Advanced Search (OLGA)

Gene: Ngef (neuronal guanine nucleotide exchange factor) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Ngef

Name:

neuronal guanine nucleotide exchange factor

RGD ID:

1309055

Description:

Predicted to enable ephrin receptor binding activity and guanyl-nucleotide exchange factor activity. Predicted to be involved in ephrin receptor signaling pathway; regulation of actin cytoskeleton organization; and regulation of synapse organization. Is active in postsynapse. Orthologous to human NGEF (neuronal guanine nucleotide exchange factor); PARTICIPATES IN ephrin - ephrin receptor bidirectional signaling axis; INTERACTS WITH (+)-schisandrin B; 1,2-dimethylhydrazine; 17beta-estradiol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

Besh3; brain-enriched SH3-domain protein Besh3; eph-interacting exchange protein; ephexin-1; LOC360451

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	95,594,823 - 95,692,381 (-)	NCBI		GRCr8
mRatBN7.2	9	88,146,956 - 88,244,454 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	88,146,956 - 88,244,914 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	9	96,571,300 - 96,604,706 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	101,707,380 - 101,740,785 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	100,075,202 - 100,108,621 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	94,569,286 - 94,601,852 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	94,569,286 - 94,601,852 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	9	94,290,729 - 94,323,295 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	9	86,294,206 - 86,327,765 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	9	85,556,597 - 85,590,171 (-)	NCBI		Celera
Cytogenetic Map	9	q35	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ngef	Rat	Joubert syndrome 22		ISO	NGEF (Homo sapiens)	8554872	ClinVar Annotator: match by term: Joubert syndrome 22	ClinVar	PMID:28492532
Ngef	Rat	Perlman syndrome		ISO	NGEF (Homo sapiens)	8554872	ClinVar Annotator: match by term: Perlman syndrome	ClinVar	PMID:28492532

