Advanced Search (OLGA)

Gene: Rspry1 (ring finger and SPRY domain containing 1) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Rspry1

Name:

ring finger and SPRY domain containing 1

RGD ID:

1308847

Description:

Predicted to enable ubiquitin-protein transferase activity. Predicted to be involved in proteolysis involved in protein catabolic process. Predicted to be active in cytoplasm. Orthologous to human RSPRY1 (ring finger and SPRY domain containing 1); INTERACTS WITH 3-chloropropane-1,2-diol; 6-propyl-2-thiouracil; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC291860; LOC689249; MGC156751; RGD1308847; RING finger and SPRY domain-containing protein 1; similar to F16A11.1; similar to SPla/RYanodine receptor SPRY (1J970)

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	10,358,423 - 10,408,988 (-)	NCBI		GRCr8
mRatBN7.2	19	10,352,449 - 10,403,015 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	10,353,821 - 10,401,102 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	19	10,317,054 - 10,364,193 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	11,083,903 - 11,131,050 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	10,370,850 - 10,418,001 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	10,770,572 - 10,826,895 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	10,770,574 - 10,826,895 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	10,764,829 - 10,820,883 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	19	10,794,160 - 10,843,023 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	19	10,798,033 - 10,847,998 (-)	NCBI
Celera	19	10,243,223 - 10,290,488 (-)	NCBI		Celera
Cytogenetic Map	19	p13	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rspry1	Rat	Bardet-Biedl syndrome		ISO	RGD:1606482	8554872	ClinVar Annotator: match by term: Bardet-Biedl syndrome	ClinVar	PMID:11285252\|PMID:20177705\|PMID:24608809\|PMID:26518167\|PMID:28492532\|PMID:28747448\|PMID:30866059
Rspry1	Rat	Chromosome 16q12 Duplication Syndrome		ISO	RGD:1606482	8554872	ClinVar Annotator: match by term: Chromosome 16q12 duplication syndrome	ClinVar	PMID:25741868
Rspry1	Rat	developmental and epileptic encephalopathy		ISO	RGD:1606482	8554872	ClinVar Annotator: match by term: Developmental and epileptic encephalopathy	ClinVar	PMID:11285252\|PMID:20177705\|PMID:24608809\|PMID:26518167\|PMID:28492532\|PMID:28747448\|PMID:30866059
Rspry1	Rat	early infantile epileptic encephalopathy		ISO	RGD:1606482	8554872	ClinVar Annotator: match by term: Early infantile epileptic encephalopathy	ClinVar	PMID:11285252\|PMID:20177705\|PMID:24608809\|PMID:26518167\|PMID:28492532\|PMID:28747448\|PMID:30866059
Rspry1	Rat	genetic disease		ISO	RGD:1606482	8554872	ClinVar Annotator: match by term: Inborn genetic diseases	ClinVar	PMID:28492532
Rspry1	Rat	Spondyloepimetaphyseal Dysplasia, Faden-Alkuraya Type		ISO	RGD:1606482	8554872	ClinVar Annotator: match by term: RSPRY1-related condition \| ClinVar Annotator: match by term: Spondyloepimetaphyseal dysplasia, more ...	ClinVar	PMID:25741868\|PMID:26365341\|PMID:28492532\|PMID:30063090

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rspry1	Rat	Spondyloepimetaphyseal Dysplasia, Faden-Alkuraya Type		ISO	RGD:1606482	7240710		OMIM

