Advanced Search (OLGA)

Gene: Cavin4 (caveolae associated protein 4) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Cavin4

Name:

caveolae associated protein 4

RGD ID:

1310395

Description:

Predicted to be involved in regulation of gene expression. Predicted to act upstream of or within positive regulation of transcription by RNA polymerase II. Located in caveola. Orthologous to human CAVIN4 (caveolae associated protein 4); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; alpha-Zearalanol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

caveolae-associated protein 4; LOC313225; Murc; muscle-related coiled-coil protein; muscle-restricted coiled-coil protein; RGD1310395; similar to RIKEN cDNA 2310039E09

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CAVIN4 (caveolae associated protein 4)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Cavin4 (caveolae associated 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Cavin4 (caveolae associated protein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CAVIN4 (caveolae associated protein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CAVIN4 (caveolae associated protein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Cavin4 (caveolae associated protein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CAVIN4 (caveolae associated protein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CAVIN4 (caveolae associated protein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Cavin4 (caveolae associated protein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Cavin4 (caveolae associated 4)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	CAVIN4 (caveolae associated protein 4)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	cavin4a	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	cavin4b	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	cavin4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	67,792,171 - 67,893,094 (+)	NCBI		GRCr8
mRatBN7.2	5	62,996,906 - 63,007,677 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	62,996,865 - 63,007,678 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	64,974,561 - 64,982,412 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	66,793,881 - 66,801,733 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	66,763,332 - 66,771,181 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	64,413,005 - 64,420,849 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	64,412,895 - 64,423,725 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	68,926,895 - 68,934,739 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	65,357,777 - 65,365,621 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	65,362,889 - 65,370,734 (+)	NCBI
Celera	5	64,592,108 - 64,599,951 (-)	NCBI		Celera
Cytogenetic Map	5	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cavin4	Rat	intellectual disability		ISO	CAVIN4 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Intellectual disability	ClinVar