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ngef	Rat	(+)-schisandrin B	multiple interactions	EXP		6480464	schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of NGEF mRNA]	CTD	PMID:31150632
Ngef	Rat	1,1-dichloroethene	decreases expression	ISO	Ngef (Mus musculus)	6480464	vinylidene chloride results in decreased expression of NGEF mRNA	CTD	PMID:26682919
Ngef	Rat	1,2-dimethylhydrazine	multiple interactions	EXP		6480464	[APC protein affects the susceptibility to 1 and 2-Dimethylhydrazine] which results in decreased expression of NGEF mRNA	CTD	PMID:27840820
Ngef	Rat	17beta-estradiol	multiple interactions	EXP		6480464	[bisphenol A co-treated with Estradiol] results in increased expression of NGEF mRNA	CTD	PMID:26496021
Ngef	Rat	17beta-estradiol	decreases expression	ISO	Ngef (Mus musculus)	6480464	Estradiol results in decreased expression of NGEF mRNA	CTD	PMID:39298647
Ngef	Rat	17beta-estradiol	increases expression	ISO	Ngef (Mus musculus)	6480464	Estradiol results in increased expression of NGEF mRNA	CTD	PMID:19484750
Ngef	Rat	17beta-estradiol	affects expression	ISO	Ngef (Mus musculus)	6480464	Estradiol affects the expression of NGEF mRNA	CTD	PMID:15598610
Ngef	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of NGEF mRNA	CTD	PMID:21215274
Ngef	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Ngef (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of NGEF mRNA	CTD	PMID:28922406
Ngef	Rat	2-amino-2-deoxy-D-glucopyranose	increases expression	ISO	Ngef (Mus musculus)	6480464	Glucosamine results in increased expression of NGEF mRNA	CTD	PMID:17178593
Ngef	Rat	3,3',4,4'-tetrachlorobiphenyl	multiple interactions	ISO	Ngef (Mus musculus)	6480464	3 more ...	CTD	PMID:19467301
Ngef	Rat	4,4'-sulfonyldiphenol	decreases expression	ISO	Ngef (Mus musculus)	6480464	bisphenol S results in decreased expression of NGEF mRNA	CTD	PMID:30951980 and PMID:39298647
Ngef	Rat	4,4'-sulfonyldiphenol	affects methylation	ISO	Ngef (Mus musculus)	6480464	bisphenol S affects the methylation of NGEF gene	CTD	PMID:31683443
Ngef	Rat	4,4'-sulfonyldiphenol	decreases methylation	ISO	Ngef (Mus musculus)	6480464	bisphenol S results in decreased methylation of NGEF exon	CTD	PMID:33297965
Ngef	Rat	4-hydroxyphenyl retinamide	increases expression	ISO	Ngef (Mus musculus)	6480464	Fenretinide results in increased expression of NGEF mRNA	CTD	PMID:28973697
Ngef	Rat	6-propyl-2-thiouracil	increases expression	EXP		6480464	Propylthiouracil results in increased expression of NGEF mRNA	CTD	PMID:30047161
Ngef	Rat	8-Br-cAMP	increases expression	ISO	NGEF (Homo sapiens)	6480464	8-Bromo Cyclic Adenosine Monophosphate results in increased expression of NGEF mRNA	CTD	PMID:22079614
Ngef	Rat	acetamide	increases expression	EXP		6480464	acetamide results in increased expression of NGEF mRNA	CTD	PMID:31881176
Ngef	Rat	acrylamide	decreases expression	EXP		6480464	Acrylamide results in decreased expression of NGEF mRNA	CTD	PMID:28959563
Ngef	Rat	aflatoxin B1	affects expression	ISO	NGEF (Homo sapiens)	6480464	Aflatoxin B1 affects the expression of NGEF protein	CTD	PMID:20106945
Ngef	Rat	aflatoxin B1	decreases methylation	ISO	NGEF (Homo sapiens)	6480464	Aflatoxin B1 results in decreased methylation of NGEF gene and Aflatoxin B1 results in decreased methylation of NGEF intron	CTD	PMID:27153756 and PMID:30157460
Ngef	Rat	aflatoxin B1	decreases expression	ISO	NGEF (Homo sapiens)	6480464	Aflatoxin B1 results in decreased expression of NGEF mRNA	CTD	PMID:21641981 and PMID:22100608
Ngef	Rat	aldehydo-D-glucosamine	increases expression	ISO	Ngef (Mus musculus)	6480464	Glucosamine results in increased expression of NGEF mRNA	CTD	PMID:17178593
Ngef	Rat	amitrole	increases expression	EXP		6480464	Amitrole results in increased expression of NGEF mRNA	CTD	PMID:30047161
Ngef	Rat	ammonium chloride	affects expression	EXP		6480464	Ammonium Chloride affects the expression of NGEF mRNA	CTD	PMID:16483693
Ngef	Rat	amosite asbestos	decreases methylation	ISO	NGEF (Homo sapiens)	6480464	Asbestos and Amosite results in decreased methylation of NGEF promoter	CTD	PMID:29626692
Ngef	Rat	aristolochic acid A	increases expression	ISO	NGEF (Homo sapiens)	6480464	aristolochic acid I results in increased expression of NGEF mRNA	CTD	PMID:33212167
Ngef	Rat	arsane	affects methylation	ISO	NGEF (Homo sapiens)	6480464	Arsenic affects the methylation of NGEF gene	CTD	PMID:25304211
Ngef	Rat	arsane	multiple interactions	ISO	NGEF (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of NGEF mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of NGEF mRNA	CTD	PMID:39836092
Ngef	Rat	arsenic atom	affects methylation	ISO	NGEF (Homo sapiens)	6480464	Arsenic affects the methylation of NGEF gene	CTD	PMID:25304211
Ngef	Rat	arsenic atom	multiple interactions	ISO	NGEF (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of NGEF mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of NGEF mRNA	CTD	PMID:39836092
Ngef	Rat	arsenite(3-)	increases expression	ISO	Ngef (Mus musculus)	6480464	arsenite results in increased expression of NGEF mRNA	CTD	PMID:33053406
Ngef	Rat	belinostat	multiple interactions	ISO	NGEF (Homo sapiens)	6480464	[NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of NGEF mRNA	CTD	PMID:27188386
Ngef	Rat	benzo[a]pyrene	increases mutagenesis	ISO	NGEF (Homo sapiens)	6480464	Benzo(a)pyrene results in increased mutagenesis of NGEF gene	CTD	PMID:25435355
Ngef	Rat	benzo[a]pyrene	affects methylation	ISO	NGEF (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of NGEF 5' UTR and Benzo(a)pyrene affects the methylation of NGEF promoter	CTD	PMID:27901495
Ngef	Rat	benzo[a]pyrene	increases methylation	ISO	NGEF (Homo sapiens)	6480464	Benzo(a)pyrene results in increased methylation of NGEF exon	CTD	PMID:27901495
Ngef	Rat	benzo[a]pyrene	decreases expression	ISO	NGEF (Homo sapiens)	6480464	Benzo(a)pyrene results in decreased expression of NGEF mRNA	CTD	PMID:20106945 more ...
Ngef	Rat	benzo[a]pyrene	increases expression	ISO	Ngef (Mus musculus)	6480464	Benzo(a)pyrene results in increased expression of NGEF mRNA	CTD	PMID:23735875
Ngef	Rat	benzo[a]pyrene	decreases expression	EXP		6480464	Benzo(a)pyrene results in decreased expression of NGEF mRNA	CTD	PMID:21839799
Ngef	Rat	benzo[a]pyrene diol epoxide I	decreases expression	ISO	NGEF (Homo sapiens)	6480464	7 more ...	CTD	PMID:26238291
Ngef	Rat	beta-D-glucosamine	increases expression	ISO	Ngef (Mus musculus)	6480464	Glucosamine results in increased expression of NGEF mRNA	CTD	PMID:17178593
Ngef	Rat	beta-lapachone	increases expression	ISO	NGEF (Homo sapiens)	6480464	beta-lapachone results in increased expression of NGEF mRNA	CTD	PMID:38218311
Ngef	Rat	bisphenol A	multiple interactions	EXP		6480464	[bisphenol A co-treated with Estradiol] results in increased expression of NGEF mRNA	CTD	PMID:26496021
Ngef	Rat	bisphenol A	multiple interactions	ISO	NGEF (Homo sapiens)	6480464	[bisphenol A co-treated with Fulvestrant] results in decreased methylation of NGEF gene	CTD	PMID:31601247
Ngef	Rat	bisphenol A	decreases methylation	ISO	NGEF (Homo sapiens)	6480464	bisphenol A results in decreased methylation of NGEF gene	CTD	PMID:31601247
Ngef	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of NGEF mRNA	CTD	PMID:25181051 more ...
Ngef	Rat	bisphenol F	decreases expression	ISO	Ngef (Mus musculus)	6480464	bisphenol F results in decreased expression of NGEF mRNA	CTD	PMID:30951980 and PMID:38685157
Ngef	Rat	butanal	increases expression	ISO	NGEF (Homo sapiens)	6480464	butyraldehyde results in increased expression of NGEF mRNA	CTD	PMID:26079696
Ngef	Rat	carbon nanotube	decreases expression	ISO	Ngef (Mus musculus)	6480464	Nanotubes more ...	CTD	PMID:25554681 and PMID:25620056
Ngef	Rat	carmustine	decreases expression	EXP		6480464	Carmustine results in decreased expression of NGEF mRNA	CTD	PMID:16005536
Ngef	Rat	CGP 52608	multiple interactions	ISO	NGEF (Homo sapiens)	6480464	CGP 52608 promotes the reaction [RORA protein binds to NGEF gene]	CTD	PMID:28238834
Ngef	Rat	choline	multiple interactions	ISO	Ngef (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of NGEF gene	CTD	PMID:20938992
Ngef	Rat	cisplatin	multiple interactions	ISO	NGEF (Homo sapiens)	6480464	[Cisplatin co-treated with jinfukang] results in decreased expression of NGEF mRNA	CTD	PMID:27392435
Ngef	Rat	cisplatin	decreases expression	ISO	NGEF (Homo sapiens)	6480464	Cisplatin results in decreased expression of NGEF mRNA	CTD	PMID:27392435
Ngef	Rat	clofibrate	decreases expression	ISO	Ngef (Mus musculus)	6480464	Clofibrate results in decreased expression of NGEF mRNA	CTD	PMID:23811191
Ngef	Rat	clothianidin	increases expression	ISO	NGEF (Homo sapiens)	6480464	clothianidin results in increased expression of NGEF mRNA	CTD	PMID:31626844
Ngef	Rat	cobalt dichloride	decreases expression	EXP		6480464	cobaltous chloride results in decreased expression of NGEF mRNA	CTD	PMID:24386269
Ngef	Rat	copper(II) sulfate	decreases expression	ISO	NGEF (Homo sapiens)	6480464	Copper Sulfate results in decreased expression of NGEF mRNA	CTD	PMID:19549813
Ngef	Rat	crocidolite asbestos	decreases methylation	ISO	NGEF (Homo sapiens)	6480464	Asbestos and Crocidolite results in decreased methylation of NGEF promoter	CTD	PMID:29626692
Ngef	Rat	Cuprizon	decreases expression	EXP		6480464	Cuprizone results in decreased expression of NGEF mRNA	CTD	PMID:26577399
Ngef	Rat	cyclosporin A	decreases expression	ISO	NGEF (Homo sapiens)	6480464	Cyclosporine results in decreased expression of NGEF mRNA	CTD	PMID:20106945
Ngef	Rat	cyclosporin A	decreases expression	ISO	Ngef (Mus musculus)	6480464	Cyclosporine results in decreased expression of NGEF mRNA	CTD	PMID:19770486
Ngef	Rat	daunorubicin	affects response to substance	ISO	NGEF (Homo sapiens)	6480464	NGEF affects the susceptibility to Daunorubicin	CTD	PMID:17545624
Ngef	Rat	DDE	increases expression	ISO	NGEF (Homo sapiens)	6480464	Dichlorodiphenyl Dichloroethylene results in increased expression of NGEF mRNA	CTD	PMID:38568856
Ngef	Rat	dibenz[a,h]anthracene	increases expression	ISO	Ngef (Mus musculus)	6480464	1 more ...	CTD	PMID:26377693
Ngef	Rat	diethylstilbestrol	decreases expression	ISO	NGEF (Homo sapiens)	6480464	Diethylstilbestrol results in decreased expression of NGEF mRNA	CTD	PMID:19371625
Ngef	Rat	dorsomorphin	multiple interactions	ISO	NGEF (Homo sapiens)	6480464	[NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ...	CTD	PMID:27188386
Ngef	Rat	endosulfan	decreases expression	EXP		6480464	Endosulfan results in decreased expression of NGEF mRNA	CTD	PMID:29391264
Ngef	Rat	entinostat	increases expression	ISO	NGEF (Homo sapiens)	6480464	entinostat results in increased expression of NGEF mRNA	CTD	PMID:26272509 and PMID:27188386
