Advanced Search (OLGA)

Gene: Supt16h (SPT16 homolog, facilitates chromatin remodeling subunit) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Supt16h

Name:

SPT16 homolog, facilitates chromatin remodeling subunit

RGD ID:

1310032

Description:

Predicted to enable nucleosome binding activity. Predicted to be involved in nucleosome disassembly and transcription elongation by RNA polymerase II. Predicted to be located in nucleoplasm. Predicted to be part of FACT complex. Human ortholog(s) of this gene implicated in neurodevelopmental disorder with dysmorphic facies and thin corpus callosum. Orthologous to human SUPT16H (SPT16 homolog, facilitates chromatin remodeling subunit); PARTICIPATES IN histone modification pathway; RNA polymerase I transcription pathway; RNA polymerase II transcription elongation pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

FACT complex subunit SPT16; LOC305851; suppressor of Ty 16 homolog; suppressor of Ty 16 homolog (S. cerevisiae)

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	15	27,341,196 - 27,378,314 (-)	NCBI		GRCr8
mRatBN7.2	15	24,867,697 - 24,904,818 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	24,866,489 - 24,904,846 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	15	27,639,907 - 27,677,046 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	15	28,594,508 - 28,631,626 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	15	26,847,446 - 26,884,565 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	15	28,574,841 - 28,611,959 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	28,575,480 - 28,611,946 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	15	32,385,107 - 32,422,226 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	15	27,604,676 - 27,641,794 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	15	27,620,377 - 27,657,927 (-)	NCBI
Celera	15	25,171,514 - 25,208,618 (-)	NCBI		Celera
Cytogenetic Map	15	p14	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Supt16h	Rat	Brain-Lung-Thyroid Syndrome		ISO	SUPT16H (Homo sapiens)	8554872	ClinVar Annotator: match by term: Brain-lung-thyroid syndrome	ClinVar	PMID:25741868
Supt16h	Rat	cone-rod dystrophy 13		ISO	SUPT16H (Homo sapiens)	8554872	ClinVar Annotator: match by term: Cone-rod dystrophy 13	ClinVar	PMID:11528500 more ...
Supt16h	Rat	dextrocardia		ISO	SUPT16H (Homo sapiens)	8554872	ClinVar Annotator: match by term: Dextrocardia	ClinVar
Supt16h	Rat	genetic disease		ISO	SUPT16H (Homo sapiens)	8554872	ClinVar Annotator: match by term: Inborn genetic diseases	ClinVar
Supt16h	Rat	neurodevelopmental disorder with dysmorphic facies and thin corpus callosum		ISO	SUPT16H (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:25741868 more ...
Supt16h	Rat	Neurodevelopmental Disorders		ISO	SUPT16H (Homo sapiens)	8554872	ClinVar Annotator: match by term: Neurodevelopmental disorder	ClinVar	PMID:25741868
Supt16h	Rat	purine nucleoside phosphorylase deficiency		ISO	SUPT16H (Homo sapiens)	8554872	ClinVar Annotator: match by term: Purine-nucleoside phosphorylase deficiency	ClinVar	PMID:24767876 and PMID:28492532

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Supt16h	Rat	neurodevelopmental disorder with dysmorphic facies and thin corpus callosum		ISO	SUPT16H (Homo sapiens)	7240710		OMIM