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rspry1	Rat	1,2-dimethylhydrazine	decreases expression	ISO	RGD:1318855	6480464	1,2-Dimethylhydrazine results in decreased expression of RSPRY1 mRNA	CTD	PMID:22206623
Rspry1	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	RGD:1318855	6480464	Tetrachlorodibenzodioxin results in decreased expression of RSPRY1 mRNA	CTD	PMID:19770486
Rspry1	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	RGD:1318855	6480464	[TIPARP gene mutant form results in increased susceptibility to Tetrachlorodibenzodioxin] which results in decreased expression more ...	CTD	PMID:25975270
Rspry1	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	RGD:1318855	6480464	Tetrachlorodibenzodioxin affects the expression of RSPRY1 mRNA	CTD	PMID:21570461
Rspry1	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	RGD:1318855	6480464	Tetrachlorodibenzodioxin results in increased expression of RSPRY1 mRNA	CTD	PMID:21354282
Rspry1	Rat	3-chloropropane-1,2-diol	increases expression	EXP		6480464	alpha-Chlorohydrin results in increased expression of RSPRY1 mRNA	CTD	PMID:28522335
Rspry1	Rat	6-propyl-2-thiouracil	decreases expression	EXP		6480464	Propylthiouracil results in decreased expression of RSPRY1 mRNA	CTD	PMID:30047161
Rspry1	Rat	arsane	multiple interactions	ISO	RGD:1606482	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in increased expression of RSPRY1 more ...	CTD	PMID:39836092
Rspry1	Rat	arsenic atom	multiple interactions	ISO	RGD:1606482	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in increased expression of RSPRY1 more ...	CTD	PMID:39836092
Rspry1	Rat	atrazine	increases expression	ISO	RGD:1606482	6480464	Atrazine results in increased expression of RSPRY1 mRNA	CTD	PMID:22378314
Rspry1	Rat	benzene	increases expression	ISO	RGD:1606482	6480464	Benzene results in increased expression of RSPRY1 mRNA	CTD	PMID:19162166
Rspry1	Rat	benzo[a]pyrene	affects methylation	ISO	RGD:1606482	6480464	Benzo(a)pyrene affects the methylation of RSPRY1 5' UTR	CTD	PMID:27901495
Rspry1	Rat	beta-lapachone	decreases expression	ISO	RGD:1606482	6480464	beta-lapachone results in decreased expression of RSPRY1 mRNA	CTD	PMID:38218311
Rspry1	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of RSPRY1 mRNA	CTD	PMID:25181051\|PMID:30816183\|PMID:32528016\|PMID:34947998
Rspry1	Rat	bisphenol A	increases methylation	EXP		6480464	bisphenol A results in increased methylation of RSPRY1 gene	CTD	PMID:28505145
Rspry1	Rat	bisphenol F	increases expression	ISO	RGD:1318855	6480464	bisphenol F results in increased expression of RSPRY1 mRNA	CTD	PMID:38685157
Rspry1	Rat	chlordecone	increases expression	ISO	RGD:1318855	6480464	Chlordecone results in increased expression of RSPRY1 mRNA	CTD	PMID:29980752
Rspry1	Rat	chlormequat chloride	increases expression	EXP		6480464	Chlormequat results in increased expression of RSPRY1 protein	CTD	PMID:34958886
Rspry1	Rat	clozapine	multiple interactions	ISO	RGD:1606482	6480464	[Cuprizone co-treated with Clozapine] results in increased expression of RSPRY1 protein	CTD	PMID:34122009
Rspry1	Rat	Cuprizon	multiple interactions	ISO	RGD:1606482	6480464	[Cuprizone co-treated with Clozapine] results in increased expression of RSPRY1 protein	CTD	PMID:34122009
