Symbol:
Zbtb38
Name:
zinc finger and BTB domain containing 38
RGD ID:
1310136
Description:
Enables DNA-binding transcription factor activity. Involved in positive regulation of transcription by RNA polymerase II. Located in nucleus. Orthologous to human ZBTB38 (zinc finger and BTB domain containing 38); PARTICIPATES IN DNA modification pathway; INTERACTS WITH (+)-schisandrin B; 17alpha-ethynylestradiol; 17beta-estradiol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC315936; RGD1310136; similar to kaiso protein; zenon; zinc finger and BTB domain-containing protein 38; zinc finger protein expressed in neurons; zinc finger transcription factor Kaiso
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 106,124,181 - 106,231,215 (-) NCBI GRCr8 mRatBN7.2 8 97,284,617 - 97,288,518 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 97,280,993 - 97,485,625 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 102,950,345 - 102,954,245 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 101,149,591 - 101,153,491 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 98,988,547 - 98,992,447 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 104,566,999 - 104,694,890 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 104,589,621 - 104,593,625 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 104,013,746 - 104,141,365 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 101,782,699 - 101,786,600 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 101,802,153 - 101,806,055 (-) NCBI Celera 8 96,727,009 - 96,730,910 (-) NCBI Celera Cytogenetic Map 8 q31 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Zbtb38 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of ZBTB38 mRNA] CTD PMID:31150632 Zbtb38 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO ZBTB38 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of ZBTB38 mRNA CTD PMID:22079256 Zbtb38 Rat 1,2-dichloroethane decreases expression ISO Zbtb38 (Mus musculus) 6480464 ethylene dichloride results in decreased expression of ZBTB38 mRNA CTD PMID:28960355 Zbtb38 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of ZBTB38 mRNA CTD PMID:29097150 Zbtb38 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of ZBTB38 mRNA CTD PMID:32145629 Zbtb38 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Zbtb38 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of ZBTB38 mRNA CTD PMID:24058054 Zbtb38 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO ZBTB38 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of ZBTB38 mRNA CTD PMID:11489354 more ... Zbtb38 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Zbtb38 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of ZBTB38 mRNA CTD PMID:24680724 Zbtb38 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO ZBTB38 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of ZBTB38 mRNA CTD PMID:22298810 Zbtb38 Rat 2-palmitoylglycerol increases expression ISO ZBTB38 (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of ZBTB38 mRNA CTD PMID:37199045 Zbtb38 Rat 4,4'-sulfonyldiphenol decreases expression ISO Zbtb38 (Mus musculus) 6480464 bisphenol S results in decreased expression of ZBTB38 mRNA CTD PMID:39298647 Zbtb38 Rat 4,4'-sulfonyldiphenol affects methylation ISO Zbtb38 (Mus musculus) 6480464 bisphenol S affects the methylation of ZBTB38 gene CTD PMID:31683443 Zbtb38 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of ZBTB38 mRNA CTD PMID:31881176 Zbtb38 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of ZBTB38 mRNA CTD PMID:28959563 Zbtb38 Rat acrylamide decreases expression ISO Zbtb38 (Mus musculus) 6480464 Acrylamide results in decreased expression of ZBTB38 mRNA CTD PMID:30807115 Zbtb38 Rat aflatoxin B1 decreases methylation ISO ZBTB38 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of ZBTB38 gene CTD PMID:27153756 Zbtb38 Rat amphetamine decreases expression EXP 6480464 Amphetamine results in decreased expression of ZBTB38 mRNA CTD PMID:30779732 Zbtb38 Rat arsane multiple interactions ISO ZBTB38 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of ZBTB38 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of ZBTB38 mRNA CTD PMID:39836092 Zbtb38 Rat arsenic atom multiple interactions ISO ZBTB38 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of ZBTB38 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of ZBTB38 mRNA CTD PMID:39836092 Zbtb38 Rat arsenite(3-) multiple interactions ISO ZBTB38 (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to ZBTB38 mRNA] CTD PMID:32406909 Zbtb38 Rat belinostat decreases expression ISO ZBTB38 (Homo sapiens) 6480464 belinostat