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Supt16h	Rat	1,2-dimethylhydrazine	multiple interactions	ISO	Supt16 (Mus musculus)	6480464	[1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of SUPT16 mRNA	CTD	PMID:22206623
Supt16h	Rat	1-chloro-2,4-dinitrobenzene	affects binding	ISO	SUPT16H (Homo sapiens)	6480464	Dinitrochlorobenzene binds to SUPT16H protein	CTD	PMID:32991956
Supt16h	Rat	2,2',4,4'-Tetrabromodiphenyl ether	decreases expression	ISO	SUPT16H (Homo sapiens)	6480464	2 more ...	CTD	PMID:31675489
Supt16h	Rat	2,3',4,4',5-Pentachlorobiphenyl	increases expression	ISO	Supt16 (Mus musculus)	6480464	2 more ...	CTD	PMID:31388691
Supt16h	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of SUPT16H mRNA	CTD	PMID:33387578
Supt16h	Rat	2,4,6-tribromophenol	decreases expression	ISO	SUPT16H (Homo sapiens)	6480464	2 more ...	CTD	PMID:31675489
Supt16h	Rat	2,6-dinitrotoluene	affects expression	EXP		6480464	2 and 6-dinitrotoluene affects the expression of SUPT16H mRNA	CTD	PMID:21346803
Supt16h	Rat	3,3',5,5'-tetrabromobisphenol A	decreases expression	ISO	SUPT16H (Homo sapiens)	6480464	tetrabromobisphenol A results in decreased expression of SUPT16H protein	CTD	PMID:31675489
Supt16h	Rat	all-trans-retinoic acid	decreases expression	ISO	SUPT16H (Homo sapiens)	6480464	Tretinoin results in decreased expression of SUPT16H mRNA	CTD	PMID:33167477
Supt16h	Rat	aristolochic acid A	decreases expression	ISO	SUPT16H (Homo sapiens)	6480464	aristolochic acid I results in decreased expression of SUPT16H mRNA	CTD	PMID:33212167
Supt16h	Rat	arsenite(3-)	multiple interactions	ISO	SUPT16H (Homo sapiens)	6480464	arsenite inhibits the reaction [G3BP1 protein binds to SUPT16H mRNA]	CTD	PMID:32406909
Supt16h	Rat	benzo[a]pyrene	increases expression	ISO	SUPT16H (Homo sapiens)	6480464	Benzo(a)pyrene results in increased expression of SUPT16H mRNA	CTD	PMID:17879257 and PMID:32234424
Supt16h	Rat	benzo[a]pyrene	affects methylation	ISO	SUPT16H (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of SUPT16H promoter	CTD	PMID:27901495
Supt16h	Rat	benzo[a]pyrene	decreases expression	ISO	SUPT16H (Homo sapiens)	6480464	Benzo(a)pyrene results in decreased expression of SUPT16H mRNA	CTD	PMID:21632981
Supt16h	Rat	bis(2-ethylhexyl) phthalate	decreases expression	ISO	Supt16 (Mus musculus)	6480464	Diethylhexyl Phthalate results in decreased expression of SUPT16 mRNA	CTD	PMID:33754040
Supt16h	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of SUPT16H mRNA	CTD	PMID:25181051
Supt16h	Rat	bisphenol A	decreases expression	ISO	SUPT16H (Homo sapiens)	6480464	bisphenol A results in decreased expression of SUPT16H protein	CTD	PMID:31675489 more ...
Supt16h	Rat	bisphenol A	decreases expression	ISO	Supt16 (Mus musculus)	6480464	bisphenol A results in decreased expression of SUPT16 mRNA	CTD	PMID:33221593
Supt16h	Rat	bisphenol A	affects expression	ISO	SUPT16H (Homo sapiens)	6480464	bisphenol A affects the expression of SUPT16H mRNA	CTD	PMID:30903817
Supt16h	Rat	Bisphenol A diglycidyl ether	affects splicing	ISO	Supt16 (Mus musculus)	6480464	bisphenol A diglycidyl ether affects the splicing of SUPT16 mRNA	CTD	PMID:36464114
Supt16h	Rat	bisphenol AF	affects splicing	ISO	Supt16 (Mus musculus)	6480464	bisphenol AF affects the splicing of SUPT16 mRNA	CTD	PMID:36464114
Supt16h	Rat	bisphenol AF	increases expression	ISO	SUPT16H (Homo sapiens)	6480464	bisphenol AF results in increased expression of SUPT16H protein	CTD	PMID:34186270
Supt16h	Rat	Bisphenol B	increases expression	ISO	SUPT16H (Homo sapiens)	6480464	bisphenol B results in increased expression of SUPT16H protein	CTD	PMID:34186270
Supt16h	Rat	bisphenol F	increases expression	ISO	SUPT16H (Homo sapiens)	6480464	bisphenol F results in increased expression of SUPT16H protein	CTD	PMID:34186270
Supt16h	Rat	C60 fullerene	increases expression	EXP		6480464	fullerene C60 results in increased expression of SUPT16H mRNA	CTD	PMID:19167457
Supt16h	Rat	cadmium dichloride	decreases expression	ISO	SUPT16H (Homo sapiens)	6480464	Cadmium Chloride results in decreased expression of SUPT16H mRNA	CTD	PMID:38568856
Supt16h	Rat	carbon nanotube	multiple interactions	ISO	Supt16 (Mus musculus)	6480464	[Dibutyl Phthalate co-treated with Nanotubes and Carbon] results in decreased expression of SUPT16 protein	CTD	PMID:34864091
Supt16h	Rat	chloropicrin	increases expression	ISO	SUPT16H (Homo sapiens)	6480464	chloropicrin results in increased expression of SUPT16H mRNA	CTD	PMID:26352163
Supt16h	Rat	chlorpyrifos	decreases expression	ISO	Supt16 (Mus musculus)	6480464	Chlorpyrifos results in decreased expression of SUPT16 mRNA	CTD	PMID:37019170
Supt16h	Rat	cobalt dichloride	decreases expression	ISO	SUPT16H (Homo sapiens)	6480464	cobaltous chloride results in decreased expression of SUPT16H mRNA	CTD	PMID:19376846
Supt16h	Rat	coumarin	increases phosphorylation	ISO	SUPT16H (Homo sapiens)	6480464	coumarin results in increased phosphorylation of SUPT16H protein	CTD	PMID:35688186
Supt16h	Rat	coumestrol	multiple interactions	ISO	SUPT16H (Homo sapiens)	6480464	[Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of SUPT16H mRNA	CTD	PMID:19167446
Supt16h	Rat	coumestrol	increases expression	ISO	SUPT16H (Homo sapiens)	6480464	Coumestrol results in increased expression of SUPT16H mRNA	CTD	PMID:19167446
Supt16h	Rat	Cuprizon	decreases expression	EXP		6480464	Cuprizone results in decreased expression of SUPT16H mRNA	CTD	PMID:26577399
Supt16h	Rat	Cuprizon	affects expression	EXP		6480464	Cuprizone affects the expression of SUPT16H mRNA	CTD	PMID:27523638
Supt16h	Rat	cyclosporin A	decreases expression	ISO	SUPT16H (Homo sapiens)	6480464	Cyclosporine results in decreased expression of SUPT16H mRNA	CTD	PMID:21632981 and PMID:25562108
Supt16h	Rat	DDE	increases expression	ISO	SUPT16H (Homo sapiens)	6480464	Dichlorodiphenyl Dichloroethylene results in increased expression of SUPT16H mRNA	CTD	PMID:38568856
Supt16h	Rat	decabromodiphenyl ether	decreases expression	ISO	SUPT16H (Homo sapiens)	6480464	decabromobiphenyl ether results in decreased expression of SUPT16H protein	CTD	PMID:31675489
Supt16h	Rat	dibutyl phthalate	decreases expression	ISO	Supt16 (Mus musculus)	6480464	Dibutyl Phthalate results in decreased expression of SUPT16 protein and Dibutyl Phthalate results in decreased expression of SUPT16H mRNA	CTD	PMID:17361019 and PMID:34864091
Supt16h	Rat	dibutyl phthalate	multiple interactions	ISO	Supt16 (Mus musculus)	6480464	[Dibutyl Phthalate co-treated with Nanotubes and Carbon] results in decreased expression of SUPT16 protein	CTD	PMID:34864091
Supt16h	Rat	dorsomorphin	multiple interactions	ISO	SUPT16H (Homo sapiens)	6480464	[NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of SUPT16H mRNA	CTD	PMID:27188386
Supt16h	Rat	doxorubicin	affects expression	ISO	SUPT16H (Homo sapiens)	6480464	Doxorubicin affects the expression of SUPT16H mRNA	CTD	PMID:29803840
Supt16h	Rat	Enterolactone	multiple interactions	ISO	SUPT16H (Homo sapiens)	6480464	[Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of SUPT16H mRNA	CTD	PMID:19167446
Supt16h	Rat	epoxiconazole	decreases expression	ISO	Supt16 (Mus musculus)	6480464	epoxiconazole results in decreased expression of SUPT16 mRNA	CTD	PMID:35436446
Supt16h	Rat	flutamide	increases expression	EXP		6480464	Flutamide results in increased expression of SUPT16H mRNA	CTD	PMID:24136188
Supt16h	Rat	folic acid	multiple interactions	ISO	Supt16 (Mus musculus)	6480464	[1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of SUPT16 mRNA	CTD	PMID:22206623
Supt16h	Rat	FR900359	affects phosphorylation	ISO	SUPT16H (Homo sapiens)	6480464	FR900359 affects the phosphorylation of SUPT16H protein	CTD	PMID:37730182
Supt16h	Rat	geldanamycin	increases expression	ISO	SUPT16H (Homo sapiens)	6480464	geldanamycin results in increased expression of SUPT16H mRNA	CTD	PMID:26705709
Supt16h	Rat	gentamycin	increases expression	EXP		6480464	Gentamicins results in increased expression of SUPT16H mRNA	CTD	PMID:22061828
Supt16h	Rat	geraniol	decreases expression	ISO	SUPT16H (Homo sapiens)	6480464	geraniol results in decreased expression of SUPT16H mRNA	CTD	PMID:27683099
Supt16h	Rat	inulin	multiple interactions	ISO	Supt16 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of SUPT16 mRNA	CTD	PMID:36331819
Supt16h	Rat	ivermectin	decreases expression	ISO	SUPT16H (Homo sapiens)	6480464	Ivermectin results in decreased expression of SUPT16H protein	CTD	PMID:32959892
Supt16h	Rat	mercury dichloride	decreases expression	ISO	SUPT16H (Homo sapiens)	6480464	Mercuric Chloride results in decreased expression of SUPT16H mRNA	CTD	PMID:27188386
Supt16h	Rat	methylmercury chloride	increases expression	ISO	SUPT16H (Homo sapiens)	6480464	methylmercuric chloride results in increased expression of SUPT16H mRNA	CTD	PMID:26272509
Supt16h	Rat	methylparaben	increases expression	ISO	SUPT16H (Homo sapiens)	6480464	methylparaben results in increased expression of SUPT16H mRNA	CTD	PMID:31745603
Supt16h	Rat	Monobutylphthalate	decreases expression	ISO	Supt16 (Mus musculus)	6480464	monobutyl phthalate results in decreased expression of SUPT16H protein	CTD	PMID:20553848
Supt16h	Rat	nitrates	multiple interactions	ISO	Supt16 (Mus musculus)	6480464	[Particulate Matter results in increased abundance of Nitrates] which results in increased expression of SUPT16 mRNA	CTD	PMID:35964746
Supt16h	Rat	ochratoxin A	increases expression	EXP		6480464	ochratoxin A results in increased expression of SUPT16H mRNA	CTD	PMID:17483316
Supt16h	Rat	oxaliplatin	multiple interactions	EXP		6480464	[oxaliplatin co-treated with Topotecan] results in decreased expression of SUPT16H mRNA	CTD	PMID:25729387
Supt16h	Rat	oxaliplatin	decreases expression	EXP		6480464	oxaliplatin results in decreased expression of SUPT16H mRNA	CTD	PMID:25729387
Supt16h	Rat	paracetamol	decreases expression	EXP		6480464	Acetaminophen results in decreased expression of SUPT16H mRNA	CTD	PMID:33387578
Supt16h	Rat	parathion	decreases expression	ISO	Supt16 (Mus musculus)	6480464	Parathion results in decreased expression of SUPT16 mRNA	CTD	PMID:34813904
Supt16h	Rat	perfluorohexanesulfonic acid	decreases expression	ISO	SUPT16H (Homo sapiens)	6480464	perfluorohexanesulfonic acid results in decreased expression of SUPT16H mRNA	CTD	PMID:25812627
Supt16h	Rat	perfluorononanoic acid	decreases expression	ISO	SUPT16H (Homo sapiens)	6480464	perfluoro-n-nonanoic acid results in decreased expression of SUPT16H mRNA	CTD	PMID:25812627
Supt16h	Rat	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	Supt16 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of SUPT16 mRNA	CTD	PMID:36331819
Supt16h	Rat	perfluorooctane-1-sulfonic acid	decreases expression	ISO	SUPT16H (Homo sapiens)	6480464	perfluorooctane sulfonic acid results in decreased expression of SUPT16H mRNA	CTD	PMID:25812627
Supt16h	Rat	perfluorooctanoic acid	decreases expression	ISO	SUPT16H (Homo sapiens)	6480464	perfluorooctanoic acid results in decreased expression of SUPT16H mRNA and perfluorooctanoic acid results in decreased expression of SUPT16H protein	CTD	PMID:25812627 and PMID:26879310
Supt16h	Rat	resveratrol	multiple interactions	ISO	SUPT16H (Homo sapiens)	6480464	[Plant Extracts co-treated with Resveratrol] results in increased expression of SUPT16H mRNA	CTD	PMID:23557933
Supt16h	Rat	SB 431542	multiple interactions	ISO	SUPT16H (Homo sapiens)	6480464	[NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of SUPT16H mRNA	CTD	PMID:27188386
Supt16h	Rat	sodium arsenite	decreases expression	ISO	SUPT16H (Homo sapiens)	6480464	sodium arsenite results in decreased expression of SUPT16H mRNA	CTD	PMID:38568856
Supt16h	Rat	thimerosal	decreases expression	ISO	SUPT16H (Homo sapiens)	6480464	Thimerosal results in decreased expression of SUPT16H mRNA	CTD	PMID:27188386
Supt16h	Rat	thiram	decreases expression	ISO	SUPT16H (Homo sapiens)	6480464	Thiram results in decreased expression of SUPT16H mRNA	CTD	PMID:38568856
Supt16h	Rat	titanium dioxide	increases expression	ISO	SUPT16H (Homo sapiens)	6480464	titanium dioxide results in increased expression of SUPT16H protein	CTD	PMID:30910687
Supt16h	Rat	titanium dioxide	increases methylation	ISO	Supt16 (Mus musculus)	6480464	titanium dioxide results in increased methylation of SUPT16H gene and titanium dioxide results in increased methylation of SUPT16H promoter	CTD	PMID:35295148
Supt16h	Rat	titanium dioxide	decreases methylation	ISO	Supt16 (Mus musculus)	6480464	titanium dioxide results in decreased methylation of SUPT16H gene and titanium dioxide results in decreased methylation of SUPT16H promoter	CTD	PMID:35295148
Supt16h	Rat	topotecan	multiple interactions	EXP		6480464	[oxaliplatin co-treated with Topotecan] results in decreased expression of SUPT16H mRNA	CTD	PMID:25729387
Supt16h	Rat	trichloroethene	decreases expression	EXP		6480464	Trichloroethylene results in decreased expression of SUPT16H mRNA	CTD	PMID:33387578
Supt16h	Rat	trichostatin A	decreases expression	ISO	SUPT16H (Homo sapiens)	6480464	trichostatin A results in decreased expression of SUPT16H mRNA	CTD	PMID:26272509
Supt16h	Rat	trichostatin A	multiple interactions	ISO	SUPT16H (Homo sapiens)	6480464	[NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of SUPT16H mRNA	CTD	PMID:27188386
Supt16h	Rat	trimellitic anhydride	increases expression	ISO	Supt16 (Mus musculus)	6480464	trimellitic anhydride results in increased expression of SUPT16H mRNA	CTD	PMID:19042947
Supt16h	Rat	triphenyl phosphate	affects expression	ISO	SUPT16H (Homo sapiens)	6480464	triphenyl phosphate affects the expression of SUPT16H mRNA	CTD	PMID:37042841
Supt16h	Rat	tungsten	decreases expression	ISO	Supt16 (Mus musculus)	6480464	Tungsten results in decreased expression of SUPT16 mRNA	CTD	PMID:30912803
Supt16h	Rat	vorinostat	decreases expression	ISO	SUPT16H (Homo sapiens)	6480464	vorinostat results in decreased expression of SUPT16H mRNA	CTD	PMID:27188386