Ngef	Rat	entinostat	multiple interactions	ISO	NGEF (Homo sapiens)	6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of NGEF mRNA	CTD	PMID:27188386
Ngef	Rat	epoxiconazole	decreases expression	ISO	Ngef (Mus musculus)	6480464	epoxiconazole results in decreased expression of NGEF mRNA	CTD	PMID:35436446
Ngef	Rat	ethanol	decreases expression	ISO	Ngef (Mus musculus)	6480464	Ethanol results in decreased expression of NGEF mRNA	CTD	PMID:34755883
Ngef	Rat	flavonoids	decreases expression	EXP		6480464	Flavonoids results in decreased expression of NGEF mRNA	CTD	PMID:18035473
Ngef	Rat	folic acid	multiple interactions	ISO	Ngef (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of NGEF gene	CTD	PMID:20938992
Ngef	Rat	fonofos	increases methylation	ISO	NGEF (Homo sapiens)	6480464	Fonofos results in increased methylation of NGEF promoter	CTD	PMID:22847954
Ngef	Rat	fulvestrant	multiple interactions	ISO	NGEF (Homo sapiens)	6480464	[bisphenol A co-treated with Fulvestrant] results in decreased methylation of NGEF gene	CTD	PMID:31601247
Ngef	Rat	genistein	decreases expression	ISO	Ngef (Mus musculus)	6480464	Genistein results in decreased expression of NGEF mRNA	CTD	PMID:32186404
Ngef	Rat	gentamycin	increases expression	EXP		6480464	Gentamicins results in increased expression of NGEF mRNA	CTD	PMID:33387578
Ngef	Rat	glafenine	decreases expression	EXP		6480464	Glafenine results in decreased expression of NGEF mRNA	CTD	PMID:24136188
Ngef	Rat	L-methionine	multiple interactions	ISO	Ngef (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of NGEF gene	CTD	PMID:20938992
Ngef	Rat	lead(0)	affects expression	ISO	NGEF (Homo sapiens)	6480464	Lead affects the expression of NGEF mRNA	CTD	PMID:28903495
Ngef	Rat	lipopolysaccharide	multiple interactions	ISO	NGEF (Homo sapiens)	6480464	[S-(1 and 2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in decreased expression of NGEF mRNA	CTD	PMID:35811015
Ngef	Rat	manganese atom	multiple interactions	ISO	NGEF (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of NGEF mRNA	CTD	PMID:39836092
Ngef	Rat	manganese(0)	multiple interactions	ISO	NGEF (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of NGEF mRNA	CTD	PMID:39836092
Ngef	Rat	manganese(II) chloride	multiple interactions	ISO	NGEF (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of NGEF mRNA	CTD	PMID:39836092
Ngef	Rat	methimazole	increases expression	EXP		6480464	Methimazole results in increased expression of NGEF mRNA	CTD	PMID:30047161
Ngef	Rat	methotrexate	decreases expression	EXP		6480464	Methotrexate results in decreased expression of NGEF mRNA	CTD	PMID:16005536
Ngef	Rat	methylmercury chloride	decreases expression	ISO	NGEF (Homo sapiens)	6480464	methylmercuric chloride results in decreased expression of NGEF mRNA	CTD	PMID:28001369
Ngef	Rat	p-toluidine	increases expression	EXP		6480464	4-toluidine results in increased expression of NGEF mRNA	CTD	PMID:27638505
Ngef	Rat	panobinostat	increases expression	ISO	NGEF (Homo sapiens)	6480464	panobinostat results in increased expression of NGEF mRNA	CTD	PMID:26272509
Ngef	Rat	panobinostat	multiple interactions	ISO	NGEF (Homo sapiens)	6480464	[NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of NGEF mRNA	CTD	PMID:27188386
Ngef	Rat	paracetamol	decreases expression	ISO	NGEF (Homo sapiens)	6480464	Acetaminophen results in decreased expression of NGEF mRNA	CTD	PMID:21420995 and PMID:29067470
Ngef	Rat	paracetamol	affects expression	ISO	Ngef (Mus musculus)	6480464	Acetaminophen affects the expression of NGEF mRNA	CTD	PMID:17562736
Ngef	Rat	paraquat	decreases expression	EXP		6480464	Paraquat results in decreased expression of NGEF mRNA	CTD	PMID:32680482
Ngef	Rat	parathion	increases methylation	ISO	NGEF (Homo sapiens)	6480464	Parathion results in increased methylation of NGEF promoter	CTD	PMID:22847954
Ngef	Rat	pentanal	increases expression	ISO	NGEF (Homo sapiens)	6480464	pentanal results in increased expression of NGEF mRNA	CTD	PMID:26079696
Ngef	Rat	perfluorooctane-1-sulfonic acid	decreases expression	EXP		6480464	perfluorooctane sulfonic acid results in decreased expression of NGEF mRNA	CTD	PMID:18692542
Ngef	Rat	phenformin	decreases expression	EXP		6480464	Phenformin results in decreased expression of NGEF mRNA	CTD	PMID:31324951
Ngef	Rat	phenobarbital	increases expression	ISO	Ngef (Mus musculus)	6480464	Phenobarbital results in increased expression of NGEF mRNA	CTD	PMID:19270015
Ngef	Rat	phenylmercury acetate	multiple interactions	ISO	NGEF (Homo sapiens)	6480464	[NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of NGEF mRNA	CTD	PMID:27188386
Ngef	Rat	pirinixic acid	multiple interactions	ISO	Ngef (Mus musculus)	6480464	[pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of NGEF mRNA	CTD	PMID:19710929
Ngef	Rat	pirinixic acid	decreases expression	ISO	Ngef (Mus musculus)	6480464	pirinixic acid results in decreased expression of NGEF mRNA	CTD	PMID:18445702
Ngef	Rat	propanal	increases expression	ISO	NGEF (Homo sapiens)	6480464	propionaldehyde results in increased expression of NGEF mRNA	CTD	PMID:26079696
Ngef	Rat	propiconazole	decreases expression	ISO	Ngef (Mus musculus)	6480464	propiconazole results in decreased expression of NGEF mRNA	CTD	PMID:21278054
Ngef	Rat	quercetin	decreases expression	ISO	NGEF (Homo sapiens)	6480464	Quercetin results in decreased expression of NGEF mRNA	CTD	PMID:21632981
Ngef	Rat	S-(1,2-dichlorovinyl)-L-cysteine	multiple interactions	ISO	NGEF (Homo sapiens)	6480464	[S-(1 and 2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in decreased expression of NGEF mRNA	CTD	PMID:35811015
Ngef	Rat	SB 431542	multiple interactions	ISO	NGEF (Homo sapiens)	6480464	[NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ...	CTD	PMID:27188386
Ngef	Rat	silicon dioxide	decreases expression	ISO	Ngef (Mus musculus)	6480464	Silicon Dioxide results in decreased expression of NGEF mRNA	CTD	PMID:23221170
Ngef	Rat	sodium arsenite	increases expression	ISO	Ngef (Mus musculus)	6480464	sodium arsenite results in increased expression of NGEF mRNA	CTD	PMID:16014739
Ngef	Rat	sodium arsenite	multiple interactions	ISO	NGEF (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of NGEF mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of NGEF mRNA	CTD	PMID:39836092
Ngef	Rat	sodium arsenite	decreases expression	ISO	Ngef (Mus musculus)	6480464	sodium arsenite results in decreased expression of NGEF mRNA	CTD	PMID:37682722
Ngef	Rat	sodium arsenite	decreases expression	ISO	NGEF (Homo sapiens)	6480464	sodium arsenite results in decreased expression of NGEF mRNA	CTD	PMID:38568856
Ngef	Rat	sodium dichromate	affects expression	EXP		6480464	sodium bichromate affects the expression of NGEF mRNA	CTD	PMID:22110744
Ngef	Rat	sotorasib	multiple interactions	ISO	NGEF (Homo sapiens)	6480464	[sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in decreased expression of NGEF mRNA	CTD	PMID:36139627
Ngef	Rat	sulfadimethoxine	increases expression	EXP		6480464	Sulfadimethoxine results in increased expression of NGEF mRNA	CTD	PMID:30047161
Ngef	Rat	tamoxifen	affects expression	ISO	Ngef (Mus musculus)	6480464	Tamoxifen affects the expression of NGEF mRNA	CTD	PMID:20937368
Ngef	Rat	temozolomide	decreases expression	ISO	NGEF (Homo sapiens)	6480464	Temozolomide results in decreased expression of NGEF mRNA	CTD	PMID:31758290
Ngef	Rat	terbufos	increases methylation	ISO	NGEF (Homo sapiens)	6480464	terbufos results in increased methylation of NGEF promoter	CTD	PMID:22847954
Ngef	Rat	tetrachloromethane	multiple interactions	EXP		6480464	schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of NGEF mRNA]	CTD	PMID:31150632
Ngef	Rat	tetrachloromethane	decreases expression	ISO	Ngef (Mus musculus)	6480464	Carbon Tetrachloride results in decreased expression of NGEF mRNA	CTD	PMID:31919559
Ngef	Rat	tetrachloromethane	decreases expression	EXP		6480464	Carbon Tetrachloride results in decreased expression of NGEF mRNA	CTD	PMID:31150632
Ngef	Rat	thioacetamide	decreases expression	EXP		6480464	Thioacetamide results in decreased expression of NGEF mRNA	CTD	PMID:34492290
Ngef	Rat	tioguanine	decreases expression	EXP		6480464	Thioguanine results in decreased expression of NGEF mRNA	CTD	PMID:16005536
Ngef	Rat	titanium dioxide	decreases methylation	ISO	Ngef (Mus musculus)	6480464	titanium dioxide results in decreased methylation of NGEF gene	CTD	PMID:35295148
Ngef	Rat	trametinib	multiple interactions	ISO	NGEF (Homo sapiens)	6480464	[sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in decreased expression of NGEF mRNA	CTD	PMID:36139627
Ngef	Rat	tributylstannane	increases expression	ISO	Ngef (Mus musculus)	6480464	tributyltin results in increased expression of NGEF mRNA	CTD	PMID:31939706
Ngef	Rat	triptonide	affects expression	ISO	Ngef (Mus musculus)	6480464	triptonide affects the expression of NGEF mRNA	CTD	PMID:33045310
Ngef	Rat	troglitazone	decreases expression	ISO	Ngef (Mus musculus)	6480464	troglitazone results in decreased expression of NGEF mRNA	CTD	PMID:28973697
Ngef	Rat	urethane	decreases expression	ISO	NGEF (Homo sapiens)	6480464	Urethane results in decreased expression of NGEF mRNA	CTD	PMID:28818685
Ngef	Rat	valproic acid	decreases expression	ISO	NGEF (Homo sapiens)	6480464	Valproic Acid results in decreased expression of NGEF mRNA	CTD	PMID:29154799 and PMID:29501571
Ngef	Rat	valproic acid	affects methylation	ISO	NGEF (Homo sapiens)	6480464	Valproic Acid affects the methylation of NGEF gene	CTD	PMID:29501571
Ngef	Rat	valproic acid	increases expression	ISO	NGEF (Homo sapiens)	6480464	Valproic Acid results in increased expression of NGEF mRNA	CTD	PMID:23179753 more ...
Ngef	Rat	valproic acid	multiple interactions	ISO	NGEF (Homo sapiens)	6480464	[NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of NGEF mRNA	CTD	PMID:27188386
Ngef	Rat	valproic acid	increases expression	ISO	Ngef (Mus musculus)	6480464	Valproic Acid results in increased expression of NGEF mRNA	CTD	PMID:21427059
Ngef	Rat	valproic acid	affects expression	ISO	Ngef (Mus musculus)	6480464	Valproic Acid affects the expression of NGEF mRNA	CTD	PMID:17963808
Ngef	Rat	valproic acid	increases methylation	ISO	NGEF (Homo sapiens)	6480464	Valproic Acid results in increased methylation of NGEF gene	CTD	PMID:29154799
Ngef	Rat	valproic acid	affects expression	ISO	NGEF (Homo sapiens)	6480464	Valproic Acid affects the expression of NGEF mRNA and Valproic Acid affects the expression of NGEF protein	CTD	PMID:25979313 and PMID:29501571
Ngef	Rat	zearalenone	decreases expression	ISO	NGEF (Homo sapiens)	6480464	Zearalenone results in decreased expression of NGEF mRNA	CTD	PMID:19371625