results in decreased expression of ZBTB38 mRNA CTD PMID:27188386 Zbtb38 Rat benzo[a]pyrene increases mutagenesis ISO ZBTB38 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased mutagenesis of ZBTB38 gene CTD PMID:25435355 Zbtb38 Rat benzo[a]pyrene decreases methylation ISO ZBTB38 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of ZBTB38 promoter CTD PMID:27901495 Zbtb38 Rat benzo[a]pyrene affects methylation ISO ZBTB38 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of ZBTB38 5' UTR CTD PMID:27901495 Zbtb38 Rat benzo[a]pyrene increases methylation ISO Zbtb38 (Mus musculus) 6480464 Benzo(a)pyrene results in increased methylation of ZBTB38 3' UTR and Benzo(a)pyrene results in increased methylation of ZBTB38 exon CTD PMID:27901495 Zbtb38 Rat benzo[a]pyrene increases expression ISO ZBTB38 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of ZBTB38 mRNA CTD PMID:20106945 more ... Zbtb38 Rat benzo[a]pyrene diol epoxide I decreases expression ISO ZBTB38 (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 and PMID:20018196 Zbtb38 Rat benzo[a]pyrene diol epoxide I increases expression ISO ZBTB38 (Homo sapiens) 6480464 7 more ... CTD PMID:26238291 Zbtb38 Rat benzo[e]pyrene decreases methylation ISO ZBTB38 (Homo sapiens) 6480464 benzo(e)pyrene results in decreased methylation of ZBTB38 exon CTD PMID:30157460 Zbtb38 Rat beta-lapachone decreases expression ISO ZBTB38 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of ZBTB38 mRNA CTD PMID:38218311 Zbtb38 Rat bisphenol A affects methylation ISO Zbtb38 (Mus musculus) 6480464 bisphenol A affects the methylation of ZBTB38 promoter CTD PMID:27334623 Zbtb38 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of ZBTB38 mRNA CTD PMID:32145629 Zbtb38 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of ZBTB38 mRNA CTD PMID:32145629 Zbtb38 Rat bisphenol F increases expression ISO Zbtb38 (Mus musculus) 6480464 bisphenol F results in increased expression of ZBTB38 mRNA CTD PMID:30951980 and PMID:38685157 Zbtb38 Rat butanal decreases expression ISO ZBTB38 (Homo sapiens) 6480464 butyraldehyde results in decreased expression of ZBTB38 mRNA CTD PMID:26079696 Zbtb38 Rat C60 fullerene decreases expression EXP 6480464 fullerene C60 results in decreased expression of ZBTB38 mRNA CTD PMID:19167457 Zbtb38 Rat cadmium dichloride increases expression ISO ZBTB38 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of ZBTB38 mRNA CTD PMID:26314618 Zbtb38 Rat caffeine decreases phosphorylation ISO ZBTB38 (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of ZBTB38 protein CTD PMID:35688186 Zbtb38 Rat calcitriol increases expression ISO ZBTB38 (Homo sapiens) 6480464 Calcitriol results in increased expression of ZBTB38 mRNA CTD PMID:16002434 Zbtb38 Rat CGP 52608 multiple interactions ISO ZBTB38 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to ZBTB38 gene] CTD PMID:28238834 Zbtb38 Rat chlorpyrifos decreases expression ISO Zbtb38 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of ZBTB38 mRNA CTD PMID:37019170 Zbtb38 Rat cobalt dichloride decreases expression ISO ZBTB38 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of ZBTB38 mRNA CTD PMID:19376846 Zbtb38 Rat copper(II) sulfate increases expression ISO ZBTB38 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of ZBTB38 mRNA CTD PMID:19549813 Zbtb38 Rat coumestrol decreases expression ISO ZBTB38 (Homo sapiens) 6480464 Coumestrol results in decreased expression of ZBTB38 mRNA CTD PMID:19167446 Zbtb38 Rat crocidolite asbestos affects expression ISO ZBTB38 (Homo sapiens) 6480464 Asbestos and Crocidolite affects the expression of ZBTB38 mRNA CTD PMID:17331233 Zbtb38 Rat DDE decreases expression ISO ZBTB38 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of ZBTB38 mRNA CTD PMID:38568856 Zbtb38 Rat Dibutyl phosphate affects expression ISO ZBTB38 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of ZBTB38 mRNA CTD PMID:37042841 Zbtb38 Rat doxorubicin decreases expression ISO ZBTB38 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of ZBTB38 mRNA CTD PMID:29803840 Zbtb38 Rat folic acid decreases expression ISO Zbtb38 (Mus musculus) 6480464 Folic Acid results in decreased expression of ZBTB38 mRNA CTD PMID:25629700 Zbtb38 Rat FR900359 increases phosphorylation ISO ZBTB38 (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of ZBTB38 protein CTD PMID:37730182 Zbtb38 Rat furan increases methylation EXP 6480464 furan results in increased methylation of ZBTB38 gene CTD PMID:22079235 Zbtb38 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of ZBTB38 mRNA CTD PMID:33387578 Zbtb38 Rat hydrogen cyanide