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Supt16h	Rat	biological_process		ND		1598407	10/2014: no relevant rat data	RGD
Supt16h	Rat	DNA damage response	involved_in	IEA	UniProtKB-KW:KW-0227	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Supt16h	Rat	DNA repair	involved_in	IEA	UniRule:UR001376781	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Supt16h	Rat	DNA repair	involved_in	IEA	UniProtKB-KW:KW-0234	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Supt16h	Rat	DNA replication	involved_in	IEA	UniProtKB-KW:KW-0235	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Supt16h	Rat	nucleosome disassembly	involved_in	ISO	SUPT16H (Homo sapiens)	1624291	PMID:16902406	RGD	PMID:16902406
Supt16h	Rat	nucleosome disassembly	involved_in	IEA	UniProtKB:Q9Y5B9 and ensembl:ENSP00000216297	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Supt16h	Rat	transcription elongation by RNA polymerase II	involved_in	IBA	CGD:CAL0000198046 and PANTHER:PTN000360139	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Supt16h	Rat	chromosome	located_in	IEA	UniProtKB-KW:KW-0158	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Supt16h	Rat	chromosome	located_in	IEA	UniProtKB-SubCell:SL-0468	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Supt16h	Rat	FACT complex	part_of	ISO	SUPT16H (Homo sapiens)	1624291	PMID:16902406	RGD	PMID:16902406
Supt16h	Rat	FACT complex	part_of	IEA	InterPro:IPR040258	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Supt16h	Rat	FACT complex	part_of	IBA	FB:FBgn0002183 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Supt16h	Rat	FACT complex	part_of	IEA	UniRule:UR001376781	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Supt16h	Rat	FACT complex	part_of	IEA	UniProtKB:Q9Y5B9 and ensembl:ENSP00000216297	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Supt16h	Rat	nucleoplasm	located_in	ISO	SUPT16H (Homo sapiens)	1624291		RGD	GO_REF:0000052
Supt16h	Rat	nucleoplasm	located_in	IEA	UniProtKB:Q9Y5B9 and ensembl:ENSP00000216297	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Supt16h	Rat	nucleus	located_in	IEA	UniProtKB-SubCell:SL-0191	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Supt16h	Rat	nucleus	located_in	IEA	UniProtKB:Q9Y5B9 and ensembl:ENSP00000216297	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Supt16h	Rat	nucleus	located_in	IEA	UniProtKB-KW:KW-0539	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Supt16h	Rat	nucleus	located_in	IEA	ARBA:ARBA00026330	1600115	GO_REF:0000117	UniProt	GO_REF:0000117
Supt16h	Rat	nucleus	located_in	ISO	SUPT16H (Homo sapiens)	1624291	PMID:9489704	RGD	PMID:9489704