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cavin4	Rat	(-)-epigallocatechin 3-gallate	multiple interactions	ISO	CAVIN4 (Homo sapiens)	6480464	[potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of CAVIN4 mRNA	CTD	PMID:22079256
Cavin4	Rat	1,2-dichloroethane	decreases expression	ISO	Cavin4 (Mus musculus)	6480464	ethylene dichloride results in decreased expression of CAVIN4 mRNA	CTD	PMID:28960355
Cavin4	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	EXP		6480464	Tetrachlorodibenzodioxin affects the expression of CAVIN4 mRNA	CTD	PMID:32109520
Cavin4	Rat	2,3,7,8-Tetrachlorodibenzofuran	decreases expression	EXP		6480464	2 more ...	CTD	PMID:32109520
Cavin4	Rat	3,3',5,5'-tetrabromobisphenol A	decreases expression	ISO	Cavin4 (Mus musculus)	6480464	tetrabromobisphenol A results in decreased expression of CAVIN4 mRNA	CTD	PMID:25172293
Cavin4	Rat	all-trans-retinoic acid	decreases expression	ISO	CAVIN4 (Homo sapiens)	6480464	Tretinoin results in decreased expression of CAVIN4 mRNA	CTD	PMID:21934132
Cavin4	Rat	alpha-Zearalanol	multiple interactions	EXP		6480464	[Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of CAVIN4 mRNA	CTD	PMID:35163327
Cavin4	Rat	alpha-Zearalanol	decreases expression	EXP		6480464	Zeranol results in decreased expression of CAVIN4 mRNA	CTD	PMID:35163327
Cavin4	Rat	arsenite(3-)	multiple interactions	ISO	CAVIN4 (Homo sapiens)	6480464	arsenite inhibits the reaction [G3BP1 protein binds to CAVIN4 mRNA]	CTD	PMID:32406909
Cavin4	Rat	atrazine	decreases expression	EXP		6480464	Atrazine results in decreased expression of CAVIN4 mRNA	CTD	PMID:36841081
Cavin4	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of CAVIN4 mRNA	CTD	PMID:25181051 and PMID:27178563
Cavin4	Rat	bisphenol A	affects expression	EXP		6480464	bisphenol A affects the expression of MURC mRNA	CTD	PMID:32145629
Cavin4	Rat	bisphenol A	decreases expression	ISO	CAVIN4 (Homo sapiens)	6480464	bisphenol A results in decreased expression of CAVIN4 mRNA	CTD	PMID:29275510
Cavin4	Rat	chlorpyrifos	decreases expression	EXP		6480464	Chlorpyrifos results in decreased expression of CAVIN4 mRNA	CTD	PMID:18668222
Cavin4	Rat	daunorubicin	decreases expression	ISO	CAVIN4 (Homo sapiens)	6480464	Daunorubicin results in decreased expression of CAVIN4 mRNA	CTD	PMID:26537877 and PMID:28940058
Cavin4	Rat	DDE	decreases expression	ISO	CAVIN4 (Homo sapiens)	6480464	Dichlorodiphenyl Dichloroethylene results in decreased expression of CAVIN4 mRNA	CTD	PMID:38568856
Cavin4	Rat	doxorubicin	decreases expression	ISO	CAVIN4 (Homo sapiens)	6480464	Doxorubicin results in decreased expression of CAVIN4 mRNA	CTD	PMID:26537877 more ...
Cavin4	Rat	furan	increases methylation	EXP		6480464	furan results in increased methylation of CAVIN4 gene	CTD	PMID:22079235
Cavin4	Rat	mitoxantrone	decreases expression	ISO	CAVIN4 (Homo sapiens)	6480464	Mitoxantrone results in decreased expression of CAVIN4 mRNA	CTD	PMID:26537877 and PMID:28940058
Cavin4	Rat	perfluorooctanoic acid	multiple interactions	EXP		6480464	[Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of CAVIN4 mRNA	CTD	PMID:35163327
Cavin4	Rat	perfluorooctanoic acid	increases expression	EXP		6480464	perfluorooctanoic acid results in increased expression of CAVIN4 mRNA	CTD	PMID:35163327
Cavin4	Rat	potassium chloride	multiple interactions	ISO	CAVIN4 (Homo sapiens)	6480464	[Dronabinol results in decreased susceptibility to Potassium Chloride] which results in increased expression of MURC mRNA	CTD	PMID:29691375
Cavin4	Rat	potassium chromate	increases expression	ISO	CAVIN4 (Homo sapiens)	6480464	potassium chromate(VI) results in increased expression of CAVIN4 mRNA	CTD	PMID:22079256
Cavin4	Rat	potassium chromate	multiple interactions	ISO	CAVIN4 (Homo sapiens)	6480464	[potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of CAVIN4 mRNA	CTD	PMID:22079256
Cavin4	Rat	sunitinib	decreases expression	ISO	CAVIN4 (Homo sapiens)	6480464	Sunitinib results in decreased expression of CAVIN4 mRNA	CTD	PMID:31533062
Cavin4	Rat	triclosan	decreases expression	ISO	CAVIN4 (Homo sapiens)	6480464	Triclosan results in decreased expression of CAVIN4 mRNA	CTD	PMID:28940058
Cavin4	Rat	tris(2-butoxyethyl) phosphate	affects expression	ISO	CAVIN4 (Homo sapiens)	6480464	tris(2-butoxyethyl) phosphate affects the expression of CAVIN4 mRNA	CTD	PMID:29024780