increases expression ISO Zbtb38 (Mus musculus) 6480464 Hydrogen Cyanide results in increased expression of ZBTB38 mRNA CTD PMID:33914522 Zbtb38 Rat iron dichloride decreases expression ISO ZBTB38 (Homo sapiens) 6480464 ferrous chloride results in decreased expression of ZBTB38 mRNA CTD PMID:35984750 Zbtb38 Rat leflunomide increases expression ISO ZBTB38 (Homo sapiens) 6480464 leflunomide results in increased expression of ZBTB38 mRNA CTD PMID:28988120 Zbtb38 Rat manganese atom multiple interactions ISO ZBTB38 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of ZBTB38 mRNA CTD PMID:39836092 Zbtb38 Rat manganese(0) multiple interactions ISO ZBTB38 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of ZBTB38 mRNA CTD PMID:39836092 Zbtb38 Rat manganese(II) chloride increases expression EXP 6480464 manganese chloride results in increased expression of ZBTB38 mRNA CTD PMID:28801915 Zbtb38 Rat manganese(II) chloride multiple interactions ISO ZBTB38 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of ZBTB38 mRNA CTD PMID:39836092 Zbtb38 Rat mercury atom increases expression ISO ZBTB38 (Homo sapiens) 6480464 Mercury results in increased expression of ZBTB38 mRNA CTD PMID:19937285 Zbtb38 Rat mercury(0) increases expression ISO ZBTB38 (Homo sapiens) 6480464 Mercury results in increased expression of ZBTB38 mRNA CTD PMID:19937285 Zbtb38 Rat methapyrilene decreases methylation ISO ZBTB38 (Homo sapiens) 6480464 Methapyrilene results in decreased methylation of ZBTB38 exon CTD PMID:30157460 Zbtb38 Rat methylmercury chloride decreases expression ISO ZBTB38 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of ZBTB38 mRNA CTD PMID:28001369 Zbtb38 Rat nickel atom decreases expression ISO ZBTB38 (Homo sapiens) 6480464 Nickel results in decreased expression of ZBTB38 mRNA CTD PMID:25583101 Zbtb38 Rat paracetamol decreases expression ISO ZBTB38 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of ZBTB38 mRNA CTD PMID:21420995 Zbtb38 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of ZBTB38 mRNA CTD PMID:33387578 Zbtb38 Rat paracetamol affects response to substance ISO ZBTB38 (Homo sapiens) 6480464 ZBTB38 gene polymorphism affects the susceptibility to Acetaminophen CTD PMID:26104854 Zbtb38 Rat perfluorooctanoic acid increases expression ISO ZBTB38 (Homo sapiens) 6480464 perfluorooctanoic acid results in increased expression of ZBTB38 mRNA CTD PMID:36326898 Zbtb38 Rat potassium chromate decreases expression ISO ZBTB38 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of ZBTB38 mRNA CTD PMID:22079256 Zbtb38 Rat potassium chromate multiple interactions ISO ZBTB38 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of ZBTB38 mRNA CTD PMID:22079256 Zbtb38 Rat potassium cyanide increases expression ISO Zbtb38 (Mus musculus) 6480464 Potassium Cyanide results in increased expression of ZBTB38 mRNA CTD PMID:33914522 Zbtb38 Rat quercetin increases expression ISO ZBTB38 (Homo sapiens) 6480464 Quercetin results in increased expression of ZBTB38 mRNA CTD PMID:21632981 Zbtb38 Rat quinolin-8-ol increases expression ISO ZBTB38 (Homo sapiens) 6480464 Oxyquinoline results in increased expression of ZBTB38 mRNA CTD PMID:21632981 Zbtb38 Rat sodium arsenite decreases expression ISO ZBTB38 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of ZBTB38 mRNA CTD PMID:28595984 more ... Zbtb38 Rat sodium arsenite multiple interactions ISO ZBTB38 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of ZBTB38 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of ZBTB38 mRNA CTD PMID:39836092 Zbtb38 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of ZBTB38 mRNA CTD PMID:31150632 Zbtb38 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of ZBTB38 mRNA] CTD PMID:31150632 Zbtb38 Rat tetraphene decreases expression ISO Zbtb38 (Mus musculus) 6480464 benz(a)anthracene results in decreased expression of ZBTB38 mRNA CTD PMID:26377693 Zbtb38 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of ZBTB38 mRNA CTD PMID:34492290 Zbtb38 Rat thiram decreases expression ISO ZBTB38 (Homo sapiens) 6480464 Thiram results in decreased expression of ZBTB38 mRNA CTD PMID:38568856 Zbtb38 Rat triphenyl phosphate affects expression ISO ZBTB38 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of ZBTB38 mRNA CTD PMID:37042841 Zbtb38 Rat tris(2-butoxyethyl) phosphate affects expression ISO ZBTB38 (Homo sapiens) 6480464 tris(2-butoxyethyl) phosphate affects the expression of ZBTB38 mRNA CTD PMID:29024780 Zbtb38 Rat urethane affects expression ISO ZBTB38 (Homo sapiens) 6480464 Urethane affects the expression of ZBTB38 mRNA CTD PMID:28818685 Zbtb38 Rat valproic acid increases expression ISO ZBTB38 (Homo sapiens) 6480464 Valproic Acid results in increased expression of ZBTB38 mRNA CTD PMID:23179753 Zbtb38 Rat vorinostat decreases expression ISO ZBTB38 (Homo sapiens) 6480464 vorinostat results in decreased expression of ZBTB38 mRNA CTD PMID:27188386