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Supt16h	Rat	nucleosome binding	enables	IBA	FB:FBgn0002183 and PANTHER:PTN000360139	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Supt16h	Rat	protein binding	enables	ISO	SUPT16H (Homo sapiens)	1624291	UniProtKB:P05067 more ...	RGD	PMID:16902406 more ...

RGD Manual Annotations

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Supt16h	Rat	histone modification pathway		ISO	SUPT16H (Homo sapiens)	9068945		RGD
Supt16h	Rat	RNA polymerase I transcription pathway		ISO	SUPT16H (Homo sapiens)	9588245		RGD
Supt16h	Rat	RNA polymerase II transcription elongation pathway		ISO	SUPT16H (Homo sapiens)	9681735		RGD

#	Reference Title	Reference Citation
1.	Histone chaperones in nucleosome assembly and human disease.	Burgess RJ and Zhang Z, Nat Struct Mol Biol. 2013 Jan;20(1):14-22. doi: 10.1038/nsmb.2461.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Control of transcriptional elongation.	Kwak H and Lis JT, Annu Rev Genet. 2013;47:483-508. doi: 10.1146/annurev-genet-110711-155440. Epub 2013 Sep 11.
4.	Histone H3 lysine 9 and H4 lysine 20 trimethylation and the expression of Suv4-20h2 and Suv-39h1 histone methyltransferases in hepatocarcinogenesis induced by methyl deficiency in rats.	Pogribny IP, etal., Carcinogenesis. 2006 Jun;27(6):1180-6. Epub 2006 Feb 23.
5.	GOA pipeline	RGD automated data pipeline
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Comprehensive gene review and curation	RGD comprehensive gene curation
8.	The histone chaperone FACT: structural insights and mechanisms for nucleosome reorganization.	Winkler DD and Luger K, J Biol Chem. 2011 May 27;286(21):18369-74. doi: 10.1074/jbc.R110.180778. Epub 2011 Mar 24.

PMID:22658674	PMID:22681889	PMID:24625528

Supt16h
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	15	27,341,196 - 27,378,314 (-)	NCBI		GRCr8
mRatBN7.2	15	24,867,697 - 24,904,818 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	24,866,489 - 24,904,846 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	15	27,639,907 - 27,677,046 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	15	28,594,508 - 28,631,626 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	15	26,847,446 - 26,884,565 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	15	28,574,841 - 28,611,959 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	28,575,480 - 28,611,946 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	15	32,385,107 - 32,422,226 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	15	27,604,676 - 27,641,794 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	15	27,620,377 - 27,657,927 (-)	NCBI
Celera	15	25,171,514 - 25,208,618 (-)	NCBI		Celera
Cytogenetic Map	15	p14	NCBI

SUPT16H
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	14	21,351,476 - 21,384,019 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	14	21,351,476 - 21,384,019 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	14	21,819,635 - 21,852,178 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	14	20,889,475 - 20,922,265 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	14	20,889,477 - 20,922,265	NCBI
Celera	14	1,685,113 - 1,717,921 (-)	NCBI		Celera
Cytogenetic Map	14	q11.2	NCBI
HuRef	14	1,939,467 - 1,972,279 (-)	NCBI		HuRef
CHM1_1	14	21,821,298 - 21,854,094 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	14	15,548,935 - 15,581,495 (-)	NCBI		T2T-CHM13v2.0

Supt16
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	14	52,397,876 - 52,434,696 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	14	52,397,871 - 52,434,873 (-)	Ensembl		GRCm39 Ensembl
GRCm38	14	52,160,419 - 52,197,239 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	14	52,160,414 - 52,197,416 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	14	52,780,094 - 52,816,914 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	14	51,082,370 - 51,119,152 (-)	NCBI		MGSCv36	mm8
Celera	14	49,144,174 - 49,181,205 (-)	NCBI		Celera
Cytogenetic Map	14	C2	NCBI
cM Map	14	26.83	NCBI

Supt16h
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955550	2,074,941 - 2,114,528 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955550	2,074,646 - 2,114,634 (-)	NCBI	ChiLan1.0	ChiLan1.0

SUPT16H
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	15	22,806,792 - 22,840,192 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	14	22,023,279 - 22,056,679 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	14	2,169,169 - 2,201,911 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	14	20,247,321 - 20,280,074 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	14	20,247,325 - 20,280,074 (-)	Ensembl	panpan1.1		panPan2

SUPT16H
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	15	18,387,624 - 18,429,553 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	15	18,388,512 - 18,429,553 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	15	18,871,946 - 18,914,215 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	15	18,646,417 - 18,688,404 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	15	18,646,415 - 18,688,499 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	15	18,328,676 - 18,370,778 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	15	18,384,688 - 18,426,630 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	15	18,513,507 - 18,555,450 (-)	NCBI		UU_Cfam_GSD_1.0

Supt16h
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	32,602,319 - 32,635,984 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936880	508,244 - 545,369 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936880	511,699 - 545,364 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SUPT16H
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	77,781,316 - 77,814,505 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	7	77,780,968 - 77,814,519 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	83,173,111 - 83,206,010 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SUPT16H
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	29	21,822,520 - 21,855,552 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	29	21,822,393 - 21,855,923 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666059	24,575,299 - 24,608,045 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Supt16h
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624825	7,367,325 - 7,410,823 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624825	7,366,448 - 7,410,847 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Supt16h
150 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	337
Count of miRNA genes:	199
Interacting mature miRNAs:	218
Transcripts:	ENSRNOT00000016288
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331729	Rf42	Renal function QTL 42	3.071		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	15	17362897	73690657	Rat
1641887	Alcrsp14	Alcohol response QTL 14			response to alcohol trait (VT:0010489)	brain neurotensin receptor 1 density (CMO:0002068)	15	1	42356671	Rat
10755503	Bp391	Blood pressure QTL 391	2.37		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	15	20248600	37896129	Rat
1578646	Bmd18	Bone mineral density QTL 18	5.2		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	15	22806240	98288169	Rat
9589149	Insul29	Insulin level QTL 29	9.06	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	15	1	34723002	Rat
1578647	Bmd17	Bone mineral density QTL 17	4		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	15	22806240	98288169	Rat
10401805	Kidm51	Kidney mass QTL 51			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	15	306329	45306329	Rat
2317750	Glom26	Glomerulus QTL 26	4.3		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	15	12496141	65205939	Rat
2298549	Neuinf12	Neuroinflammation QTL 12	3.5		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	15	1	55302115	Rat
8552920	Pigfal8	Plasma insulin-like growth factor 1 level QTL 8	3		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	15	1	34723002	Rat
2293688	Bss29	Bone structure and strength QTL 29	5.31	0.0001	femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	15	11111142	56111142	Rat
5685002	Bss103	Bone structure and strength QTL 103	2.8		tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	15	14481165	28469888	Rat
8694361	Abfw6	Abdominal fat weight QTL 6	10.2	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	15	1	34723002	Rat
631273	Lecl2	Lens clarity QTL 2		0.001	lens clarity trait (VT:0001304)	age of onset/diagnosis of cataract (CMO:0001584)	15	10596089	55596089	Rat
2300167	Bmd63	Bone mineral density QTL 63	5.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	15	11111142	56111142	Rat
731170	Pur3	Proteinuria QTL 3	2.3	0.0005	urine protein amount (VT:0005160)	urine protein excretion rate (CMO:0000759)	15	1	41686771	Rat
738017	Hcas7	Hepatocarcinoma susceptibility QTL 7	2.91		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464)	15	2266368	46921453	Rat
10054130	Srcrt8	Stress Responsive Cort QTL 8	2.18	0.0085	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	15	22117933	67117933	Rat
2300173	Bmd62	Bone mineral density QTL 62	12.8	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	15	11111142	56111142	Rat
2324620	Coatc3	Coat color QTL 3			coat/hair pigmentation trait (VT:0010463)	pigmented coat/hair area to total coat/hair area ratio (CMO:0001810)	15	19856566	46187442	Rat
61424	Scl1	Serum cholesterol level QTL 1	7.7	0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	15	16725528	80672115	Rat
1582251	Gluco24	Glucose level QTL 24	3.2	0.0008	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	15	5530756	50530756	Rat
1354657	Despr13	Despair related QTL 13		0.0022	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	15	1	29912054	Rat
631550	Bw7	Body weight QTL 7	3.6		body mass (VT:0001259)	body weight (CMO:0000012)	15	19856566	34924750	Rat
1578660	Bss19	Bone structure and strength QTL 19	4.3		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	15	22806240	98288169	Rat