Rspry1	Rat	Dibutyl phosphate	affects expression	ISO	RGD:1606482	6480464	di-n-butylphosphoric acid affects the expression of RSPRY1 mRNA	CTD	PMID:37042841
Rspry1	Rat	doxorubicin	decreases expression	ISO	RGD:1606482	6480464	Doxorubicin results in decreased expression of RSPRY1 mRNA	CTD	PMID:29803840
Rspry1	Rat	ethanol	affects expression	ISO	RGD:1318855	6480464	Ethanol affects the expression of RSPRY1 mRNA	CTD	PMID:30319688
Rspry1	Rat	lead(0)	affects splicing	ISO	RGD:1606482	6480464	Lead affects the splicing of RSPRY1 mRNA	CTD	PMID:28903495
Rspry1	Rat	manganese atom	multiple interactions	ISO	RGD:1606482	6480464	[manganese chloride results in increased abundance of Manganese] which results in increased expression of RSPRY1 more ...	CTD	PMID:39836092
Rspry1	Rat	manganese(0)	multiple interactions	ISO	RGD:1606482	6480464	[manganese chloride results in increased abundance of Manganese] which results in increased expression of RSPRY1 more ...	CTD	PMID:39836092
Rspry1	Rat	manganese(II) chloride	multiple interactions	ISO	RGD:1606482	6480464	[manganese chloride results in increased abundance of Manganese] which results in increased expression of RSPRY1 more ...	CTD	PMID:39836092
Rspry1	Rat	methimazole	decreases expression	EXP		6480464	Methimazole results in decreased expression of RSPRY1 mRNA	CTD	PMID:30047161
Rspry1	Rat	N(4)-hydroxycytidine	decreases expression	ISO	RGD:1318855	6480464	N(4)-hydroxycytidine results in decreased expression of RSPRY1 mRNA	CTD	PMID:37748715
Rspry1	Rat	paracetamol	affects expression	ISO	RGD:1318855	6480464	Acetaminophen affects the expression of RSPRY1 mRNA	CTD	PMID:17562736
Rspry1	Rat	phenobarbital	affects expression	ISO	RGD:1318855	6480464	Phenobarbital affects the expression of RSPRY1 mRNA	CTD	PMID:23091169
Rspry1	Rat	resveratrol	multiple interactions	ISO	RGD:1606482	6480464	[Plant Extracts co-treated with Resveratrol] results in increased expression of RSPRY1 mRNA	CTD	PMID:23557933
Rspry1	Rat	sodium arsenite	increases expression	ISO	RGD:1606482	6480464	sodium arsenite results in increased expression of RSPRY1 mRNA	CTD	PMID:38568856
Rspry1	Rat	sodium arsenite	multiple interactions	ISO	RGD:1606482	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in increased expression of RSPRY1 more ...	CTD	PMID:39836092
Rspry1	Rat	sulfadimethoxine	decreases expression	EXP		6480464	Sulfadimethoxine results in decreased expression of RSPRY1 mRNA	CTD	PMID:30047161
Rspry1	Rat	titanium dioxide	decreases expression	ISO	RGD:1318855	6480464	titanium dioxide results in decreased expression of RSPRY1 mRNA	CTD	PMID:29264374
Rspry1	Rat	titanium dioxide	decreases methylation	ISO	RGD:1318855	6480464	titanium dioxide results in decreased methylation of RSPRY1 gene	CTD	PMID:35295148
Rspry1	Rat	triptonide	decreases expression	ISO	RGD:1318855	6480464	triptonide results in decreased expression of RSPRY1 mRNA	CTD	PMID:33045310
Rspry1	Rat	valproic acid	decreases methylation	ISO	RGD:1606482	6480464	Valproic Acid results in decreased methylation of RSPRY1 gene	CTD	PMID:29154799
Rspry1	Rat	vinclozolin	affects expression	EXP		6480464	vinclozolin affects the expression of RSPRY1 mRNA	CTD	PMID:19015723