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cavin4	Rat	cell differentiation	involved_in	IEA	UniProtKB-KW:KW-0221	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Cavin4	Rat	muscle organ development	involved_in	IEA	UniProtKB-KW:KW-0517	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Cavin4	Rat	positive regulation of transcription by RNA polymerase II	acts_upstream_of_or_within	ISO	Cavin4 (Mus musculus)	1624291	PMID:18332105	RGD	PMID:18332105
Cavin4	Rat	positive regulation of transcription by RNA polymerase II	acts_upstream_of_or_within	IEA	UniProtKB:A2AMM0 and ensembl:ENSMUSP00000030033	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cavin4	Rat	regulation of gene expression	involved_in	ISO	CAVIN4 (Homo sapiens)	1624291	PMID:21642240	RGD	PMID:21642240
Cavin4	Rat	regulation of gene expression	involved_in	IEA	UniProtKB:Q5BKX8 and ensembl:ENSP00000418668	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cavin4	Rat	regulation of gene expression	involved_in	IBA	MGI:1915266 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cavin4	Rat	caveola	located_in	ISO	CAVIN4 (Homo sapiens)	1624291	PMID:19525939	RGD	PMID:19525939
Cavin4	Rat	caveola	located_in	IEA	UniProtKB-SubCell:SL-0035	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Cavin4	Rat	caveola	located_in	IEA	UniProtKB:Q5BKX8 and ensembl:ENSP00000418668	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cavin4	Rat	caveola	is_active_in	IBA	MGI:1277968 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Cavin4	Rat	caveola	located_in	IEA	UniProtKB:A2AMM0 and ensembl:ENSMUSP00000030033	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cavin4	Rat	caveola	located_in	ISO	Cavin4 (Mus musculus)	1624291	PMID:24567387	RGD	PMID:24567387
Cavin4	Rat	caveola	located_in	IDA		12907554	PMID:24567387	UniProt
Cavin4	Rat	cytoplasm	located_in	IEA	UniProtKB-SubCell:SL-0086	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Cavin4	Rat	cytoplasm	located_in	IEA	UniProtKB-KW:KW-0963	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Cavin4	Rat	cytoplasm	is_active_in	IBA	MGI:1277968 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Cavin4	Rat	cytosol	located_in	IEA	UniProtKB-SubCell:SL-0091	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Cavin4	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Cavin4	Rat	plasma membrane	located_in	ISS	UniProtKB:A2AMM0	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Cavin4	Rat	plasma membrane	located_in	IEA	UniProtKB:Q5BKX8 and ensembl:ENSP00000418668	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cavin4	Rat	plasma membrane	located_in	IEA	UniProtKB-KW:KW-1003	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Cavin4	Rat	plasma membrane	located_in	IEA	UniProtKB:A2AMM0 and ensembl:ENSMUSP00000030033	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cavin4	Rat	plasma membrane	located_in	IEA	UniProtKB-SubCell:SL-0039	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Cavin4	Rat	plasma membrane	located_in	ISO	Cavin4 (Mus musculus)	1624291	PMID:24567387 and PMID:26497963	RGD	PMID:24567387 and PMID:26497963
Cavin4	Rat	plasma membrane	located_in	IDA		12907554	PMID:24567387	UniProt
Cavin4	Rat	plasma membrane	located_in	ISO	CAVIN4 (Homo sapiens)	1624291	PMID:26497963	RGD	PMID:26497963
Cavin4	Rat	sarcolemma	located_in	IEA	UniProtKB-SubCell:SL-0238	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Cavin4	Rat	sarcomere	located_in	IEA	UniProtKB-SubCell:SL-0313	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Cavin4	Rat	sarcoplasm	located_in	IEA	UniProtKB:A2AMM0 and ensembl:ENSMUSP00000030033	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cavin4	Rat	sarcoplasm	located_in	ISO	Cavin4 (Mus musculus)	1624291	PMID:18332105	RGD	PMID:18332105
Cavin4	Rat	Z disc	located_in	ISO	Cavin4 (Mus musculus)	1624291	PMID:18332105	RGD	PMID:18332105
Cavin4	Rat	Z disc	located_in	IEA	UniProtKB:A2AMM0 and ensembl:ENSMUSP00000030033	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cavin4	Rat	protein binding	enables	IPI	UniProtKB:P21708 and UniProtKB:P63086	12907554	PMID:24567387	UniProt
Cavin4	Rat	protein binding	enables	ISO	CAVIN4 (Homo sapiens)	1624291	UniProtKB:O95810 more ...	RGD	PMID:24567387 more ...