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ngef	Rat	cell differentiation	involved_in	IEA	UniProtKB-KW:KW-0221	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ngef	Rat	ephrin receptor signaling pathway	involved_in	ISS	UniProtKB:Q8CHT1	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Ngef	Rat	ephrin receptor signaling pathway	involved_in	ISO	Ngef (Mus musculus)	1624291	PMID:17143272	RGD	PMID:17143272
Ngef	Rat	ephrin receptor signaling pathway	involved_in	IEA	UniProtKB:Q8CHT1 and ensembl:ENSMUSP00000027477	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ngef	Rat	negative regulation of dendritic spine morphogenesis	involved_in	ISS	UniProtKB:Q8CHT1	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Ngef	Rat	negative regulation of dendritic spine morphogenesis	involved_in	IEA	UniProtKB:Q8CHT1 and ensembl:ENSMUSP00000027477	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ngef	Rat	negative regulation of dendritic spine morphogenesis	involved_in	ISO	Ngef (Mus musculus)	1624291	PMID:17143272	RGD	PMID:17143272
Ngef	Rat	nervous system development	involved_in	IEA	UniProtKB-KW:KW-0524	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ngef	Rat	regulation of actin cytoskeleton organization	involved_in	IBA	PANTHER:PTN002656129 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Ngef	Rat	regulation of synapse pruning	involved_in	ISO	Ngef (Mus musculus)	1624291	PMID:17143272	RGD	PMID:17143272
Ngef	Rat	regulation of synapse pruning	involved_in	IEA	UniProtKB:Q8CHT1 and ensembl:ENSMUSP00000027477	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ngef	Rat	cell projection	located_in	IEA	UniProtKB-SubCell:SL-0280	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Ngef	Rat	cell projection	located_in	IEA	UniProtKB-KW:KW-0966	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ngef	Rat	cytoplasm	located_in	IEA	UniProtKB-KW:KW-0963	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ngef	Rat	cytoplasm	located_in	IEA	UniProtKB-SubCell:SL-0086	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Ngef	Rat	glutamatergic synapse	is_active_in	ISO	Ngef (Mus musculus)	1624291	PMID:17143272	RGD	PMID:17143272
Ngef	Rat	glutamatergic synapse	is_active_in	IEA	UniProtKB:Q8CHT1 and ensembl:ENSMUSP00000027477	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ngef	Rat	growth cone	located_in	IEA	UniProtKB-SubCell:SL-0288	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Ngef	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ngef	Rat	membrane	located_in	IEA	UniProtKB-SubCell:SL-0162	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Ngef	Rat	postsynapse	is_active_in	IDA		8554385	PMID:17143272	SynGO