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rspry1	Rat	proteolysis involved in protein catabolic process	involved_in	IBA	PANTHER:PTN001001019\|TAIR:locus:2052581\|UniProtKB:Q5XPI4	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rspry1	Rat	cytoplasm	is_active_in	IBA	PANTHER:PTN001001019\|UniProtKB:Q5XPI4	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rspry1	Rat	ubiquitin-protein transferase activity	enables	IBA	PANTHER:PTN001001019\|TAIR:locus:2052581\|UniProtKB:Q5XPI4	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Rspry1	Rat	ubiquitin-protein transferase activity	enables	IEA	InterPro:IPR045129	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
3.	GOA pipeline	RGD automated data pipeline
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:12477932	PMID:15632090

Rspry1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	10,358,423 - 10,408,988 (-)	NCBI		GRCr8
mRatBN7.2	19	10,352,449 - 10,403,015 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	10,353,821 - 10,401,102 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	19	10,317,054 - 10,364,193 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	11,083,903 - 11,131,050 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	10,370,850 - 10,418,001 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	10,770,572 - 10,826,895 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	10,770,574 - 10,826,895 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	10,764,829 - 10,820,883 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	19	10,794,160 - 10,843,023 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	19	10,798,033 - 10,847,998 (-)	NCBI
Celera	19	10,243,223 - 10,290,488 (-)	NCBI		Celera
Cytogenetic Map	19	p13	NCBI

RSPRY1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	16	57,186,152 - 57,240,469 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	16	57,186,137 - 57,240,469 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	16	57,220,241 - 57,274,381 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	16	55,777,742 - 55,830,451 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	16	41,720,063 - 41,772,638 (+)	NCBI		Celera
Cytogenetic Map	16	q13	NCBI
HuRef	16	43,089,815 - 43,142,600 (+)	NCBI		HuRef
CHM1_1	16	58,627,738 - 58,681,196 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	16	62,982,343 - 63,036,458 (+)	NCBI		T2T-CHM13v2.0

Rspry1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	95,328,569 - 95,386,905 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	95,328,565 - 95,386,903 (+)	Ensembl		GRCm39 Ensembl
GRCm38	8	94,601,941 - 94,660,276 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	94,601,937 - 94,660,275 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	97,125,841 - 97,184,176 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	97,491,109 - 97,548,982 (+)	NCBI		MGSCv36	mm8
Celera	8	98,935,623 - 98,988,663 (+)	NCBI		Celera
Cytogenetic Map	8	C5	NCBI
cM Map	8	46.6	NCBI

Rspry1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955433	14,843,671 - 14,884,742 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955433	14,843,521 - 14,884,083 (+)	NCBI	ChiLan1.0	ChiLan1.0

RSPRY1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	18	66,657,710 - 66,709,685 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	16	72,578,499 - 72,630,456 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	16	37,464,158 - 37,515,481 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	16	56,596,843 - 56,648,085 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	16	56,596,851 - 56,648,085 (+)	Ensembl	panpan1.1		panPan2

RSPRY1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	59,139,908 - 59,186,340 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	59,141,107 - 59,186,724 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	55,768,089 - 55,814,514 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	59,678,215 - 59,724,611 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	59,678,192 - 59,724,597 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	56,509,629 - 56,555,927 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	57,516,879 - 57,563,294 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	58,410,958 - 58,457,378 (-)	NCBI		UU_Cfam_GSD_1.0