Zbtb38 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 106,124,181 - 106,231,215 (-) NCBI GRCr8 mRatBN7.2 8 97,284,617 - 97,288,518 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 97,280,993 - 97,485,625 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 102,950,345 - 102,954,245 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 101,149,591 - 101,153,491 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 98,988,547 - 98,992,447 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 104,566,999 - 104,694,890 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 104,589,621 - 104,593,625 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 104,013,746 - 104,141,365 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 101,782,699 - 101,786,600 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 101,802,153 - 101,806,055 (-) NCBI Celera 8 96,727,009 - 96,730,910 (-) NCBI Celera Cytogenetic Map 8 q31 NCBI
ZBTB38 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 141,324,186 - 141,449,792 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 141,324,213 - 141,449,792 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 141,043,028 - 141,168,634 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 142,525,745 - 142,651,324 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 3 139,466,550 - 139,592,174 (+) NCBI Celera Cytogenetic Map 3 q23 NCBI HuRef 3 138,418,028 - 138,543,648 (+) NCBI HuRef CHM1_1 3 141,005,858 - 141,131,749 (+) NCBI CHM1_1 T2T-CHM13v2.0 3 144,071,778 - 144,197,435 (+) NCBI T2T-CHM13v2.0
Zbtb38 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 9 96,564,820 - 96,613,728 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 9 96,564,823 - 96,634,884 (-) Ensembl GRCm39 Ensembl GRCm38 9 96,682,767 - 96,731,675 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 9 96,682,770 - 96,752,831 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 9 96,585,842 - 96,632,094 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 9 96,495,619 - 96,541,027 (-) NCBI MGSCv36 mm8 Celera 9 96,241,020 - 96,287,268 (-) NCBI Celera Cytogenetic Map 9 E3.3 NCBI cM Map 9 50.71 NCBI
Zbtb38 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955508 4,260,716 - 4,297,435 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955508 4,260,716 - 4,297,435 (-) NCBI ChiLan1.0 ChiLan1.0
ZBTB38 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 139,277,994 - 139,358,799 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 139,282,692 - 139,363,532 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 138,401,279 - 138,481,969 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 145,954,568 - 146,079,500 (+) NCBI panpan1.1 PanPan1.1 panPan2
ZBTB38 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 23 37,283,794 - 37,344,316 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 23 37,297,101 - 37,341,506 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 23 37,204,078 - 37,337,108 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 23 37,741,900 - 37,874,509 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 23 37,795,756 - 37,874,493 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 23 37,425,079 - 37,557,988 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 23 37,502,716 - 37,635,250 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 23 37,744,769 - 37,878,042 (+) NCBI UU_Cfam_GSD_1.0
Zbtb38 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 76,467,370 - 76,523,590 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936540 3,198,254 - 3,262,475 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936540 3,207,044 - 3,263,373 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ZBTB38 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 82,064,565 - 82,195,319 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 82,053,887 - 82,195,321 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 89,895,533 - 90,036,843 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ZBTB38 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 15 49,160,877 - 49,203,378 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 15 49,160,896 - 49,164,486 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666041 22,065,957 - 22,224,470 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Zbtb38
.