WI-14045

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	15	24,905,800 - 24,905,927 (+)	MAPPER	mRatBN7.2
Rnor_6.0	15	28,612,942 - 28,613,068	NCBI	Rnor6.0
Rnor_5.0	15	32,423,209 - 32,423,335	UniSTS	Rnor5.0
RGSC_v3.4	15	27,642,777 - 27,642,903	UniSTS	RGSC3.4
Celera	15	25,209,601 - 25,209,727	UniSTS
Cytogenetic Map	15	p14	UniSTS

AA997586

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	15	24,867,766 - 24,867,974 (+)	MAPPER	mRatBN7.2
Rnor_6.0	15	28,574,911 - 28,575,118	NCBI	Rnor6.0
Rnor_5.0	15	32,385,177 - 32,385,384	UniSTS	Rnor5.0
RGSC_v3.4	15	27,604,746 - 27,604,953	UniSTS	RGSC3.4
Celera	15	25,171,584 - 25,171,791	UniSTS
Cytogenetic Map	15	p14	UniSTS

RH138387

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	15	24,867,402 - 24,867,585 (+)	MAPPER	mRatBN7.2
Rnor_6.0	15	28,574,547 - 28,574,729	NCBI	Rnor6.0
Rnor_5.0	15	32,384,813 - 32,384,995	UniSTS	Rnor5.0
RGSC_v3.4	15	27,604,382 - 27,604,564	UniSTS	RGSC3.4
Celera	15	25,171,220 - 25,171,402	UniSTS
Cytogenetic Map	15	p14	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001107261	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC118113	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474040	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215536	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000015	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000016288 ⟹ ENSRNOP00000016288

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	15	24,868,520 - 24,904,827 (-)	Ensembl
Rnor_6.0 Ensembl	15	28,575,480 - 28,611,946 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000111950 ⟹ ENSRNOP00000076424

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	15	24,866,489 - 24,904,846 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000116098 ⟹ ENSRNOP00000091739

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	15	24,867,715 - 24,904,846 (-)	Ensembl

RefSeq Acc Id:

NM_001107261 ⟹ NP_001100731

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	27,341,196 - 27,378,314 (-)	NCBI
mRatBN7.2	15	24,867,697 - 24,904,818 (-)	NCBI
Rnor_6.0	15	28,574,841 - 28,611,959 (-)	NCBI
Rnor_5.0	15	32,385,107 - 32,422,226 (-)	NCBI
RGSC_v3.4	15	27,604,676 - 27,641,794 (-)	RGD
Celera	15	25,171,514 - 25,208,618 (-)	RGD

Sequence:

show sequence

GCGGGTGGCGGAGCTGGGACCTCGCGTGATTCTCGGAGCCCGACGGAAAGCGGCGTCCAGGGCTATGGCTGTGACTCTGGACAAAGACGCGTACTACCGGCGAGTTAAGAGACTGTACAGTAACTGGC
GGAAAGGAGAAGATGAGTATGCCAGTATTGATGCCATTGTTGTATCGGTGGGTGTTGATGAAGAAATTGTATATGCCAAGTCAACTGCCTTACAGACGTGGCTCTTTGGTTATGAACTAACTGATACA
ATCATGGTCTTCTGTGATGACAAAATCATCTTCATGGCCAGCAAAAAGAAGGTGGAGTTTCTGAAACAGATTGCCAATACTAAAGGCAATGAGAATGCTAATGGAGCTCCTGCCATCACACTGCTTGT
CAGAGAAAAGAATGAAAGTAATAAGAGCAGCTTTGACAAAATGATTGAAGCCATTAAAGAAAGCAAGAACGGCAAGAAAATTGGAGTGTTCAGCAAAGACAAGTTCCCTGGAGAATTCATGAAGAGCT
GGAGTGACTGTCTTAACAAGGAGGGCTTTGACAAAGTAGACATCAGCGCTGTTGTGGCATACACTATTGCTGTGAAAGAGGATGGTGAGCTCAACCTGATGAAGAAAGCAGCCAGCATTACCTCTGAG
GTCTTCAACAAGTTCTTCAAGGAAAGAGTCATGGAAATAGTGGATGCAGATGAGAAAGTTCGGCATAGCAAATTGGCTGAGTCTGTGGAAAAGGCCATCGAAGAGAAAAAATACCTAGCCGGGGCAGA
CCCTTCTACTGTGGAAATGTGTTACCCTCCTATCATTCAGAGTGGTGGCAACTACAATCTCAAGTTCAGTGTGGTGAGTGATAAAAATCATATGCATTTTGGAGCCATTACTTGTGCCATGGGCATTC
GCTTTAAATCATACTGCTCCAACCTTGTTCGCACTCTGATGGTTGACCCTACTCAGGAAGTTCAAGAAAATTACAACTTTTTACTTCAACTTCAAGAGGAGTTGCTAAAGGAATTAAGACATGGTGTG
AAGATATGTGATGTGTATAACTCTGTCATGGATGTGGTTAAGAAGCAGAAGCCAGAACTGCTGAACAAAATTACAAAAAACCTAGGATTTGGGATGGGAATTGAATTCCGTGAAGGCTCTCTAGTGAT
CAATAGTAAAAATCAGTACAAGCTAAAGAAAGGGATGGTTTTCAGCATCAACCTAGGATTTTCAGACCTGACTAACAAAGAAGGGAAAAAACCAGAAGAGAAAACCTATGCCCTGTTTATTGGTGACA
CTGTGCTTGTAGATGAGGATGGTCCAGCCACTGTCCTTACATCTGTGAAGAAGAAGGTAAAGAACGTGGGCATTTTCCTCAAGAATGAGGACGATGAGGAGGAGGAGGAGGAGAAAGATGAGGCGGAG
GACCTTTTGGGAAGAGGTTCTAGAGCAGCGTTACTTACTGAAAGAACACGGAATGAGATGACTGCAGAAGAGAAGCGAAGAGCCCATCAGAAGGAACTGGCAGCACAGCTCAACGAGGAAGCGAAGAG
GAGGCTGACAGAGCAGAAAGGGGAACAGCAGATTCAGAAGGCTCGAAAATCTAATGTGTCCTATAAAAACCCATCTCTGATGCCTAAGGAACCACATATTCGGGAAATGAAGATCTATATTGATAAGA
AATACGAGACTGTGATAATGCCTGTGTTTGGCATTGCCACACCCTTCCATATTGCCACAATCAAGAACATAAGTATGTCTGTCGAAGGAGACTATACTTACTTGCGAATCAACTTCTATTGTCCAGGA
AGTGCTCTGGGCAGGAACGAGGGCAACATCTTTCCTAACCCTGAAGCTACTTTTGTCAAGGAAATTACATACCGAGCTTCAAATATGAAAGCACCTGGGGAGCAGACTGTACCCGCCTTAAATCTTCA
GAATGCTTTTCGAATTATAAAAGAAGTGCAGAAACGTTACAAGACCAGAGAAGCTGAAGAGAAAGAAAAAGAGGGCATTGTAAAACAAGACTCACTGGTGATCAACCTAAACAGAAGTAATCCAAAGC
TGAAAGATCTATACATTCGCCCAAACATTGCCCAAAAGAGAATGCAAGGCTCCCTGGAGGCTCACGTCAATGGTTTCCGCTTCACATCTGTTCGAGGAGACAAGGTGGATATTTTGTACAATAATATC
AAGCACGCACTCTTCCAGCCCTGTGATGGCGAGATGATTATTGTTTTGCACTTTCACCTCAAGAATGCTATCATGTTCGGGAAGAAGCGGCACACAGACGTACAGTTCTACACAGAAGTTGGAGAGAT
CACTACAGATTTGGGGAAACATCAACACATGCATGACCGAGATGACCTATATGCTGAGCAGATGGAAAGAGAGATGAGACACAAACTGAAAACAGCCTTTAAGAACTTCATTGAAAAAGTAGAGGCTC
TAACAAAGGAGGAACTGGAGTTTGAAGTACCATTCAGGGATCTGGGGTTTAATGGGGCTCCCTACAGGAGTACCTGCCTCCTTCAGCCCACTAGTAGTGCACTGGTAAATGCTACAGAGTGGCCACCC
TTTGTGGTGACACTGGATGAAGTGGAGCTGATCCACTTTGAGAGGGTCCAATTTCACCTGAAGAACTTTGACATGGTGATTGTCTACAAGGATTACAGCAAGAAAGTCACGATGATCAACGCCATTCC
TGTTGCCTCTCTAGACCCCATCAAGGAGTGGCTAAATTCCTGTGACCTAAAGTACACAGAAGGTGTTCAGTCCCTCAACTGGACTAAAATCATGAAGACCATCGTTGACGACCCTGAAGGCTTCTTTG
AACAAGGTGGCTGGTCTTTCCTGGAACCTGAGGGTGAGGGCAGTGATGCTGAGGACGGGGACTCGGAGTCTGAAATTGAAGATGAGACCTTCAATCCTTCCGAGGATGACTATGAAGAGGAAGAAGAG
GACAGTGATGAAGACTATTCATCAGAAGCTGAAGAATCAGATTATTCTAAGGAATCTCTGGGAAGTGAAGAAGAAAGCGGGAAAGACTGGGATGAGCTAGAAGAAGAAGCACGAAAAGCGGACCGAGA
AAGCCGTTATGAGGAGGAGGAAGAACAGAGCCGAAGTATGAGCCGGAAGAGGAAGGCGTCTGTACATAGTTCAGGCCGTGGCTCTAACCGCGGTTCCAGACACAGCTCTGCACCCCCGAAGAAAAAGA
GAAAGTAATATGAACCTTGGGTCCTATGCTCCATTCTTTCTGCAAACAACTCCTAAAATGACATGACATAGAAACTGTTTTTCCTTTTGGTTCTGTTGAAGTTTTGCCGTTTGTGTTTATGGGTTTAG
GGGCCATTTGTGCGGACCAAGCTACTCGGGGAATTCCAGGCCTACCAGGACATGTGCCAGTGGCCCCGATCAGATGGCTGGCAAGGGAGGCGGTGTTGAAGGGCAGGAGGCTCCTCCCACTGTTGATA
CCATTTATTCTTTTCTTCTGACAACTTATCTTTGGTATCTCAAAGCTGAATTACCAAGACAGTGGTATGAGCTCACCACTATTTCTACTATGGTTCTTTTTTCTTTACTTTTTTATTTTTCCTGGCTT
TTTGAGACAGTCTTGCTATGCAGCCATGGCTGACCTTGAAGTCGATGTAAACCAGGCTAGCCTCAAATGTATGATCCTCTTACTCTGCCTCCCAAGTGCTGGGACTACAGGCCTGAGTCACCATACTT
AGCCAAAGCGTGGTTCTGGCCCAGAGTCAGTCCTCCATCCGTCCCTTTATCAGTTTGAGATCTGAAGTTCTCAAGAAGGTTCTTGGGTTTGCTGATGGTTGTGATAAGCACAGCTGAGCTAAAGGCAG
AGCGGGCTGGTGTCTGGTCTTAGGTTGTTCTGGTTTCTTGCCTGGTGCACATTCTGGGTGTTTTTGCTGCATTGGAAGACAAATACTGGCACTCCGTGGCTGGGTTTTTCCTCCTTACAAGTCCATAT
GTGGTACAGTGCTCGATCGCACATCACCACTGTCTCCTCTGATCCATCTAAGGAAGAATGGCCATGCCTCATCTGCTGCAGGTGAAATCTAGAGGGAGGCTTACAGGAGTCAACACGGATCTCGAAGA
GTAAGTCATGTCTTGGCCTAGAATATCTTGACAAGAAGAGAAGCAGGAAGAAGGCCACACCCACAAGGCTGGGCTCTGCTGCTCCTCCCTTTCCTTTGTCTGCAGTGTCCTGTGTCGGTTGCTTCTGA
TGATGAGCTTTAAGATACTGGGGGGCTCTCTCTTGCCGTCCTCCCCTGCAGGTTCTCTGCATCCACCTGTCCCACTTTGCCTCCTCTGTTCTGTACCTTTATGAGAAGGGGCTTCTCGGATTTTATGT
TTGTTTGTTTTCTCTCCTTAGCAGTAGGACTTGATATTTTGAATTTTGGAAGAACTAAAAGATAAATAAACTGGGATTTTTTTTGTTTTGTTTTGTTTTTTGT

hide sequence


Protein RefSeqs	NP_001100731	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL88471	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000016288
	ENSRNOP00000016288.4
	ENSRNOP00000076424.1
	ENSRNOP00000091739.1

RefSeq Acc Id:

NP_001100731 ⟸ NM_001107261

- UniProtKB:

A0A8I5ZJ57 (UniProtKB/TrEMBL), A6KEG6 (UniProtKB/TrEMBL), A0A8I6GJV6 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAVTLDKDAYYRRVKRLYSNWRKGEDEYASIDAIVVSVGVDEEIVYAKSTALQTWLFGYELTDTIMVFCDDKIIFMASKKKVEFLKQIANTKGNENANGAPAITLLVREKNESNKSSFDKMIEAIKES
KNGKKIGVFSKDKFPGEFMKSWSDCLNKEGFDKVDISAVVAYTIAVKEDGELNLMKKAASITSEVFNKFFKERVMEIVDADEKVRHSKLAESVEKAIEEKKYLAGADPSTVEMCYPPIIQSGGNYNLK
FSVVSDKNHMHFGAITCAMGIRFKSYCSNLVRTLMVDPTQEVQENYNFLLQLQEELLKELRHGVKICDVYNSVMDVVKKQKPELLNKITKNLGFGMGIEFREGSLVINSKNQYKLKKGMVFSINLGFS
DLTNKEGKKPEEKTYALFIGDTVLVDEDGPATVLTSVKKKVKNVGIFLKNEDDEEEEEEKDEAEDLLGRGSRAALLTERTRNEMTAEEKRRAHQKELAAQLNEEAKRRLTEQKGEQQIQKARKSNVSY
KNPSLMPKEPHIREMKIYIDKKYETVIMPVFGIATPFHIATIKNISMSVEGDYTYLRINFYCPGSALGRNEGNIFPNPEATFVKEITYRASNMKAPGEQTVPALNLQNAFRIIKEVQKRYKTREAEEK
EKEGIVKQDSLVINLNRSNPKLKDLYIRPNIAQKRMQGSLEAHVNGFRFTSVRGDKVDILYNNIKHALFQPCDGEMIIVLHFHLKNAIMFGKKRHTDVQFYTEVGEITTDLGKHQHMHDRDDLYAEQM
EREMRHKLKTAFKNFIEKVEALTKEELEFEVPFRDLGFNGAPYRSTCLLQPTSSALVNATEWPPFVVTLDEVELIHFERVQFHLKNFDMVIVYKDYSKKVTMINAIPVASLDPIKEWLNSCDLKYTEG
VQSLNWTKIMKTIVDDPEGFFEQGGWSFLEPEGEGSDAEDGDSESEIEDETFNPSEDDYEEEEEDSDEDYSSEAEESDYSKESLGSEEESGKDWDELEEEARKADRESRYEEEEEQSRSMSRKRKASV
HSSGRGSNRGSRHSSAPPKKKRK

hide sequence

Ensembl Acc Id:

ENSRNOP00000016288 ⟸ ENSRNOT00000016288

Ensembl Acc Id:

ENSRNOP00000091739 ⟸ ENSRNOT00000116098

Ensembl Acc Id:

ENSRNOP00000076424 ⟸ ENSRNOT00000111950

Protein Domains

FACT complex subunit Spt16 FACT complex subunit Spt16 N-terminal lobe Histone chaperone RTT106/FACT complex subunit SPT16-

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4A4J0-F1-model_v2	AlphaFold	D4A4J0	1-1047	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13699636

Promoter ID:

EPDNEW_R10160

Type:

multiple initiation site

Name:

Supt16h_1

Description:

SPT16 homolog, facilitates chromatin remodeling subunit

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	15	28,611,985 - 28,612,045	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-13985	BioCyc
Ensembl Genes	ENSRNOG00000011953	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000016288	ENTREZGENE
	ENSRNOT00000016288.6	UniProtKB/TrEMBL
	ENSRNOT00000111950.1	UniProtKB/TrEMBL
	ENSRNOT00000116098.1	UniProtKB/TrEMBL
Gene3D-CATH	2.30.29.150	UniProtKB/TrEMBL
	2.30.29.30	UniProtKB/TrEMBL
	3.40.350.10	UniProtKB/TrEMBL
	3.90.230.10	UniProtKB/TrEMBL
	FACT complex subunit Spt16p/Cdc68p	UniProtKB/TrEMBL
InterPro	Creatin/AminoP/Spt16_NTD	UniProtKB/TrEMBL
	Creatinase/aminopeptidase-like	UniProtKB/TrEMBL
	DUF1747_euk	UniProtKB/TrEMBL
	FACT-Spt16_Nlobe	UniProtKB/TrEMBL
	FACT_Spt16p	UniProtKB/TrEMBL
	Pept_M24_structural-domain	UniProtKB/TrEMBL
	PH-like_dom_sf	UniProtKB/TrEMBL
	SPT16	UniProtKB/TrEMBL
	Spt16	UniProtKB/TrEMBL
	SPT16_C	UniProtKB/TrEMBL
KEGG Report	rno:305851	UniProtKB/TrEMBL
NCBI Gene	305851	ENTREZGENE
PANTHER	FACT COMPLEX SUBUNIT SPT16	UniProtKB/TrEMBL
	PTHR13980	UniProtKB/TrEMBL
Pfam	FACT-Spt16_Nlob	UniProtKB/TrEMBL
	Peptidase_M24	UniProtKB/TrEMBL
	Rtt106	UniProtKB/TrEMBL
	SPT16	UniProtKB/TrEMBL
	SPT16_C	UniProtKB/TrEMBL
PhenoGen	Supt16h	PhenoGen
RatGTEx	ENSRNOG00000011953	RatGTEx
SMART	FACT-Spt16_Nlob	UniProtKB/TrEMBL
	Rtt106	UniProtKB/TrEMBL
	SPT16	UniProtKB/TrEMBL
Superfamily-SCOP	Peptidase_M24_cat_core	UniProtKB/TrEMBL
UniProt	A0A8I5ZJ57	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6GJV6	ENTREZGENE, UniProtKB/TrEMBL
	A6KEG6	ENTREZGENE, UniProtKB/TrEMBL
	D4A4J0_RAT	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-10-01	Supt16h	SPT16 homolog, facilitates chromatin remodeling subunit	Supt16h	suppressor of Ty 16 homolog (S. cerevisiae)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Supt16h	suppressor of Ty 16 homolog (S. cerevisiae)	Supt16h_predicted	suppressor of Ty 16 homolog (S. cerevisiae) (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Supt16h_predicted	suppressor of Ty 16 homolog (S. cerevisiae) (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

RGD Manual Annotations