Rspry1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	50,250,412 - 50,294,665 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936475	9,294,340 - 9,340,268 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936475	9,294,421 - 9,338,372 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RSPRY1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	19,154,417 - 19,204,826 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	19,154,413 - 19,204,827 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	17,159,489 - 17,195,780 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RSPRY1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	5	43,137,942 - 43,187,327 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	5	43,155,963 - 43,188,765 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666047	33,131,948 - 33,181,777 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rspry1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624746	28,808,364 - 28,862,113 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624746	28,808,364 - 28,862,125 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Rspry1
231 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	24
Count of miRNA genes:	21
Interacting mature miRNAs:	23
Transcripts:	ENSRNOT00000023988
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1549847	Bss8	Bone structure and strength QTL 8	4		lumbar vertebra strength trait (VT:0010574)	vertebra ultimate force (CMO:0001678)	19	1	31963836	Rat
8552935	Pigfal10	Plasma insulin-like growth factor 1 level QTL 10	5.7		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	19	1	36824771	Rat
61447	Tcas1	Tongue tumor susceptibility QTL 1	6.08		tongue integrity trait (VT:0010553)	squamous cell carcinoma of the tongue maximum tumor diameter (CMO:0001875)	19	2316121	47316121	Rat
631681	Cm12	Cardiac mass QTL 12	3.33	0.00053	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	19	1	28982497	Rat
9590298	Uminl5	Urine mineral level QTL 5	3.59	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	19	1	36824771	Rat
631840	Niddm38	Non-insulin dependent diabetes mellitus QTL 38	3.86		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	19	10323180	23069265	Rat
10054132	Srcrt9	Stress Responsive Cort QTL 9	2.87	0.0017	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	19	1	27355345	Rat
1331737	Uae29	Urinary albumin excretion QTL 29	5.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	4096155	55283277	Rat
724518	Uae19	Urinary albumin excretion QTL 19	5.5		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	7457249	42983518	Rat
8694186	Bw152	Body weight QTL 152	3.34	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	19	569374	45569374	Rat
7411590	Foco7	Food consumption QTL 7	6.8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	19	1	24688055	Rat
631678	Cm9	Cardiac mass QTL 9	4.27	0.0001	aorta mass (VT:0002845)	aorta weight (CMO:0000076)	19	1	28982497	Rat
9590250	Scort11	Serum corticosterone level QTL 11	23.45	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	19	1	36824771	Rat
9590090	Insglur8	Insulin/glucose ratio QTL 8	10.81	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	19	1	36824771	Rat
2317848	Alcrsp21	Alcohol response QTL 21	1.899999976158142	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	19	3204777	48204777	Rat
9589102	Slep13	Serum leptin concentration QTL 13	4.63	0.001	blood leptin amount (VT:0005667)	plasma leptin level (CMO:0000781)	19	569374	45569374	Rat
7247442	Uae39	Urinary albumin excretion QTL 39			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	2187927	46708701	Rat
724566	Uae12	Urinary albumin excretion QTL 12	5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	2187927	56457239	Rat
724565	Tcas5	Tongue tumor susceptibility QTL 5	10.04		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	19	9977753	39654489	Rat

AI608258

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	10,352,649 - 10,352,794 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	10,769,403 - 10,769,547	NCBI	Rnor6.0
Rnor_5.0	19	10,763,660 - 10,763,804	UniSTS	Rnor5.0
RGSC_v3.4	19	10,792,991 - 10,793,135	UniSTS	RGSC3.4
Celera	19	10,242,054 - 10,242,198	UniSTS
Cytogenetic Map	19	p12	UniSTS

BF390149

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	10,362,533 - 10,362,700 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	10,779,287 - 10,779,453	NCBI	Rnor6.0
Rnor_5.0	19	10,773,731 - 10,773,897	UniSTS	Rnor5.0
RGSC_v3.4	19	10,803,598 - 10,803,764	UniSTS	RGSC3.4
Celera	19	10,251,963 - 10,252,129	UniSTS
RH 3.4 Map	19	95.52	UniSTS
Cytogenetic Map	19	p12	UniSTS

RH138519

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	10,353,125 - 10,353,263 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	10,769,879 - 10,770,016	NCBI	Rnor6.0
Rnor_5.0	19	10,764,136 - 10,764,273	UniSTS	Rnor5.0
RGSC_v3.4	19	10,793,467 - 10,793,604	UniSTS	RGSC3.4
Celera	19	10,242,530 - 10,242,667	UniSTS
RH 3.4 Map	19	104.7	UniSTS
Cytogenetic Map	19	p12	UniSTS

AI009640

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	19	10,358,463 - 10,358,648 (+)	Marker Load Pipeline
mRatBN7.2	19	10,352,489 - 10,352,674 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	10,769,243 - 10,769,427	NCBI	Rnor6.0
Rnor_5.0	19	10,763,500 - 10,763,684	UniSTS	Rnor5.0
RGSC_v3.4	19	10,792,831 - 10,793,015	UniSTS	RGSC3.4
Celera	19	10,241,894 - 10,242,078	UniSTS
RH 3.4 Map	19	104.6	UniSTS
Cytogenetic Map	19	p12	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001100945	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039097997	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC096512	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY724539	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC129112	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474006	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000019	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000090217 ⟹ ENSRNOP00000071830