Predicted Target Of
Count of predictions: 233 Count of miRNA genes: 173 Interacting mature miRNAs: 191 Transcripts: ENSRNOT00000016625 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
12879878 Bw183 Body weight QTL 183 0.001 body mass (VT:0001259) body weight (CMO:0000012) 8 43296169 98968765 Rat 1300177 Cm2 Cardiac mass QTL 2 3.65 heart mass (VT:0007028) heart weight (CMO:0000017) 8 54259986 100382532 Rat 1549909 Stresp11 Stress response QTL 11 6.83 0.0019 stress-related behavior trait (VT:0010451) number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960) 8 73473045 118473045 Rat 12879879 Cm99 Cardiac mass QTL 99 0.001 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 43296169 98968765 Rat 1554321 Bmd3 Bone mineral density QTL 3 7.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 40952565 123900184 Rat 9590292 Uminl3 Urine mineral level QTL 3 3.62 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 8 71888757 116888757 Rat 1578769 Uae31 Urinary albumin excretion QTL 31 3.3 0.001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 30848154 101699754 Rat 12879880 Cm100 Cardiac mass QTL 100 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 8 43296169 98968765 Rat 12879881 Cm101 Cardiac mass QTL 101 0.001 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 8 43296169 98968765 Rat 12879882 Am8 Aortic mass QTL 8 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 8 43296169 98968765 Rat 12879883 Kidm65 Kidney mass QTL 65 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 8 43296169 98968765 Rat 738011 Anxrr9 Anxiety related response QTL 9 6.1 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 8 93535351 123900184 Rat 8693654 Alc32 Alcohol consumption QTL 32 2 0.755 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 8 88612425 107550209 Rat 1358912 Bw51 Body weight QTL 51 2.95 body mass (VT:0001259) body weight (CMO:0000012) 8 51351728 107062046 Rat 1578765 Klgr1 Kidney lesion grade QTL 1 3.3 0.0001 kidney morphology trait (VT:0002135) organ lesion measurement (CMO:0000677) 8 30848154 101699754 Rat 738014 Anxrr15 Anxiety related response QTL 15 3.6 0.005 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 8 95718998 123900184 Rat 1300171 Bp184 Blood pressure QTL 184 3.66 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 8 70513503 118219066 Rat 1578755 Pur5 Proteinuria QTL 5 3.3 0.0001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 8 30848154 101699754 Rat 2313400 Anxrr25 Anxiety related response QTL 25 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 8 89265192 114019816 Rat 2303171 Bp331 Blood pressure QTL 331 5.57 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 61290298 119084929 Rat 8662823 Vetf5 Vascular elastic tissue fragility QTL 5 1.9 artery integrity trait (VT:0010639) patent ductus arteriosus score (CMO:0002566) 8 28242912 99525068 Rat 2293697 Bmd39 Bone mineral density QTL 39 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 8 54043744 98968765 Rat 631210 Bw3 Body weight QTL3 5.9 mesenteric fat pad mass (VT:0010427) mesenteric fat pad weight to body weight ratio (CMO:0000654) 8 69349194 112783834 Rat 1358903 Bp252 Blood pressure QTL 252 7 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 93965141 123900184 Rat 1358896 Bp262 Blood pressure QTL 262 2.89 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 27205715 99103503 Rat 1331837 Bw23 Body weight QTL 23 4.19 0.00007 body mass (VT:0001259) body weight (CMO:0000012) 8 46531722 99083736 Rat 1331838 Niddm61 Non-insulin dependent diabetes mellitus QTL 61 3.53 0.0004 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 8 36469535 99083736 Rat 8694446 Bw170 Body weight QTL 170 12.07 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 8 71888757 116888757 Rat 631650 Stl6 Serum triglyceride level QTL 6 4 0.0019 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 8 10378157 112202585 Rat 631653 Bp125 Blood pressure QTL 125 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 66142385 111142385 Rat 1581557 Eae16 Experimental allergic encephalomyelitis QTL 16 3.8 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 8 8462195 110921472 Rat 1358907 Cm40 Cardiac mass QTL 40 1.89 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 27205715 99103503 Rat 70197 BpQTLcluster8 Blood pressure QTL cluster 8 3.482 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 46531639 119088626 Rat 2316950 Scl66 Serum cholesterol level QTL 66 4.1 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 8 30848259 105647037 Rat 2300182 Bmd56 Bone mineral density QTL 56 5.4 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 95718998 123900184 Rat 2300181 Bmd55 Bone mineral density QTL 55 5.7 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 76468691 121468691 Rat 10402857 Bp380 Blood pressure QTL 380 0.95 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 53968765 98968765 Rat 1358892 Kidm26 Kidney mass QTL 26 3.69 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 8 27205715 99103503 Rat 2301402 Bp316 Blood pressure QTL 316 0.005 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 53968765 98968765 Rat 631664 Hcar3 Hepatocarcinoma resistance QTL 3 2.9 0.0005 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 8 54237644 99103503 Rat 1358893 Bp263 Blood pressure QTL 263 5.01 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 93965141 123900184 Rat 8694200 Abfw4 Abdominal fat weight QTL 4 9.07 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 8 71888757 116888757 Rat 8694392 Bw161 Body weight QTL 161 8.06 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 8 71888757 116888757 Rat 61437 Cia6 Collagen induced arthritis QTL 6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 8 82460758 122812818 Rat
AW530896
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 97,288,039 - 97,288,229 (+) MAPPER mRatBN7.2 Rnor_6.0 8 104,593,021 - 104,593,210 NCBI Rnor6.0 Rnor_5.0 8 104,039,563 - 104,039,752 UniSTS Rnor5.0 RGSC_v3.4 8 101,786,122 - 101,786,311 UniSTS RGSC3.4 Celera 8 96,730,432 - 96,730,621 UniSTS RH 3.4 Map 8 1052.3 UniSTS Cytogenetic Map 8 q31 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000016625 ⟹ ENSRNOP00000067350
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 97,281,546 - 97,296,084 (-) Ensembl Rnor_6.0 Ensembl 8 104,589,621 - 104,593,625 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000097273 ⟹ ENSRNOP00000078634
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 97,282,074 - 97,485,625 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000097643 ⟹ ENSRNOP00000081438
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 97,280,993 - 97,331,437 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000100368 ⟹ ENSRNOP00000094159
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 97,281,584 - 97,318,750 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000102946 ⟹ ENSRNOP00000095257
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 97,280,993 - 97,318,750 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000103605 ⟹ ENSRNOP00000095446
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 97,280,993 - 97,351,352 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000107023 ⟹ ENSRNOP00000093204
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 97,280,993 - 97,318,750 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000111528 ⟹ ENSRNOP00000081285
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 97,280,993 - 97,351,380 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000115816 ⟹ ENSRNOP00000097975
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 97,280,993 - 97,331,437 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000119448 ⟹ ENSRNOP00000094938
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 97,280,993 - 97,351,380 (-) Ensembl
RefSeq Acc Id:
NM_001012471 ⟹ NP_001012489
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 106,164,161 - 106,168,062 (-) NCBI mRatBN7.2 8 97,284,617 - 97,288,518 (-) NCBI Rnor_6.0 8 104,589,598 - 104,593,499 (-) NCBI Rnor_5.0 8 104,013,746 - 104,141,365 (-) NCBI RGSC_v3.4 8 101,782,699 - 101,786,600 (-) RGD Celera 8 96,727,009 - 96,730,910 (-) RGD
Sequence:
GTAGCACATAGCCTAGAAATGACTAAGTCGCTGATGGGAGGCCCCTGACCATTTGTTTCTTGTTTCAGATGACAGTCATGTCCCTCTCCAGGGACCTCAAGGACGACTTTCACAGTGACACGGTGCTC
hide sequence
RefSeq Acc Id:
XM_063265575 ⟹ XP_063121645
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 106,161,802 - 106,196,963 (-) NCBI
RefSeq Acc Id:
XM_063265576 ⟹ XP_063121646
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 106,161,802 - 106,195,502 (-) NCBI
RefSeq Acc Id:
XM_063265577 ⟹ XP_063121647
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 106,161,802 - 106,191,364 (-) NCBI
RefSeq Acc Id:
XM_063265578 ⟹ XP_063121648
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 106,161,802 - 106,230,891 (-) NCBI
RefSeq Acc Id:
XM_063265579 ⟹ XP_063121649
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 106,161,802 - 106,230,891 (-) NCBI
RefSeq Acc Id:
XM_063265580 ⟹ XP_063121650
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 106,161,802 - 106,175,641 (-) NCBI
RefSeq Acc Id:
XM_063265581 ⟹ XP_063121651
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 106,161,802 - 106,230,891 (-) NCBI
RefSeq Acc Id:
XM_063265582 ⟹ XP_063121652
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 106,161,802 - 106,230,891 (-) NCBI
RefSeq Acc Id:
XM_063265583 ⟹ XP_063121653
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 106,161,802 - 106,196,487 (-) NCBI
RefSeq Acc Id:
XM_063265584 ⟹ XP_063121654
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 106,161,802 - 106,196,560 (-) NCBI
RefSeq Acc Id:
XR_010053973
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 106,139,460 - 106,231,214 (-) NCBI
RefSeq Acc Id:
XR_010053974
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 106,124,181 - 106,231,214 (-) NCBI
RefSeq Acc Id:
XR_010053975
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 106,124,181 - 106,231,215 (-) NCBI
RefSeq Acc Id:
XR_010053976
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 106,124,181 - 106,231,214 (-) NCBI
RefSeq Acc Id:
XR_010053977
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 106,139,460 - 106,230,988 (-) NCBI
RefSeq Acc Id:
XR_010053978
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 106,139,460 - 106,231,014 (-) NCBI
RefSeq Acc Id:
NP_001012489 ⟸ NM_001012471
- UniProtKB:
M0RCM7 (UniProtKB/TrEMBL), A6I286 (UniProtKB/TrEMBL)
- Sequence:
MTVMSLSRDLKDDFHSDTVLSILNEQRIRGILCDVTIIVEDTKFKAHSNVLAASSLYFKNIFWSHTICISSHVLELDDLKAEVFTEILNYIYSSTVVVRRQETVTDLAAAGKRLGISFLEDLSDRNFS
hide sequence
Ensembl Acc Id:
ENSRNOP00000067350 ⟸ ENSRNOT00000016625
Ensembl Acc Id:
ENSRNOP00000097975 ⟸ ENSRNOT00000115816
Ensembl Acc Id:
ENSRNOP00000094938 ⟸ ENSRNOT00000119448
Ensembl Acc Id:
ENSRNOP00000095257 ⟸ ENSRNOT00000102946
Ensembl Acc Id:
ENSRNOP00000093204 ⟸ ENSRNOT00000107023
Ensembl Acc Id:
ENSRNOP00000094159 ⟸ ENSRNOT00000100368
Ensembl Acc Id:
ENSRNOP00000095446 ⟸ ENSRNOT00000103605
Ensembl Acc Id:
ENSRNOP00000081438 ⟸ ENSRNOT00000097643
Ensembl Acc Id:
ENSRNOP00000081285 ⟸ ENSRNOT00000111528
Ensembl Acc Id:
ENSRNOP00000078634 ⟸ ENSRNOT00000097273
RefSeq Acc Id:
XP_063121651 ⟸ XM_063265581
- Peptide Label:
isoform X2
- UniProtKB:
A6I286 (UniProtKB/TrEMBL), M0RCM7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063121649 ⟸ XM_063265579
- Peptide Label:
isoform X2
- UniProtKB:
A6I286 (UniProtKB/TrEMBL), M0RCM7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063121648 ⟸ XM_063265578
- Peptide Label:
isoform X2
- UniProtKB:
A6I286 (UniProtKB/TrEMBL), M0RCM7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063121652 ⟸ XM_063265582
- Peptide Label:
isoform X2
- UniProtKB:
A6I286 (UniProtKB/TrEMBL), M0RCM7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063121645 ⟸ XM_063265575
- Peptide Label:
isoform X1
- UniProtKB:
A6I286 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063121654 ⟸ XM_063265584
- Peptide Label:
isoform X2
- UniProtKB:
A6I286 (UniProtKB/TrEMBL), M0RCM7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063121653 ⟸ XM_063265583
- Peptide Label:
isoform X2
- UniProtKB:
A6I286 (UniProtKB/TrEMBL), M0RCM7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063121646 ⟸ XM_063265576
- Peptide Label:
isoform X2
- UniProtKB:
A6I286 (UniProtKB/TrEMBL), M0RCM7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063121647 ⟸ XM_063265577
- Peptide Label:
isoform X2
- UniProtKB:
A6I286 (UniProtKB/TrEMBL), M0RCM7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063121650 ⟸ XM_063265580
- Peptide Label:
isoform X2
- UniProtKB:
A6I286 (UniProtKB/TrEMBL), M0RCM7 (UniProtKB/TrEMBL)
BioCyc Gene G2FUF-29449 BioCyc
Ensembl Genes ENSRNOG00000012386 Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript ENSRNOT00000016625 ENTREZGENE
ENSRNOT00000016625.7 UniProtKB/TrEMBL
ENSRNOT00000097273.1 UniProtKB/TrEMBL
ENSRNOT00000097643.1 UniProtKB/TrEMBL
ENSRNOT00000100368.1 UniProtKB/TrEMBL
ENSRNOT00000102946 ENTREZGENE
ENSRNOT00000102946.1 UniProtKB/TrEMBL
ENSRNOT00000103605.1 UniProtKB/TrEMBL
ENSRNOT00000107023.1 UniProtKB/TrEMBL
ENSRNOT00000111528 ENTREZGENE
ENSRNOT00000111528.1 UniProtKB/TrEMBL
ENSRNOT00000115816.1 UniProtKB/TrEMBL
ENSRNOT00000119448.1 UniProtKB/TrEMBL
ENSRNOT00000120592 ENTREZGENE
ENSRNOT00000121360 ENTREZGENE
ENSRNOT00000154527 ENTREZGENE
Gene3D-CATH Classic Zinc Finger UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Potassium Channel Kv1.1, Chain A UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro BTB/POZ_dom UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SKP1/BTB/POZ_sf UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Znf_C2H2_sf UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Znf_C2H2_type UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report rno:315936 UniProtKB/Swiss-Prot
NCBI Gene 315936 ENTREZGENE
PANTHER ZINC FINGER AND BTB DOMAIN CONTAINING 33 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
ZINC FINGER PROTEIN UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam BTB UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
zf-C2H2 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
zf-C2H2_6 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen Zbtb38 PhenoGen
PROSITE BTB UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
ZINC_FINGER_C2H2_1 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
ZINC_FINGER_C2H2_2 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx ENSRNOG00000012386 RatGTEx
SMART BTB UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
ZnF_C2H2 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP SSF54695 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SSF57667 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt A6I286 ENTREZGENE, UniProtKB/TrEMBL
M0RCM7 ENTREZGENE, UniProtKB/TrEMBL
Q5EXX3 ENTREZGENE, UniProtKB/Swiss-Prot
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2006-03-30
Zbtb38
zinc finger and BTB domain containing 38
RGD1310136
similar to kaiso protein; zinc finger transcription factor Kaiso
Symbol and Name updated
1299863 APPROVED
2005-12-06
RGD1310136
similar to kaiso protein; zinc finger transcription factor Kaiso
RGD1310136_predicted
similar to kaiso protein; zinc finger transcription factor Kaiso (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-20
RGD1310136_predicted
similar to kaiso protein; zinc finger transcription factor Kaiso (predicted)
LOC315936_predicted
Symbol and Name status set to approved
1331353 APPROVED
2005-01-12
LOC315936_predicted
similar to kaiso protein; zinc finger transcription factor Kaiso (predicted)
Symbol and Name status set to provisional
70820 PROVISIONAL