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ngef	Rat	ephrin receptor binding	enables	ISO	Ngef (Mus musculus)	1624291	UniProtKB:Q03137 and PMID:17143272	RGD	PMID:17143272
Ngef	Rat	ephrin receptor binding	enables	IEA	UniProtKB:Q8CHT1 and ensembl:ENSMUSP00000027477	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ngef	Rat	guanyl-nucleotide exchange factor activity	enables	ISO	NGEF (Homo sapiens)	1624291	PMID:15848799	RGD	PMID:15848799
Ngef	Rat	guanyl-nucleotide exchange factor activity	enables	IEA	UniProtKB-KW:KW-0344	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ngef	Rat	guanyl-nucleotide exchange factor activity	enables	IEA	InterPro:IPR000219 and InterPro:IPR047271	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Ngef	Rat	protein binding	enables	ISO	NGEF (Homo sapiens)	1624291	UniProtKB:O60333-2 more ...	RGD	PMID:32814053
Ngef	Rat	protein binding	enables	ISO	Ngef (Mus musculus)	1624291	UniProtKB:P61809 and PMID:17143272	RGD	PMID:17143272

Imported Annotations - PID (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ngef	Rat	ephrin - ephrin receptor bidirectional signaling axis		ISO	NGEF (Homo sapiens)	6484113		PID	PID:200142

#	Reference Title	Reference Citation
1.	Cdk5 regulates EphA4-mediated dendritic spine retraction through an ephexin1-dependent mechanism.	Fu WY, etal., Nat Neurosci. 2007 Jan;10(1):67-76. Epub 2006 Dec 3.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
4.	GOA pipeline	RGD automated data pipeline
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
6.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