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	19	10,353,821 - 10,401,102 (-)	Ensembl
Rnor_6.0 Ensembl	19	10,770,574 - 10,826,895 (-)	Ensembl

RefSeq Acc Id:

NM_001100945 ⟹ NP_001094415

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	10,359,793 - 10,407,076 (-)	NCBI
mRatBN7.2	19	10,353,819 - 10,401,102 (-)	NCBI
Rnor_6.0	19	10,770,572 - 10,826,895 (-)	NCBI
Rnor_5.0	19	10,764,829 - 10,820,883 (-)	NCBI
RGSC_v3.4	19	10,794,160 - 10,843,023 (-)	RGD
Celera	19	10,243,223 - 10,290,488 (-)	RGD

Sequence:

show sequence

GCTGCTCTGGGAAGCCCCTTGGGGACGTGGCCGGGGAGGGTGCTTGAGGGCTAGCGACGCCTGTGAGGGAAGAGAACAGCCGCTGGAGCCTGGGTCGGAGAGACTGGACTGGGGCCGTGGCCGTCTCC
GGGCAGTGGTCTTGGAGAGGGTGGCGTTGGTCAGAGCCTGGGAAGCAGCCGGAACGCTCTCCTCCGAGGCCCGCGCTGGAGGCGCCTGAAAGCGGTTCCTGGAAGAGGGTGTTCCCCTTTAGGGGATC
TTGACTGAAGGAGGTCCTGGGGTCACCCTCCTGAGGAGACTGCGGCTAAGAGCTGCCAGTGTATGGCCAGCATTCCCAGTGGTTAATAATGTTGGAAACGAGCTGCTTGACCTTCTCCAGCCTTCAGT
TGTTAAGAATGAATAGAGTGCAAGTTCAACTCCACATTATGAAGACAGTACTCGGAAAATTGAAAACTATCTAAATGATTGTCTTTGGTTGGGCTGTGTTCTTAGCAAGCAGAAGCCTTGGTCAGGGT
CTGCTATTGACTTTTGAGGAGCACATAGCCCACCTATTGGGGACTACAGGTGCCACTACTACTATGGGTAATTCTTGCATCTGCCGAGATGACAGTGGAGCAGAAGACAGTGTTGACACCCACCAGCA
ACAGGCTGAGAACAGTACAGTCCCTACTGCGGACAGTAGGAGCCAACTTCGGGACCCTGTTCGGCCTCCAAGGAGAGGCCGAGGACCTCATGAGCCAAGGAGAAAGAAACAAAATGTGGATGGGTTAG
TGTTGGACACACTGGCGGTAATACGGACTCTTGTAGATAATGATCAGGAACCTCCTTATTCAATGATTACATTACATGAAATGGCAGAAACAGATGAAGGATGGTTGGATGTTGTCCAGTCTTTAATT
AGAGTTATTCCATTGGAAGATCCACTGGGACCAGCTGTTATAACCTTGTTACTAGACGAATGTCCATTGCCCACTAAAGATGCACTCCAGAAATTGACCGAAATTCTTAATTTAAATGGAGAGGTAGC
GTGCCAGGACTCAGGTCACCCTGCCAAACACAGGAACACATCTGCAGTCCTGGGCTGTTTGGCTGAGAAACTAGCAGGTCCTGCAAGCATAGGTTTACTTAGCCCAGGAATACTGGAATATTTGCTAC
AGTGTCTGAAGTTACAGTCCCATCCCACAGTCATGCTTTTTGCACTGATTGCACTGGAAAAGTTTGCCCAGACAAGTGAGAACAAATTGACTATCTCTGAATCCAGTATTAGTGACCGACTGGTCACA
TTGGAGCTGTGGGCTGATGATCCTGATTATCTGAAACGTCAGGTTGGCTTCTGTGCCCAGTGGAGCTTAGACAATCTCTTTTTAAAAGAAGGTAGACAACTAACCTACGAGAAAGTGGACTTGAATAA
CATTAGGGCCATGCTGAACAGCAATGATGTCAGCGAGTACTTGAAGATCTCACCTCACGGCTTGGAGGCTCGCTGTGATGCCTCCTCCTTTGAGAGTGTGCGCTGCACTTTTTGTGTGGACACTGGGG
TGTGGTACTACGAAGTAACAGTGGTCACTTCTGGTGTCATGCAGATTGGCTGGGCTACTCGAGACAGCAAGTTTCTGAACCACGAAGGCTATGGTATTGGCGACGATGAGTACTCCTGTGCCTATGAT
GGCTGCCGGCAGCTGATTTGGTACAATGCCAGAAGTAAGCCTCACGTGCACCCGTGCTGGAAGGAAGGAGACACAGTGGGGTTTCTGTTAGACTTGAATGAAAAGCAAATGATCTTCTTTTTAAATGG
CAACCAGCTGCCTCCTGAGAAGCAAGTCTTTTCATCCACCGTATCGGGATTTTTTGCTGCAGCTAGTTTCATGTCATATCAACAATGTGAGTTCAACTTTGGAGCAAGACCATTCAAATACCCACCGT
CTATGAAATTTAGCACTTTTAATGATTACGCCTTCCTAACAGCTGAAGAAAAGATCATTTTGCCAAGGCACCGGCGCCTCGCTCTGCTGAAGCAAGTCAGTATCCGAGAGAACTGCTGTTCACTCTGT
TGTGACGAGGTGGCGGACACACAGCTGAAGCCCTGTGGACACAGTGACCTGTGCATGGATTGTGCCTTGCAACTGGAGACCTGCCCATTGTGTCGTAAAGAAATAGTGTCTAGAATCAGACAGATTTC
TCATATTTCATGACACATGTGAAGAGAGATCATGGACCTATTTCTACTCAATTCCAGCCAATGTTGAAAAGAAAAGGAAAAAAAAAACCACAAACATCTCTAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039097997 ⟹ XP_038953925