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	MURC/Cavin-4 facilitates recruitment of ERK to caveolae and concentric cardiac hypertrophy induced by a1-adrenergic receptors.	Ogata T, etal., Proc Natl Acad Sci U S A. 2014 Mar 11;111(10):3811-6. doi: 10.1073/pnas.1315359111. Epub 2014 Feb 24.
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:18332105	PMID:19525939	PMID:21642240	PMID:26497963	PMID:30951783	PMID:31505169

Cavin4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	67,792,171 - 67,893,094 (+)	NCBI		GRCr8
mRatBN7.2	5	62,996,906 - 63,007,677 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	62,996,865 - 63,007,678 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	64,974,561 - 64,982,412 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	66,793,881 - 66,801,733 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	66,763,332 - 66,771,181 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	64,413,005 - 64,420,849 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	64,412,895 - 64,423,725 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	68,926,895 - 68,934,739 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	65,357,777 - 65,365,621 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	65,362,889 - 65,370,734 (+)	NCBI
Celera	5	64,592,108 - 64,599,951 (-)	NCBI		Celera
Cytogenetic Map	5	q22	NCBI

CAVIN4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	100,576,867 - 100,588,389 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	9	100,578,079 - 100,588,389 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	9	103,340,361 - 103,350,671 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	102,380,157 - 102,390,001 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	9	73,853,560 - 73,863,400 (+)	NCBI		Celera
Cytogenetic Map	9	q31.1	NCBI
HuRef	9	72,939,042 - 72,949,352 (+)	NCBI		HuRef
CHM1_1	9	103,486,816 - 103,497,108 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	9	112,748,569 - 112,760,082 (+)	NCBI		T2T-CHM13v2.0

Cavin4
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	48,663,514 - 48,673,492 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	48,663,514 - 48,673,502 (+)	Ensembl		GRCm39 Ensembl
GRCm38	4	48,663,514 - 48,673,492 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	48,663,514 - 48,673,502 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	48,676,386 - 48,686,364 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	48,684,657 - 48,694,593 (+)	NCBI		MGSCv36	mm8
Celera	4	48,687,179 - 48,697,159 (+)	NCBI		Celera
Cytogenetic Map	4	B1	NCBI
cM Map	4	26.23	NCBI

Cavin4
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955419	25,181,438 - 25,188,632 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955419	25,181,395 - 25,188,951 (-)	NCBI	ChiLan1.0	ChiLan1.0

CAVIN4
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	11	38,772,797 - 38,783,514 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	9	38,775,169 - 38,785,886 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	9	71,788,601 - 71,799,310 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	9	99,785,397 - 99,796,121 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	9	99,785,397 - 99,796,114 (+)	Ensembl	panpan1.1		panPan2

CAVIN4
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	11	57,452,229 - 57,462,933 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	11	57,452,347 - 57,460,463 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	11	55,895,496 - 55,906,219 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	11	58,579,567 - 58,590,283 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	11	58,580,742 - 58,590,219 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	11	57,077,571 - 57,088,014 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	11	57,103,190 - 57,113,636 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	11	57,802,519 - 57,812,964 (+)	NCBI		UU_Cfam_GSD_1.0