PMID:10777665	PMID:11336673	PMID:15057822	PMID:15489334	PMID:15848799	PMID:20949525	PMID:22871113

Ngef
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	95,594,823 - 95,692,381 (-)	NCBI		GRCr8
mRatBN7.2	9	88,146,956 - 88,244,454 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	88,146,956 - 88,244,914 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	9	96,571,300 - 96,604,706 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	101,707,380 - 101,740,785 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	100,075,202 - 100,108,621 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	94,569,286 - 94,601,852 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	94,569,286 - 94,601,852 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	9	94,290,729 - 94,323,295 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	9	86,294,206 - 86,327,765 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	9	85,556,597 - 85,590,171 (-)	NCBI		Celera
Cytogenetic Map	9	q35	NCBI

NGEF
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	232,878,701 - 233,013,256 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	232,878,701 - 233,013,256 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	233,743,411 - 233,877,966 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	233,451,655 - 233,586,182 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	2	227,507,672 - 227,643,202 (-)	NCBI		Celera
Cytogenetic Map	2	q37.1	NCBI
HuRef	2	225,592,253 - 225,726,431 (-)	NCBI		HuRef
CHM1_1	2	233,749,324 - 233,883,758 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	2	233,365,384 - 233,500,670 (-)	NCBI		T2T-CHM13v2.0

Ngef
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	87,404,551 - 87,501,661 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	87,404,556 - 87,501,592 (-)	Ensembl		GRCm39 Ensembl
GRCm38	1	87,476,829 - 87,573,870 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	87,476,834 - 87,573,870 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	1	89,373,404 - 89,470,445 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	1	89,308,005 - 89,341,517 (-)	NCBI		MGSCv36	mm8
Celera	1	90,442,498 - 90,539,911 (-)	NCBI		Celera
Cytogenetic Map	1	D	NCBI
cM Map	1	44.42	NCBI

Ngef
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955453	3,082,628 - 3,186,039 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955453	3,082,826 - 3,186,039 (+)	NCBI	ChiLan1.0	ChiLan1.0

NGEF
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	13	135,484,267 - 135,527,795 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2B	135,499,232 - 135,542,753 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2B	120,110,441 - 120,153,934 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2B	239,027,286 - 239,155,874 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2B	239,027,286 - 239,155,874 (-)	Ensembl	panpan1.1		panPan2

NGEF
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	25	44,473,422 - 44,547,838 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	25	44,474,174 - 44,547,872 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	25	44,969,850 - 45,009,071 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	25	44,733,359 - 44,772,804 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	25	44,731,905 - 44,837,771 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	25	44,658,432 - 44,697,679 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	25	44,504,534 - 44,543,977 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	25	44,659,743 - 44,699,019 (-)	NCBI		UU_Cfam_GSD_1.0

Ngef
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	186,657,675 - 186,689,323 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936525	4,220,385 - 4,282,065 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936525	4,250,389 - 4,282,041 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NGEF
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	15	133,332,718 - 133,460,166 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	15	133,332,715 - 133,460,161 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	15	147,333,684 - 147,429,402 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

NGEF
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	10	118,911,019 - 118,959,259 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666040	80,548,560 - 80,597,571 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ngef
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624843	5,557,839 - 5,648,871 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624843	5,558,053 - 5,648,869 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Ngef
836 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	317
Count of miRNA genes:	198
Interacting mature miRNAs:	221
Transcripts:	ENSRNOT00000022485
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631656	Bp108	Blood pressure QTL 108	5.97	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	48598251	93598251	Rat
8662828	Vetf6	Vascular elastic tissue fragility QTL 6	3.9		artery integrity trait (VT:0010639)	patent ductus arteriosus score (CMO:0002566)	9	36962359	92058970	Rat
11353957	Bmd92	Bone mineral density QTL 92		0.01	tibia mineral mass (VT:1000283)	volumetric bone mineral density (CMO:0001553)	9	46114199	91114199	Rat
724515	Uae16	Urinary albumin excretion QTL 16	8		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	9	58163035	100929646	Rat
731171	Glom6	Glomerulus QTL 6	2.8	0.0003	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	9	64573531	109573531	Rat
724547	Cm21	Cardiac mass QTL 21	2.7		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	9	79271511	102910209	Rat
61385	Edpm9	Estrogen-dependent pituitary mass QTL 9	3.43	0.05	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	9	63869687	108869687	Rat
2303178	Bp334	Blood pressure QTL 334	3.7	0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	79271511	91616855	Rat
724544	Uae9	Urinary albumin excretion QTL 9	4.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	9	25268044	114175309	Rat
2290450	Scl57	Serum cholesterol level QTL 57	4.15		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	9	36962359	95410867	Rat
1578760	Cm53	Cardiac mass QTL 53	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	9	56771635	101771635	Rat
11353951	Bp394	Blood pressure QTL 394			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	44649921	89649921	Rat
1581580	Uae34	Urinary albumin excretion QTL 34			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	9	62072275	96470995	Rat
1300134	Bp185	Blood pressure QTL 185	3.73		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	9	61381434	104821652	Rat
12879506	Pur33	Proteinuria QTL 33			urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	9	44649921	89649921	Rat
1354626	Bvd1	Brain ventricular dilatation QTL 1	3.73	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	9	75712843	111552878	Rat
4889852	Pur26	Proteinuria QTL 26	15	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	9	77813894	101597663	Rat
7794784	Mcs31	Mammary carcinoma susceptibility QTL 31	2.98		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	9	77813894	111552878	Rat
731164	Uae25	Urinary albumin excretion QTL 25	3.5	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	9	25661188	100929786	Rat
1578757	Pur6	Proteinuria QTL 6	3.3	0.005	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	9	62072275	96470995	Rat
4889943	Bss90	Bone structure and strength QTL 90	4.1		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	9	86369631	92058970	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	45	113	91	90	59	24	59	6	213	92	93	45	60	31


RefSeq Transcripts	NM_001136241	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039083015	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC078722	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC091122	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000009	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000022485 ⟹ ENSRNOP00000022485

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	9	88,146,956 - 88,180,387 (-)	Ensembl
Rnor_6.0 Ensembl	9	94,569,286 - 94,601,852 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000097143 ⟹ ENSRNOP00000081178

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	9	88,146,956 - 88,244,914 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000111267 ⟹ ENSRNOP00000091148

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	9	88,146,956 - 88,180,387 (-)	Ensembl

RefSeq Acc Id:

NM_001136241 ⟹ NP_001129713

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	95,594,823 - 95,628,247 (-)	NCBI
mRatBN7.2	9	88,146,956 - 88,180,387 (-)	NCBI
Rnor_6.0	9	94,569,286 - 94,601,852 (-)	NCBI
Rnor_5.0	9	94,290,729 - 94,323,295 (-)	NCBI
RGSC_v3.4	9	86,294,206 - 86,327,765 (-)	RGD
Celera	9	85,556,597 - 85,590,171 (-)	RGD

Sequence:

show sequence

ACCTCGCTTCGAGCCCGCGCGTTGCCCCCGGCCCGGCCCTGGGTCCCCCGCGCGGCCCCCCACCGGCTCCTGAGCCTACCCTGTCTCTGGTCCCCATGGAGCTGCTGGCTGCCGCTTTCAGCGCTGCC
TGCGCCGTGGACCACGACAGCTCCACCTCGGAGAGCGACACGCGCGACTCGGCGGCGGGACACCTGCCCGGCAGCGAGTCATCCTCCACCCCTGGAAATGGAACCACACCCGAGGAGTGCCCGGCCCT
CACCGACAGCCCCACCACGCTCACCGAGGCCCTGCAGATGATCCATCCCATTCCCGCCGACTCCTGGAGAAACCTCATTGAACAAATAGGGCTCCTGTACCAAGAGTATAGAGACAAATCGACTCTCC
AAGAGATCGAAACCCGGAGGCAACAGGATGCAGAAATACAAGGCAACTCGGATGGGTCCCAGGCTGGGGAAGACAATGCAGAGGAGGAGGAAGAGGAGGAGGAGGAGCCGGCCAGCCCCCCTGAGAGG
AGAGCTCTGCCTCAGATCTGCCTGCTCAGCAACCCCCACTCCAGGTTCAACCTCTGGCAGGACCTTCCTGAGATCCAGAGCAGCGGGGTGCTGGACATCCTCCAGCCTGAGGAGACCAAGCTGCAGGA
GGCCATGTTTGAGTTGGTCACCTCTGAGGCCTCCTACTATAAGAGCCTGAACCTGCTGGTGTCGCACTTCATGGAGAACGAGCGGCTGAAGAAGATCCTGCACCCGTCCGAGGCCCACATCCTCTTCT
CCAATGTCCTGGATGTCATGGCTGTCAGTGAGCGGTTTTTGCTAGAGCTGGAACACCGCATGGAGGAGAACATTGTCATCTCGGATGTGTGTGACATCGTGTACCGTTATGCGGCTGATCACTTCTCG
GTCTATATCACCTACGTCAGTAACCAGACCTACCAGGAAAGGACGTACAAGCAACTCCTACAGGAGAAGACGGCTTTTCGGGAACTGATCGCACAGCTGGAGCTGGACCCCAAGTGCAAGGGCCTGCC
CTTGTCCTCCTTCCTCATCTTGCCCTTCCAGAGGATCACGAGACTCAAGCTGCTGGTCCAGAACATCCTGAAGAGGGTGGAGGAAGGGTCTGAACGTGAAGGCACTGCCTTGGATGCCCACAAGGAGC
TAGAAATGGTGGTAAAGGCGTGCAACGAGGGTGTCCGGAAGATGAGCCGCACAGAACAGATGATCAGCATTCAGAAGAAGATGGAGTTCAAGATCAAGTCGGTACCTATCATCTCACACTCCCGGTGG
CTGCTGAAGCAAGGTGAACTACAGCAGATGTCCGGCCCCAAGACCTCCCGCACCCTGCGGACCAAGAAGCTCTTCAGAGAGATTTACCTCTTCCTCTTCAATGACCTGCTGGTGATCTGCCGGCAGAT
CCCTGGAGACAAGTACCAGGTGTTCGATTCCGCTCCAAGGGGCCTGCTGCGAGTGGAGGAGCTGGAGGACCAGGGCCAGACACTGGCTAATGTGTTCATCCTGCGGCTGCTGGAAAACGCAGATGACC
GGGAGGCCACCTATATGCTGAAGGCATCCTCCCAGAGCGAGATGAAGCGTTGGATGACTTCACTGGCCCCCAACAGGAGGACCAAGTTTGTATCCTTCACATCTCGGCTGTTGGACTGTCCGCAGGTC
CAGTGTGTCCACCCCTACGTGGCCCAGCAGCCCGATGAGCTGACACTGGAACTGGCAGACATCCTGAACATCCTAGAGAAGACGGAGGATGGGTGGATCTTTGGTGAGCGGCTGCATGACCAGGAGAG
AGGCTGGTTCCCCAGTTCCATGACAGAGGAGATCCTGAACCCCAAGATCCGCTCCCAAAACCTCAAGGAATGTTTCCGAGTGCATAAGATGGAGGACCCTCAGCGCAGCCAGAATAAGGACCGCAGGA
AGTTGGGCAGCCGGAATCGTCAATGAATCCCCCCCAGCTCAGGCACCAGCCTGAAGGAGGGGGTGTGGGCAGGGATGGGAAGCAGGCCCAGCAGAGATGCCTGACAGATTCAGAGGGTTTTAGGGAAG
AATGTCAGTGCCTTCCCAGGCAGCAGGAGTGGCTTGGGCCTGTTCTGTCCCTGCCCACGCAGTGGATGTTCCAGCATCCTGGCCACTCGCTTGCTTACACACTGGCGGAAGGCTAAGTACTTAGGCAG
TATTAGACCACCACCCTCCAGCCTCTCAGAGGGAGGAGGGCAGGCATTCTCCAGAGACCTTCCGGGGACTGGAGGAGACCCACACAAGGGTCCCTGGCAGCAGGGAGGTGGAAGGTAACCACCGTCAG
GATCCCCTGAACTGCACGTGTCCTTCCCTACCTTGGAAGCAGCTAAGAGTCTACTGGGCACACCGATGGACCACCCCTGCCCAAGGGAGCTTGGTGAGCAGTGCTGACTCTGCCTGCCCATCCCCGTG
CCTCTGCCAGCCTCTTTTGCACGGCCAAGCCCTGCCCTCAGCAGGCCTCCCAGAGCTTAGCTGAGGGTTCATGCCACCTCTAGCTCCCTGAAGGGCTTGATGTCACGTGTGTCTCCTGGCCCCTGAAG
GAGCCCAGGTGTTTTGCAGAATGAATTGGTCACTGCATCCTTTATGGTCATGGTTTTGAGAAAAGCAAATATCATTTTTGGCTGCATTAAAAGAAGCATCCTGTATGAAACGAGA

hide sequence

RefSeq Acc Id:

XM_039083015 ⟹ XP_038938943

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	95,594,825 - 95,692,381 (-)	NCBI
mRatBN7.2	9	88,146,956 - 88,244,454 (-)	NCBI


Protein RefSeqs	NP_001129713	(Get FASTA)	NCBI Sequence Viewer
	XP_038938943	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH78722	(Get FASTA)	NCBI Sequence Viewer
	AAH91122	(Get FASTA)	NCBI Sequence Viewer
	EDL75642	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000022485
	ENSRNOP00000081178
GenBank Protein	Q5BKC9	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001129713 ⟸ NM_001136241

- UniProtKB:

G3V856 (UniProtKB/TrEMBL), A6JWN4 (UniProtKB/TrEMBL), A0A8I6ADY5 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MELLAAAFSAACAVDHDSSTSESDTRDSAAGHLPGSESSSTPGNGTTPEECPALTDSPTTLTEALQMIHPIPADSWRNLIEQIGLLYQEYRDKSTLQEIETRRQQDAEIQGNSDGSQAGEDNAEEEEE
EEEEPASPPERRALPQICLLSNPHSRFNLWQDLPEIQSSGVLDILQPEETKLQEAMFELVTSEASYYKSLNLLVSHFMENERLKKILHPSEAHILFSNVLDVMAVSERFLLELEHRMEENIVISDVCD
IVYRYAADHFSVYITYVSNQTYQERTYKQLLQEKTAFRELIAQLELDPKCKGLPLSSFLILPFQRITRLKLLVQNILKRVEEGSEREGTALDAHKELEMVVKACNEGVRKMSRTEQMISIQKKMEFKI
KSVPIISHSRWLLKQGELQQMSGPKTSRTLRTKKLFREIYLFLFNDLLVICRQIPGDKYQVFDSAPRGLLRVEELEDQGQTLANVFILRLLENADDREATYMLKASSQSEMKRWMTSLAPNRRTKFVS
FTSRLLDCPQVQCVHPYVAQQPDELTLELADILNILEKTEDGWIFGERLHDQERGWFPSSMTEEILNPKIRSQNLKECFRVHKMEDPQRSQNKDRRKLGSRNRQ

hide sequence

Ensembl Acc Id:

ENSRNOP00000022485 ⟸ ENSRNOT00000022485

RefSeq Acc Id:	XP_038938943 ⟸ XM_039083015
- Peptide Label:	isoform X1
- UniProtKB:	Q5BKC9 (UniProtKB/Swiss-Prot), A0A8I5ZSE2 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000091148 ⟸ ENSRNOT00000111267

Ensembl Acc Id:

ENSRNOP00000081178 ⟸ ENSRNOT00000097143

Protein Domains

DH PH SH3

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5BKC9-F1-model_v2	AlphaFold	Q5BKC9	1-701	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13696836

Promoter ID:

EPDNEW_R7361

Type:

single initiation site

Name:

Ngef_1

Description:

neuronal guanine nucleotide exchange factor

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	9	94,601,900 - 94,601,960	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-26840	BioCyc
Ensembl Genes	ENSRNOG00000016653	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000022485	ENTREZGENE
	ENSRNOT00000097143	ENTREZGENE
Gene3D-CATH	1.20.900.10	UniProtKB/Swiss-Prot
	2.30.29.30	UniProtKB/Swiss-Prot
	SH3 Domains	UniProtKB/Swiss-Prot
InterPro	DBL_dom_sf	UniProtKB/Swiss-Prot
	DH-domain	UniProtKB/Swiss-Prot
	Ephexin-1_SH3	UniProtKB/Swiss-Prot
	Ephexin-like	UniProtKB/Swiss-Prot
	PH-like_dom_sf	UniProtKB/Swiss-Prot
	PH_domain	UniProtKB/Swiss-Prot
	PH_ephexin	UniProtKB/Swiss-Prot
	SH3-like_dom_sf	UniProtKB/Swiss-Prot
	SH3_domain	UniProtKB/Swiss-Prot
	SOS1_NGEF_PH	UniProtKB/Swiss-Prot
NCBI Gene	246217	ENTREZGENE
PANTHER	EPHEXIN-1	UniProtKB/Swiss-Prot
	GUANINE NUCLEOTIDE EXCHANGE FACTOR	UniProtKB/Swiss-Prot
Pfam	RhoGEF	UniProtKB/Swiss-Prot
	SH3_1	UniProtKB/Swiss-Prot
	SOS1_NGEF_PH	UniProtKB/Swiss-Prot
PhenoGen	Ngef	PhenoGen
PROSITE	DH_2	UniProtKB/Swiss-Prot
	PH_DOMAIN	UniProtKB/Swiss-Prot
	SH3	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000016653	RatGTEx
SMART	RhoGEF	UniProtKB/Swiss-Prot
	SH3	UniProtKB/Swiss-Prot
	SM00233	UniProtKB/Swiss-Prot
Superfamily-SCOP	PH domain-like	UniProtKB/Swiss-Prot
	SSF48065	UniProtKB/Swiss-Prot
	SSF50044	UniProtKB/Swiss-Prot
UniProt	A0A8I5ZSE2	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6ADY5	ENTREZGENE, UniProtKB/TrEMBL
	A6JWN4	ENTREZGENE, UniProtKB/TrEMBL
	G3V856	ENTREZGENE, UniProtKB/TrEMBL
	NGEF_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q6AZ62_RAT	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2006-12-05	Ngef	neuronal guanine nucleotide exchange factor	Ngef_predicted	neuronal guanine nucleotide exchange factor (predicted)	Symbol and Name updated	1299863	APPROVED
2006-12-05	Ngef_predicted	neuronal guanine nucleotide exchange factor (predicted)	Besh3_retired		Data merged from RGD:628687	737654	APPROVED
2006-12-05	Besh3_retired		Besh3	brain-enriched SH3-domain protein Besh3	Symbol and Name updated	1299863	APPROVED
2005-01-12	Ngef_predicted	neuronal guanine nucleotide exchange factor (predicted)			Symbol and Name status set to approved	70820	APPROVED
2003-02-27	Besh3	brain-enriched SH3-domain protein Besh3			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar

Imported Annotations - PID (archival)