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	10,358,423 - 10,408,988 (-)	NCBI
mRatBN7.2	19	10,352,449 - 10,403,015 (-)	NCBI


Protein RefSeqs	NP_001094415	(Get FASTA)	NCBI Sequence Viewer
	XP_038953925	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI29113	(Get FASTA)	NCBI Sequence Viewer
	EDL87335	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000071830
	ENSRNOP00000071830.2

RefSeq Acc Id:	NP_001094415 ⟸ NM_001100945
- Peptide Label:	precursor
- UniProtKB:	A1L1K9 (UniProtKB/TrEMBL)
- Sequence:	show sequence MIVFGWAVFLASRSLGQGLLLTFEEHIAHLLGTTGATTTMGNSCICRDDSGAEDSVDTHQQQAENSTVPTADSRSQLRDPVRPPRRGRGPHEPRRKKQNVDGLVLDTLAVIRTLVDNDQEPPYSMITL HEMAETDEGWLDVVQSLIRVIPLEDPLGPAVITLLLDECPLPTKDALQKLTEILNLNGEVACQDSGHPAKHRNTSAVLGCLAEKLAGPASIGLLSPGILEYLLQCLKLQSHPTVMLFALIALEKFAQT SENKLTISESSISDRLVTLELWADDPDYLKRQVGFCAQWSLDNLFLKEGRQLTYEKVDLNNIRAMLNSNDVSEYLKISPHGLEARCDASSFESVRCTFCVDTGVWYYEVTVVTSGVMQIGWATRDSKF LNHEGYGIGDDEYSCAYDGCRQLIWYNARSKPHVHPCWKEGDTVGFLLDLNEKQMIFFLNGNQLPPEKQVFSSTVSGFFAAASFMSYQQCEFNFGARPFKYPPSMKFSTFNDYAFLTAEEKIILPRHR RLALLKQVSIRENCCSLCCDEVADTQLKPCGHSDLCMDCALQLETCPLCRKEIVSRIRQISHIS hide sequence

Ensembl Acc Id:

ENSRNOP00000071830 ⟸ ENSRNOT00000090217

RefSeq Acc Id:	XP_038953925 ⟸ XM_039097997
- Peptide Label:	isoform X1
- UniProtKB:	A0A0G2K1G4 (UniProtKB/TrEMBL), A6JY57 (UniProtKB/TrEMBL)

Protein Domains

B30.2/SPRY RING-type

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-A0A0G2K1G4-F1-model_v2	AlphaFold	A0A0G2K1G4	1-578	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-6502	BioCyc
Ensembl Genes	ENSRNOG00000060931	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000090217	ENTREZGENE
	ENSRNOT00000090217.2	UniProtKB/TrEMBL
Gene3D-CATH	2.60.120.920	UniProtKB/TrEMBL
	3.30.40.10	UniProtKB/TrEMBL
InterPro	ARM-type_fold	UniProtKB/TrEMBL
	B30.2/SPRY_sf	UniProtKB/TrEMBL
	B302/SPRY	UniProtKB/TrEMBL
	ConA-like_dom	UniProtKB/TrEMBL
	RNF123/RSPRY1-like	UniProtKB/TrEMBL
	SPRY_rcpt	UniProtKB/TrEMBL
	SPRY_RSPRY1	UniProtKB/TrEMBL
	Znf_RING	UniProtKB/TrEMBL
	Znf_RING/FYVE/PHD	UniProtKB/TrEMBL
KEGG Report	rno:689249	UniProtKB/TrEMBL
NCBI Gene	Rspry1	ENTREZGENE
PANTHER	PTHR13363	UniProtKB/TrEMBL
	RING FINGER AND SPRY DOMAIN-CONTAINING PROTEIN 1	UniProtKB/TrEMBL
Pfam	SPRY	UniProtKB/TrEMBL
	zf-C3HC4_3	UniProtKB/TrEMBL
PhenoGen	Rspry1	PhenoGen
PROSITE	B302_SPRY	UniProtKB/TrEMBL
	ZF_RING_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000060931	RatGTEx
SMART	RING	UniProtKB/TrEMBL
	SPRY	UniProtKB/TrEMBL
Superfamily-SCOP	ConA_like_lec_gl	UniProtKB/TrEMBL
	RING/U-box	UniProtKB/TrEMBL
	SSF48371	UniProtKB/TrEMBL
UniProt	A0A0G2K1G4	ENTREZGENE, UniProtKB/TrEMBL
	A1L1K9	ENTREZGENE, UniProtKB/TrEMBL
	A6JY57	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-09-22	Rspry1	ring finger and SPRY domain containing 1	LOC689249	similar to F16A11.1	Data merged from RGD:1594803	737654	APPROVED
2008-09-05	Rspry1	ring finger and SPRY domain containing 1	RGD1308847	similar to SPla/RYanodine receptor SPRY (1J970)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	RGD1308847	similar to SPla/RYanodine receptor SPRY (1J970)	RGD1308847_predicted	similar to SPla/RYanodine receptor SPRY (1J970) (predicted)	'predicted' is removed	2292626	APPROVED
2006-11-20	LOC689249	similar to F16A11.1			Symbol and Name status set to provisional	70820	PROVISIONAL
2005-01-20	RGD1308847_predicted	similar to SPla/RYanodine receptor SPRY (1J970) (predicted)	LOC291860_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC291860_predicted	similar to SPla/RYanodine receptor SPRY (1J970) (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM