - 30,429,751 (-) NCBI
RefSeq Acc Id:
XM_063261264 ⟹ XP_063117334
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 30,425,550 - 30,429,770 (-) NCBI
RefSeq Acc Id:
XM_063261265 ⟹ XP_063117335
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 30,423,484 - 30,429,769 (-) NCBI
RefSeq Acc Id:
XM_063261266 ⟹ XP_063117336
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 30,423,693 - 30,429,769 (-) NCBI
RefSeq Acc Id:
XR_010051710
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 30,414,668 - 30,429,768 (-) NCBI
RefSeq Acc Id:
XP_002729509 ⟸ XM_002729463
- Peptide Label:
isoform X6
- Sequence:
MPSGLPCPSLDRRGARRVATETPDRSGGAPGALSAPGGSGGVSCSRAPWRPGAALVGLPSRVPGGAKGKMLRRNLDDRDAQTKQLQDAVTNVEKHFGELCQIFAAYVRKTARLRDKADLLVNEINLYA
hide sequence
Ensembl Acc Id:
ENSRNOP00000022249 ⟸ ENSRNOT00000022249
RefSeq Acc Id:
XP_038966872 ⟸ XM_039110944
- Peptide Label:
isoform X7
Ensembl Acc Id:
ENSRNOP00000092728 ⟸ ENSRNOT00000117295
Ensembl Acc Id:
ENSRNOP00000084687 ⟸ ENSRNOT00000115551
RefSeq Acc Id:
XP_063117332 ⟸ XM_063261262
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I5ZZV0 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063117333 ⟸ XM_063261263
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_063117335 ⟸ XM_063261265
- Peptide Label:
isoform X4
RefSeq Acc Id:
XP_063117336 ⟸ XM_063261266
- Peptide Label:
isoform X5
RefSeq Acc Id:
XP_063117334 ⟸ XM_063261264
- Peptide Label:
isoform X3
RGD ID: 13693576 Promoter ID: EPDNEW_R4096 Type: multiple initiation site Name: Fam92a_1 Description: family with sequence similarity 92 member A SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 5 25,750,737 - 25,750,797 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2020-01-09
Cibar1
CBY1 interacting BAR domain containing 1
Fam92a
family with sequence similarity 92 member A
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2016-11-02
Fam92a
family with sequence similarity 92 member A
Fam92a1
family with sequence similarity 92, member A1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-03-07
Fam92a1
family with sequence similarity 92, member A1
RGD1310681_predicted
similar to RIKEN cDNA 6720467C03 (predicted)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-01-20
RGD1310681_predicted
similar to RIKEN cDNA 6720467C03 (predicted)
LOC297903_predicted
Symbol and Name status set to approved
1331353 APPROVED
2005-01-12
LOC297903_predicted
similar to RIKEN cDNA 6720467C03 (predicted)
Symbol and Name status set to provisional
70820 PROVISIONAL