Cavin4
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	172,320,785 - 172,330,229 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936524	8,868,721 - 8,876,019 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936524	8,868,295 - 8,882,398 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CAVIN4
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	242,308,977 - 242,320,047 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	242,310,017 - 242,319,977 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	270,670,749 - 270,680,300 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CAVIN4
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	12	38,852,824 - 38,863,132 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	12	38,853,613 - 38,861,918 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666035	3,691,234 - 3,701,578 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cavin4
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624825	441,987 - 452,926 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Cavin4
47 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	18
Count of miRNA genes:	18
Interacting mature miRNAs:	18
Transcripts:	ENSRNOT00000010561
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578776	Stresp18	Stress response QTL 18	2.9		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	5	27955440	72955440	Rat
1298067	Scl15	Serum cholesterol level QTL 15	4.8	0.001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	33215665	78215665	Rat
1300115	Hrtrt7	Heart rate QTL 7	2.76		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	5	47869062	90099692	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	40128307	148607290	Rat
70212	Niddm25	Non-insulin dependent diabetes mellitus QTL 25	3.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	1	131345958	Rat
1358353	Srcrtb2	Stress Responsive Cort Basal QTL 2	3.48	0.003	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	18873947	74251464	Rat
634305	Mamtr1	Mammary tumor resistance QTL 1		0.0001	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	12789751	113558310	Rat
61386	Bp49	Blood pressure QTL 49	16.6		cerebrum integrity trait (VT:0010549)	brain infarction volume (CMO:0001013)	5	60293434	98603051	Rat
1331801	Rf33	Renal function QTL 33	4.149		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	43726656	129132602	Rat
1598807	Glom12	Glomerulus QTL 12	2.7		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	5	33215665	78215665	Rat
1302786	Kidm8	Kidney mass QTL 8	28.15		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	5	33215665	78215665	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	60293434	161481680	Rat
6903292	Stl28	Serum triglyceride level QTL 28	2.6	0.0073	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	5	28515489	73515489	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	46711509	161317411	Rat
1578767	Stresp17	Stress response QTL 17	4.3	0.01	blood aldosterone amount (VT:0005346)	plasma aldosterone level (CMO:0000551)	5	27955440	72955440	Rat
7411561	Bw134	Body weight QTL 134	24	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	49463600	94463600	Rat
1641922	Alcrsp8	Alcohol response QTL 8			alcohol metabolism trait (VT:0015089)	blood ethanol level (CMO:0000535)	5	35189153	68564008	Rat
2303615	Vencon7	Ventilatory control QTL 7		0.001	respiration trait (VT:0001943)	respiration rate (CMO:0000289)	5	50983895	95983895	Rat
1576312	Emca8	Estrogen-induced mammary cancer QTL 8	4.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	50328551	141643988	Rat
1641912	Alcrsp18	Alcohol response QTL 18			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	5	35189153	141643988	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
6903306	Scl35	Serum cholesterol QTL 35	2.6	0.0073	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	28515489	73515489	Rat
1576317	Eutr2	Estrogen induced uterine response QTL 2		0.01	uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	34730116	104251008	Rat
7394712	Emca13	Estrogen-induced mammary cancer QTL 13			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	9823266	99753708	Rat
1331773	Scl26	Serum cholesterol level QTL 26	3.065		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	43726656	86724018	Rat
70189	Mcs5	Mammary carcinoma susceptibility QTL 5	10.51		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	55805606	132207589	Rat
1331771	Rf35	Renal function QTL 35	4.36965		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	729470	86724018	Rat
61359	Eaex	Experimental allergic encephalomyelitis QTL x	3		nervous system integrity trait (VT:0010566)	post-insult time to onset of experimental autoimmune encephalomyelitis (CMO:0001422)	5	55715622	100715622	Rat
8662454	Vetf3	Vascular elastic tissue fragility QTL 3	27.4		artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	5	2282226	69540447	Rat
2290448	Scl54	Serum cholesterol level QTL 54	2.93		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	31663789	131345958	Rat
61426	Scl2	Serum cholesterol level QTL 2	7.3	0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	59793399	143070159	Rat
9589025	Epfw7	Epididymal fat weight QTL 7	20.66	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	5	49463600	94463600	Rat
2303574	Gluco42	Glucose level QTL 42	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	53496719	98496719	Rat
1331756	Rf34	Renal function QTL 34	4.16275		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	1	90450412	Rat
8552954	Pigfal14	Plasma insulin-like growth factor 1 level QTL 14	9		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	21226744	66226744	Rat
2316954	Rf57	Renal function QTL 57	0		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	5	59793528	90450144	Rat
1358895	Bp254	Blood pressure QTL 254	3.6	0.0003	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	5	58829236	128034027	Rat
2316959	Gluco59	Glucose level QTL 59	4.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	34944474	113558310	Rat
1600358	Mamtr5	Mammary tumor resistance QTL 5			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	18873947	63873947	Rat
2316957	Pur21	Proteinuria QTL 21	6.2		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	5	59793528	113558156	Rat

RH144033

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	62,996,207 - 62,996,313 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	64,412,238 - 64,412,343	NCBI	Rnor6.0
Rnor_5.0	5	68,926,128 - 68,926,233	UniSTS	Rnor5.0
RGSC_v3.4	5	65,357,010 - 65,357,115	UniSTS	RGSC3.4
Celera	5	64,600,613 - 64,600,718	UniSTS
RH 3.4 Map	5	415.4	UniSTS
Cytogenetic Map	5	q22	UniSTS

RH138909

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	62,995,933 - 62,996,059 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	64,411,964 - 64,412,089	NCBI	Rnor6.0
Rnor_5.0	5	68,925,854 - 68,925,979	UniSTS	Rnor5.0
RGSC_v3.4	5	65,356,736 - 65,356,861	UniSTS	RGSC3.4
Celera	5	64,600,867 - 64,600,992	UniSTS
RH 3.4 Map	5	416.6	UniSTS
Cytogenetic Map	5	q22	UniSTS

BE118719

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	62,999,163 - 62,999,332 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	64,415,194 - 64,415,362	NCBI	Rnor6.0
Rnor_5.0	5	68,929,084 - 68,929,252	UniSTS	Rnor5.0
RGSC_v3.4	5	65,359,966 - 65,360,134	UniSTS	RGSC3.4
Celera	5	64,597,595 - 64,597,763	UniSTS
RH 3.4 Map	5	412.3	UniSTS
Cytogenetic Map	5	q22	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	111	61	62	31	20	31	6	184	91	92	45	59	31


RefSeq Transcripts	NM_001107931	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063287620	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063287621	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063287622	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063287623	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010066384	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010066385	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010066386	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010066387	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010066388	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010066389	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010066390	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010066391	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010066392	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010066393	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010066394	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010066395	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010066396	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH474056	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	EU487255	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215090	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000010561 ⟹ ENSRNOP00000010561

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	62,996,865 - 63,007,678 (+)	Ensembl
Rnor_6.0 Ensembl	5	64,412,895 - 64,423,725 (+)	Ensembl

RefSeq Acc Id:

NM_001107931 ⟹ NP_001101401

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	67,792,432 - 67,803,203 (+)	NCBI
mRatBN7.2	5	62,996,906 - 63,007,677 (+)	NCBI
Rnor_6.0	5	64,413,005 - 64,420,849 (+)	NCBI
Rnor_5.0	5	68,926,895 - 68,934,739 (+)	NCBI
RGSC_v3.4	5	65,357,777 - 65,365,621 (+)	RGD
Celera	5	64,592,108 - 64,599,951 (-)	RGD

Sequence:

show sequence

ATGGAACACAATGGATCTGCTTCAAATGCTGGTAAAATCCACCAGAACCGATTGTCAAGTGTGACTGAAGATGAAGACCAGGACGCAGCTCTCACAATTGTGACTGTGCTGGACAGGGTGGCCACCGT
CGTGGACAGCGTGCAGGCAAGCCAGAAGAGAATCGAGGAGAGACACAGAGAGATGGGGAACGCCATCAAGTCTGTCCAGATAGACCTGCTGAAGCTCTCACAATCACACAGCAACACGGGCTACGTTG
TTAACAAGCTGTTTGAGAAGACCCGGAAAGTCAGCGCTCACATTAAAGATGTGAAGGCCCGGGTAGAGAAGCAACAGGTTCGAGTAACCAAAGTCGAAACCAAGCAAGAAGAAATAATGAAGAAGAAC
AAGTTCCGCGTGGTAATCTTCCAGGAGGATGTTCCCTGCCCCGCATCCCTGTCTGTTGTTAAAGACAGAAGCCTGCCGGAGAACGAGGAGGAAGCTGAGGAAGTCTTCGATCCCCCGATCGATCTCTC
ATCGGATGAAGAATACTATGTTGAAGAAAGCAGATCTGCCAGGCTTAGAAAGTCAGGCAAAGAGCACATCGATCATATTAAGAAGGCATTTTCCAAAGAAAACATGCAGAAGACGCGGCAGAATTTTG
ATAAGAAAGTGAGTGGAATTAGAACCAGGATAGTTACACCTGAGAGAAGAGAGAGGCTGAGGCAGTCAGGAGAGAGGCTGAGGCAGTCGGGGGAGAGGCTGAGGCAGTCGGGGGAAAGATTTAAGAAA
TCGATCTCAAATGCCACCCCCTCCAAGGAAGCTTTTAAGATCCGGAGCCTTAGAAAACCGAAGGACCCCAAGGCAGAAGGCCAGGAGGTAGACAGGGGGATGGGGGTGGACATCATCTCAGGTAGCCT
GGCTCTGGGGCCCATCCATGAGTTCCACTCTGATGGGTTCAGTGAAACAGAAAAGGAGGTGACCAAAGTAGGGTACATTCCCCAAGAGGGAGGGGACCCCCCAACGCCTGAGCCTTTGAAGGTGACCT
TTAAACCTCAGGTGAGAGTAGAGGATGACGAGTCACTCCTGTTGGAATTAAAGCAGTCCTCATAG

hide sequence

RefSeq Acc Id:

XM_063287620 ⟹ XP_063143690

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	67,799,776 - 67,831,079 (+)	NCBI

RefSeq Acc Id:

XM_063287621 ⟹ XP_063143691

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	67,792,171 - 67,840,261 (+)	NCBI

RefSeq Acc Id:

XM_063287622 ⟹ XP_063143692

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	67,792,171 - 67,840,242 (+)	NCBI

RefSeq Acc Id:

XM_063287623 ⟹ XP_063143693

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	67,792,171 - 67,818,959 (+)	NCBI

RefSeq Acc Id:

XR_010066384

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	67,799,776 - 67,857,307 (+)	NCBI

RefSeq Acc Id:

XR_010066385

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	67,799,776 - 67,857,307 (+)	NCBI

RefSeq Acc Id:

XR_010066386

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	67,799,776 - 67,857,307 (+)	NCBI

RefSeq Acc Id:

XR_010066387

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	67,799,776 - 67,857,307 (+)	NCBI

RefSeq Acc Id:

XR_010066388

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	67,799,776 - 67,857,307 (+)	NCBI

RefSeq Acc Id:

XR_010066389

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	67,799,776 - 67,857,307 (+)	NCBI

RefSeq Acc Id:

XR_010066390

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	67,799,776 - 67,857,307 (+)	NCBI

RefSeq Acc Id:

XR_010066391

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	67,799,776 - 67,857,307 (+)	NCBI

RefSeq Acc Id:

XR_010066392

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	67,799,776 - 67,893,094 (+)	NCBI

RefSeq Acc Id:

XR_010066393

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	67,799,776 - 67,893,094 (+)	NCBI

RefSeq Acc Id:

XR_010066394

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	67,799,776 - 67,893,094 (+)	NCBI

RefSeq Acc Id:

XR_010066395

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	67,799,776 - 67,857,307 (+)	NCBI

RefSeq Acc Id:

XR_010066396

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	67,799,776 - 67,857,307 (+)	NCBI


Protein RefSeqs	NP_001101401	(Get FASTA)	NCBI Sequence Viewer
	XP_063143690	(Get FASTA)	NCBI Sequence Viewer
	XP_063143691	(Get FASTA)	NCBI Sequence Viewer
	XP_063143692	(Get FASTA)	NCBI Sequence Viewer
	XP_063143693	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	ACA62937	(Get FASTA)	NCBI Sequence Viewer
	B1PRL5	(Get FASTA)	NCBI Sequence Viewer
	EDL78187	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000010561
	ENSRNOP00000010561.2

RefSeq Acc Id:

NP_001101401 ⟸ NM_001107931

- UniProtKB:

B1PRL5 (UniProtKB/Swiss-Prot), A6KJE9 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MEHNGSASNAGKIHQNRLSSVTEDEDQDAALTIVTVLDRVATVVDSVQASQKRIEERHREMGNAIKSVQIDLLKLSQSHSNTGYVVNKLFEKTRKVSAHIKDVKARVEKQQVRVTKVETKQEEIMKKN
KFRVVIFQEDVPCPASLSVVKDRSLPENEEEAEEVFDPPIDLSSDEEYYVEESRSARLRKSGKEHIDHIKKAFSKENMQKTRQNFDKKVSGIRTRIVTPERRERLRQSGERLRQSGERLRQSGERFKK
SISNATPSKEAFKIRSLRKPKDPKAEGQEVDRGMGVDIISGSLALGPIHEFHSDGFSETEKEVTKVGYIPQEGGDPPTPEPLKVTFKPQVRVEDDESLLLELKQSS

hide sequence

Ensembl Acc Id:

ENSRNOP00000010561 ⟸ ENSRNOT00000010561

RefSeq Acc Id:	XP_063143691 ⟸ XM_063287621
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_063143692 ⟸ XM_063287622
- Peptide Label:	isoform X3

RefSeq Acc Id:	XP_063143693 ⟸ XM_063287623
- Peptide Label:	isoform X4

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B1PRL5-F1-model_v2	AlphaFold	B1PRL5	1-362	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13693726

Promoter ID:

EPDNEW_R4250

Type:

initiation region

Name:

Cavin4_1

Description:

caveolae associated protein 4

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	5	64,412,895 - 64,412,955	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-41348	BioCyc
Ensembl Genes	ENSRNOG00000008027	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000010561	ENTREZGENE
	ENSRNOT00000010561.5	UniProtKB/Swiss-Prot
InterPro	Cavin_fam	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:313225	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
NCBI Gene	313225	ENTREZGENE
PANTHER	CAVEOLAE-ASSOCIATED PROTEIN 4	UniProtKB/TrEMBL
	CAVIN	UniProtKB/TrEMBL, UniProtKB/Swiss-Prot
	PTHR15240:SF4	UniProtKB/Swiss-Prot
Pfam	PTRF_SDPR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Cavin4	PhenoGen
RatGTEx	ENSRNOG00000008027	RatGTEx
UniProt	A6KJE9	ENTREZGENE, UniProtKB/TrEMBL
	B1PRL5	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-03-29	Cavin4	caveolae associated protein 4	Murc	muscle-related coiled-coil protein	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2010-05-05	Murc	muscle-related coiled-coil protein	Murc	muscle-restricted coiled-coil protein	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-31	Murc	muscle-restricted coiled-coil protein	RGD1310395_predicted	similar to RIKEN cDNA 2310039E09 (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	RGD1310395_predicted	similar to RIKEN cDNA 2310039E09 (predicted)	LOC313225_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC313225_predicted	similar to RIKEN cDNA 2310039E09 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar