Symbol:
Elavl1
Name:
ELAV like RNA binding protein 1
RGD ID:
1308649
Description:
Enables mRNA 3'-UTR binding activity and protein kinase binding activity. Involved in several processes, including positive regulation of autophagosome size; positive regulation of metabolic process; and response to glucose. Located in cytoplasm and nucleus. Biomarker of degenerative disc disease. Orthologous to human ELAVL1 (ELAV like RNA binding protein 1); PARTICIPATES IN CRM1 export pathway; INTERACTS WITH 4,4'-sulfonyldiphenol; 6-propyl-2-thiouracil; amitrole.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
ELAV (embryonic lethal, abnormal vision, Drosophila)-like 1 (Hu antigen R); ELAV like 1; ELAV-like protein 1; hu-antigen R; Hua; HuR; LOC363854; mRNA-stabilizing factor HuR
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 7,441,699 - 7,482,625 (-) NCBI GRCr8 mRatBN7.2 12 2,640,936 - 2,684,787 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 2,645,061 - 2,684,784 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 3,291,952 - 3,332,869 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 3,915,541 - 3,956,458 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 2,678,578 - 2,719,442 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 2,461,502 - 2,502,432 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 2,461,502 - 2,502,432 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 4,614,839 - 4,655,379 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 1,459,046 - 1,500,042 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 12 1,458,769 - 1,500,043 (+) NCBI Celera 12 4,459,379 - 4,500,318 (-) NCBI Celera Cytogenetic Map 12 p12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Elavl1 Rat (-)-epigallocatechin 3-gallate increases expression ISO ELAVL1 (Homo sapiens) 6480464 epigallocatechin gallate results in increased expression of ELAVL1 protein CTD PMID:31195006 Elavl1 Rat (Z)-3-butylidenephthalide decreases expression ISO ELAVL1 (Homo sapiens) 6480464 butylidenephthalide results in decreased expression of ELAVL1 protein CTD PMID:23770345 Elavl1 Rat 1,2-dimethylhydrazine multiple interactions ISO Elavl1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of ELAVL1 mRNA CTD PMID:22206623 Elavl1 Rat 1,2-dimethylhydrazine affects expression ISO Elavl1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine affects the expression of ELAVL1 mRNA CTD PMID:22206623 Elavl1 Rat 1,4-benzoquinone decreases expression ISO ELAVL1 (Homo sapiens) 6480464 quinone results in decreased expression of ELAVL1 mRNA CTD PMID:38367942 Elavl1 Rat 1-chloro-2,4-dinitrobenzene increases expression ISO ELAVL1 (Homo sapiens) 6480464 Dinitrochlorobenzene results in increased expression of ELAVL1 protein CTD PMID:21969073 Elavl1 Rat 17alpha-ethynylestradiol affects expression ISO Elavl1 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of ELAVL1 mRNA CTD PMID:17555576 Elavl1 Rat 17alpha-ethynylestradiol increases expression ISO Elavl1 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of ELAVL1 mRNA CTD PMID:17942748 Elavl1 Rat 17alpha-ethynylestradiol multiple interactions ISO Elavl1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of ELAVL1 mRNA CTD PMID:17942748 Elavl1 Rat 17beta-estradiol affects expression ISO Elavl1 (Mus musculus) 6480464 Estradiol affects the expression of ELAVL1 mRNA CTD PMID:15598610 Elavl1 Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Elavl1 (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Elavl1 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO ELAVL1 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Elavl1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO ELAVL1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of ELAVL1 protein CTD PMID:19962423 Elavl1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Elavl1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of ELAVL1 mRNA CTD PMID:21570461 Elavl1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Elavl1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of ELAVL1 mRNA CTD PMID:17942748 Elavl1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO ELAVL1 (Homo sapiens) 6480464 U 0126 inhibits the reaction [Tetrachlorodibenzodioxin results in increased expression of ELAVL1 protein] CTD PMID:19962423 Elavl1 Rat 2,4,6-tribromophenol increases expression ISO ELAVL1 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Elavl1 Rat 2,6-di-tert-butyl-4-methylphenol affects localization ISO Elavl1 (Mus musculus) 6480464 Butylated Hydroxytoluene affects the localization of ELAVL1 protein CTD PMID:10900464 Elavl1 Rat 3',5'-cyclic UMP affects binding ISO ELAVL1 (Homo sapiens) 6480464 ELAVL1 protein binds to cyclic 3' and 5'-uridine monophosphate CTD PMID:30528433 Elavl1 Rat 3,3',5,5'-tetrabromobisphenol A increases expression ISO ELAVL1 (Homo sapiens) 6480464 tetrabromobisphenol A results in increased expression of ELAVL1 protein CTD PMID:31675489 Elavl1 Rat 3-methyladenine multiple interactions ISO ELAVL1 (Homo sapiens) 6480464 3-methyladenine inhibits the reaction [sepantronium results in decreased expression of and results in decreased stability of ELAVL1 mRNA] and 3-methyladenine inhibits the reaction [sepantronium results in decreased expression of ELAVL1 protein] CTD PMID:31837377 Elavl1 Rat 4,4'-diaminodiphenylmethane affects expression ISO Elavl1 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane affects the expression of ELAVL1 mRNA CTD PMID:18648102 Elavl1 Rat 4,4'-sulfonyldiphenol increases expression ISO Elavl1 (Mus musculus) 6480464 bisphenol S results in increased expression of ELAVL1 mRNA CTD PMID:39298647 Elavl1 Rat 4,4'-sulfonyldiphenol increases expression ISO ELAVL1 (Homo sapiens) 6480464 bisphenol S results in increased expression of ELAVL1 protein CTD PMID:34186270 Elavl1 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of ELAVL1 mRNA CTD PMID:36041667 Elavl1 Rat 4-vinylcyclohexene dioxide affects expression ISO Elavl1 (Mus musculus) 6480464 4-vinyl-1-cyclohexene dioxide affects the expression of ELAVL1 mRNA CTD PMID:20829426 Elavl1 Rat 5-aza-2'-deoxycytidine multiple interactions ISO ELAVL1 (Homo sapiens) 6480464 [Decitabine co-treated with trichostatin A] affects the localization of ELAVL1 protein CTD PMID:17891453 Elavl1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of ELAVL1 mRNA CTD PMID:30047161 Elavl1 Rat aflatoxin B1 increases methylation ISO ELAVL1 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of ELAVL1 intron CTD PMID:30157460 Elavl1 Rat AICA ribonucleotide multiple interactions ISO ELAVL1 (Homo sapiens) 6480464 AICA ribonucleotide inhibits the reaction [ELAVL1 protein binds to CCNA2 3' UTR] and AICA ribonucleotide inhibits the reaction [ELAVL1 protein binds to CCNB1 3' UTR] CTD PMID:12730239 Elavl1 Rat AICA ribonucleotide decreases localization ISO ELAVL1 (Homo sapiens) 6480464 AICA ribonucleotide results in decreased localization of ELAVL1 protein CTD PMID:12730239 Elavl1 Rat all-trans-retinoic acid decreases expression ISO ELAVL1 (Homo sapiens) 6480464 Tretinoin results in decreased expression of ELAVL1 mRNA CTD PMID:23724009 and PMID:33167477 Elavl1 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of ELAVL1 mRNA CTD PMID:38685447 Elavl1 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of ELAVL1 mRNA CTD PMID:30047161 Elavl1 Rat amsacrine decreases expression ISO ELAVL1 (Homo sapiens) 6480464 Amsacrine results in decreased expression of ELAVL1 protein CTD PMID:37451322 Elavl1 Rat amsacrine multiple interactions ISO ELAVL1 (Homo sapiens) 6480464 [[Amsacrine results in decreased phosphorylation of MAPK1 protein] which results in decreased expression of ELAVL1 mRNA] which results in increased degradation of BCL2L1 mRNA more ... CTD PMID:37451322 Elavl1 Rat antimycin A decreases expression ISO ELAVL1 (Homo sapiens) 6480464 Antimycin A results in decreased expression of ELAVL1 mRNA CTD PMID:33512557 Elavl1 Rat antimycin A decreases localization ISO ELAVL1 (Homo sapiens) 6480464 Antimycin A results in decreased localization of ELAVL1 protein CTD PMID:12730239 Elavl1 Rat antimycin A multiple interactions ISO ELAVL1 (Homo sapiens) 6480464 Antimycin A inhibits the reaction [ELAVL1 protein binds to CCNA2 3' UTR] and Antimycin A inhibits the reaction [ELAVL1 protein binds to CCNB1 3' UTR] CTD PMID:12730239 Elavl1 Rat Aroclor 1254 decreases expression ISO Elavl1 (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of ELAVL1 mRNA CTD PMID:23650126 Elavl1 Rat arsenic trichloride multiple interactions ISO ELAVL1 (Homo sapiens) 6480464 arsenic trichloride promotes the reaction [ELAVL1 protein binds to GADD45A mRNA] CTD PMID:16421274 Elavl1 Rat arsenous acid multiple interactions ISO ELAVL1 (Homo sapiens) 6480464 [Arsenic Trioxide promotes the reaction [ELAVL1 protein binds to TGIF1 promoter]] which results in decreased degradation of TGIF1 promoter and Arsenic Trioxide promotes the reaction [ELAVL1 protein binds to TGIF1 promoter] CTD PMID:21649584 Elavl1 Rat atrazine decreases expression ISO ELAVL1 (Homo sapiens) 6480464 Atrazine results in decreased expression of ELAVL1 mRNA CTD PMID:22378314 Elavl1 Rat benzo[a]pyrene increases expression ISO Elavl1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of ELAVL1 mRNA CTD PMID:22228805 Elavl1 Rat benzo[a]pyrene affects methylation ISO ELAVL1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of ELAVL1 intron CTD PMID:30157460 Elavl1 Rat bis(2-ethylhexyl) phthalate increases expression ISO Elavl1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of ELAVL1 mRNA CTD PMID:33754040 Elavl1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of ELAVL1 mRNA CTD PMID:25181051 Elavl1 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of ELAVL1 mRNA CTD PMID:36041667 Elavl1 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of ELAVL1 gene CTD PMID:28505145 Elavl1 Rat Bisphenol B increases expression ISO ELAVL1 (Homo sapiens) 6480464 bisphenol B results in increased expression of ELAVL1 protein CTD PMID:34186270 Elavl1 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of ELAVL1 mRNA CTD PMID:36041667 Elavl1 Rat cadmium dichloride decreases expression ISO ELAVL1 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of ELAVL1 mRNA CTD PMID:38568856 Elavl1 Rat caffeine decreases phosphorylation ISO ELAVL1 (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of ELAVL1 protein CTD PMID:35688186 Elavl1 Rat carbon nanotube decreases expression ISO Elavl1 (Mus musculus) 6480464 Nanotubes and Carbon analog results in decreased expression of ELAVL1 mRNA CTD PMID:25554681 Elavl1 Rat copper(II) sulfate decreases expression ISO ELAVL1 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of ELAVL1 mRNA CTD PMID:19549813 Elavl1 Rat crotonaldehyde decreases expression ISO ELAVL1 (Homo sapiens) 6480464 2-butenal results in decreased expression of ELAVL1 mRNA CTD PMID:20471460 Elavl1 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of ELAVL1 mRNA CTD PMID:26577399 Elavl1 Rat cycloheximide multiple interactions ISO ELAVL1 (Homo sapiens) 6480464 Cycloheximide inhibits the reaction [EIF4E protein modified form inhibits the reaction [sodium arsenite results in decreased expression of ELAVL1 protein]] CTD PMID:25923732 Elavl1 Rat DDE increases expression ISO ELAVL1 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of ELAVL1 mRNA CTD PMID:38568856 Elavl1 Rat decabromodiphenyl ether increases expression ISO ELAVL1 (Homo sapiens) 6480464 decabromobiphenyl ether results in increased expression of ELAVL1 protein CTD PMID:31675489 Elavl1 Rat deguelin decreases expression ISO ELAVL1 (Homo sapiens) 6480464 deguelin results in decreased expression of ELAVL1 mRNA CTD PMID:33512557 Elavl1 Rat deoxynivalenol multiple interactions ISO ELAVL1 (Homo sapiens) 6480464 [[[Acetylmuramyl-Alanyl-Isoglutamine binds to and results in increased activity of NOD2 protein] which affects the localization of ELAVL1 protein] which co-treated with deoxynivalenol] promotes the reaction [[ELAVL1 protein binds to ATF3 3' UTR] which results in increased stability of ATF3 mRNA] more ... CTD PMID:19591856 and PMID:22003189 Elavl1 Rat dexamethasone increases expression EXP 6480464 Dexamethasone results in increased expression of ELAVL1 mRNA CTD PMID:21804312 Elavl1 Rat diarsenic trioxide multiple interactions ISO ELAVL1 (Homo sapiens) 6480464 [Arsenic Trioxide promotes the reaction [ELAVL1 protein binds to TGIF1 promoter]] which results in decreased degradation of TGIF1 promoter and Arsenic Trioxide promotes the reaction [ELAVL1 protein binds to TGIF1 promoter] CTD PMID:21649584 Elavl1 Rat Dibutyl phosphate affects expression ISO ELAVL1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of ELAVL1 mRNA CTD PMID:37042841 Elavl1 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of ELAVL1 mRNA CTD PMID:21266533 Elavl1 Rat dibutyl phthalate increases expression ISO Elavl1 (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of ELAVL1 mRNA CTD PMID:21266533 Elavl1 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of ELAVL1 mRNA CTD PMID:21266533 Elavl1 Rat dorsomorphin multiple interactions ISO ELAVL1 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of ELAVL1 mRNA CTD PMID:27188386 Elavl1 Rat enzyme inhibitor multiple interactions ISO ELAVL1 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of ELAVL1 protein CTD PMID:23301498 Elavl1 Rat flurbiprofen multiple interactions ISO ELAVL1 (Homo sapiens) 6480464 ELAVL1 protein promotes the reaction [Flurbiprofen results in increased expression of NGFR protein] and Flurbiprofen promotes the reaction [ELAVL1 protein binds to NGFR mRNA] CTD PMID:18056468 Elavl1 Rat flurbiprofen increases expression ISO ELAVL1 (Homo sapiens) 6480464 Flurbiprofen results in increased expression of ELAVL1 protein CTD PMID:18056468 Elavl1 Rat folic acid decreases expression ISO Elavl1 (Mus musculus) 6480464 Folic Acid results in decreased expression of ELAVL1 mRNA CTD PMID:25629700 Elavl1 Rat folic acid multiple interactions ISO Elavl1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of ELAVL1 mRNA CTD PMID:22206623 Elavl1 Rat folpet decreases expression ISO Elavl1 (Mus musculus) 6480464 folpet results in decreased expression of ELAVL1 mRNA CTD PMID:31558096 Elavl1 Rat formaldehyde multiple interactions ISO ELAVL1 (Homo sapiens) 6480464 Formaldehyde affects the reaction [SET protein alternative form binds to ELAVL1 protein] CTD PMID:36534342 Elavl1 Rat furfural multiple interactions ISO ELAVL1 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of ELAVL1 protein CTD PMID:38598786 Elavl1 Rat genistein decreases expression ISO ELAVL1 (Homo sapiens) 6480464 Genistein results in decreased expression of ELAVL1 mRNA CTD PMID:22228119 Elavl1 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of ELAVL1 mRNA CTD PMID:22061828 Elavl1 Rat Goe 6976 multiple interactions ISO ELAVL1 (Homo sapiens) 6480464 Go 6976 inhibits the reaction [N-Methylaspartate results in increased phosphorylation of ELAVL1 protein] CTD PMID:31945382 Elavl1 Rat hydroquinone multiple interactions ISO ELAVL1 (Homo sapiens) 6480464 ELAVL1 protein inhibits the reaction [hydroquinone results in decreased expression of SIRT3 mRNA] more ... CTD PMID:35302183 Elavl1 Rat hydroquinone increases degradation ISO ELAVL1 (Homo sapiens) 6480464 hydroquinone results in increased degradation of ELAVL1 mRNA CTD PMID:35302183 Elavl1 Rat hydroquinone decreases expression ISO ELAVL1 (Homo sapiens) 6480464 hydroquinone results in decreased expression of ELAVL1 mRNA and hydroquinone results in decreased expression of ELAVL1 protein CTD PMID:35302183 Elavl1 Rat ibuprofen multiple interactions ISO ELAVL1 (Homo sapiens) 6480464 ELAVL1 protein promotes the reaction [Ibuprofen results in increased expression of NGFR protein] and Ibuprofen promotes the reaction [ELAVL1 protein binds to NGFR mRNA] CTD PMID:18056468 Elavl1 Rat ibuprofen increases expression ISO ELAVL1 (Homo sapiens) 6480464 Ibuprofen results in increased expression of ELAVL1 protein CTD PMID:18056468 Elavl1 Rat ivermectin decreases expression ISO ELAVL1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of ELAVL1 protein CTD PMID:32959892 Elavl1 Rat lipopolysaccharide multiple interactions ISO ELAVL1 (Homo sapiens) 6480464 ELAVL1 protein promotes the reaction [Lipopolysaccharides results in increased expression of PLA2G4A mRNA] and ELAVL1 protein promotes the reaction [Lipopolysaccharides results in increased expression of PTGS2 mRNA] CTD PMID:21391979 Elavl1 Rat menadione multiple interactions ISO ELAVL1 (Homo sapiens) 6480464 [[Vitamin K 3 results in increased phosphorylation of JAK3 protein] which results in increased phosphorylation of and affects the localization of ELAVL1 protein] inhibits the reaction [ELAVL1 protein binds to and results in decreased degradation of SIRT1 mRNA] more ... CTD PMID:24106086 Elavl1 Rat menadione increases phosphorylation ISO ELAVL1 (Homo sapiens) 6480464 Vitamin K 3 results in increased phosphorylation of ELAVL1 protein CTD PMID:24106086 Elavl1 Rat muramyl dipeptide multiple interactions ISO ELAVL1 (Homo sapiens) 6480464 [[[Acetylmuramyl-Alanyl-Isoglutamine binds to and results in increased activity of NOD2 protein] which affects the localization of ELAVL1 protein] which co-treated with deoxynivalenol] promotes the reaction [[ELAVL1 protein binds to ATF3 3' UTR] which results in increased stability of ATF3 mRNA] more ... CTD PMID:22003189 Elavl1 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal increases expression ISO ELAVL1 (Homo sapiens) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in increased expression of ELAVL1 mRNA and benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in increased expression of ELAVL1 protein CTD PMID:23922739 Elavl1 Rat N-methyl-4-phenylpyridinium increases expression ISO Elavl1 (Mus musculus) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of ELAVL1 protein CTD PMID:26558463 Elavl1 Rat N-methyl-4-phenylpyridinium increases expression ISO ELAVL1 (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of ELAVL1 mRNA and 1-Methyl-4-phenylpyridinium results in increased expression of ELAVL1 protein CTD PMID:32968928 Elavl1 Rat N-methyl-4-phenylpyridinium multiple interactions ISO ELAVL1 (Homo sapiens) 6480464 ELAVL1 protein affects the reaction [MIR326 affects the reaction [1-Methyl-4-phenylpyridinium results in increased cleavage of CASP1 protein]] more ... CTD PMID:31253394 and PMID:32968928 Elavl1 Rat N-methyl-D-aspartic acid increases phosphorylation ISO ELAVL1 (Homo sapiens) 6480464 N-Methylaspartate results in increased phosphorylation of ELAVL1 protein CTD PMID:31945382 Elavl1 Rat N-methyl-D-aspartic acid multiple interactions ISO ELAVL1 (Homo sapiens) 6480464 1 more ... CTD PMID:31945382 Elavl1 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of ELAVL1 mRNA CTD PMID:24136188 Elavl1 Rat nickel atom decreases expression ISO ELAVL1 (Homo sapiens) 6480464 Nickel results in decreased expression of ELAVL1 mRNA CTD PMID:25583101 Elavl1 Rat nitrates multiple interactions ISO Elavl1 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of ELAVL1 mRNA CTD PMID:35964746 Elavl1 Rat ozone multiple interactions ISO ELAVL1 (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of ELAVL1 mRNA CTD PMID:35430440 Elavl1 Rat p-toluidine decreases expression EXP 6480464 4-toluidine results in decreased expression of ELAVL1 mRNA CTD PMID:27638505 Elavl1 Rat paracetamol affects expression ISO Elavl1 (Mus musculus) 6480464 Acetaminophen affects the expression of ELAVL1 mRNA CTD PMID:17562736 Elavl1 Rat paracetamol increases expression ISO ELAVL1 (Homo sapiens) 6480464 Acetaminophen results in increased expression of ELAVL1 mRNA CTD PMID:22230336 Elavl1 Rat paraquat affects localization ISO ELAVL1 (Homo sapiens) 6480464 Paraquat affects the localization of ELAVL1 protein CTD PMID:22879928 Elavl1 Rat phenobarbital increases expression EXP 6480464 Phenobarbital results in increased expression of ELAVL1 mRNA CTD PMID:30047161 Elavl1 Rat pirinixic acid increases expression ISO Elavl1 (Mus musculus) 6480464 pirinixic acid results in increased expression of ELAVL1 mRNA CTD PMID:18301758 Elavl1 Rat pirinixic acid decreases expression ISO Elavl1 (Mus musculus) 6480464 pirinixic acid results in decreased expression of ELAVL1 mRNA CTD PMID:18445702 Elavl1 Rat pregnenolone 16alpha-carbonitrile increases expression EXP 6480464 Pregnenolone Carbonitrile results in increased expression of ELAVL1 mRNA CTD PMID:30047161 Elavl1 Rat putrescine multiple interactions EXP 6480464 Putrescine inhibits the reaction [Ornithine Decarboxylase Inhibitors affects the localization of ELAVL1 protein] and Putrescine inhibits the reaction [Ornithine Decarboxylase Inhibitors promotes the reaction [ELAVL1 protein binds to JUND 3' UTR]] CTD PMID:20805360 Elavl1 Rat resveratrol multiple interactions ISO ELAVL1 (Homo sapiens) 6480464 ELAVL1 mutant form inhibits the reaction [resveratrol results in increased expression of MAT2B protein] more ... CTD PMID:23814050 Elavl1 Rat resveratrol increases expression ISO ELAVL1 (Homo sapiens) 6480464 resveratrol results in increased expression of ELAVL1 mRNA CTD PMID:23814050 Elavl1 Rat rotenone decreases expression ISO ELAVL1 (Homo sapiens) 6480464 Rotenone results in decreased expression of ELAVL1 mRNA CTD PMID:33512557 Elavl1 Rat rottlerin multiple interactions EXP 6480464 rottlerin inhibits the reaction [AGT protein affects the localization of ELAVL1 protein] CTD PMID:19246637 Elavl1 Rat SB 431542 multiple interactions ISO ELAVL1 (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 and PMID:37664457 Elavl1 Rat sepantronium decreases expression ISO ELAVL1 (Homo sapiens) 6480464 sepantronium results in decreased expression of ELAVL1 protein CTD PMID:31837377 Elavl1 Rat sepantronium multiple interactions ISO ELAVL1 (Homo sapiens) 6480464 3-methyladenine inhibits the reaction [sepantronium results in decreased expression of and results in decreased stability of ELAVL1 mRNA] more ... CTD PMID:31837377 Elavl1 Rat sevoflurane decreases methylation ISO Elavl1 (Mus musculus) 6480464 Sevoflurane results in decreased methylation of ELAVL1 mRNA CTD PMID:35249202 Elavl1 Rat sodium arsenite multiple interactions ISO ELAVL1 (Homo sapiens) 6480464 [sodium arsenite promotes the reaction [CHEK2 protein results in increased phosphorylation of ELAVL1 protein]] promotes the reaction [[ELAVL1 protein binds to TRA2B exon] which results in increased expression of TRA2B mRNA modified form] more ... CTD PMID:24106086 more ... Elavl1 Rat sodium arsenite multiple interactions ISO Elavl1 (Mus musculus) 6480464 sodium arsenite promotes the reaction [ELAVL1 protein binds to TIA1 protein] and sodium arsenite promotes the reaction [ELAVL1 protein binds to TIAL1 protein] CTD PMID:19765185 Elavl1 Rat sodium arsenite increases phosphorylation ISO ELAVL1 (Homo sapiens) 6480464 sodium arsenite results in increased phosphorylation of ELAVL1 protein CTD PMID:24865968 Elavl1 Rat sodium arsenite decreases expression ISO ELAVL1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of ELAVL1 protein CTD PMID:25923732 Elavl1 Rat sodium arsenite affects localization ISO ELAVL1 (Homo sapiens) 6480464 sodium arsenite affects the localization of ELAVL1 protein CTD PMID:22879928 and PMID:27932253 Elavl1 Rat sodium azide multiple interactions ISO ELAVL1 (Homo sapiens) 6480464 Sodium Azide inhibits the reaction [ELAVL1 protein binds to CCNA2 3' UTR] and Sodium Azide inhibits the reaction [ELAVL1 protein binds to CCNB1 3' UTR] CTD PMID:12730239 Elavl1 Rat sodium azide decreases localization ISO ELAVL1 (Homo sapiens) 6480464 Sodium Azide results in decreased localization of ELAVL1 protein CTD PMID:12730239 Elavl1 Rat sodium chloride multiple interactions ISO ELAVL1 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of ELAVL1 protein CTD PMID:38598786 Elavl1 Rat Soman increases expression EXP 6480464 Soman results in increased expression of ELAVL1 mRNA CTD PMID:19281266 Elavl1 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of ELAVL1 mRNA CTD PMID:30047161 Elavl1 Rat sunitinib increases expression ISO ELAVL1 (Homo sapiens) 6480464 Sunitinib results in increased expression of ELAVL1 mRNA CTD PMID:31533062 Elavl1 Rat tamoxifen affects expression ISO Elavl1 (Mus musculus) 6480464 Tamoxifen affects the expression of ELAVL1 mRNA CTD PMID:17555576 Elavl1 Rat tebufenpyrad decreases expression ISO ELAVL1 (Homo sapiens) 6480464 4-chloro-N-((4-(1 and 1-dimethylethyl)phenyl)methyl)-3-ethyl-1-methyl-1H-pyrazole-5-carboxamide results in decreased expression of ELAVL1 mRNA CTD PMID:33512557 Elavl1 Rat tert-butyl hydroperoxide decreases expression ISO ELAVL1 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in decreased expression of ELAVL1 mRNA CTD PMID:15336504 Elavl1 Rat tetrachloroethene decreases expression ISO Elavl1 (Mus musculus) 6480464 Tetrachloroethylene results in decreased expression of ELAVL1 mRNA CTD PMID:28973375 Elavl1 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of ELAVL1 mRNA CTD PMID:31150632 Elavl1 Rat thapsigargin decreases expression EXP 6480464 Thapsigargin results in decreased expression of ELAVL1 protein CTD PMID:35544339 Elavl1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of ELAVL1 mRNA CTD PMID:34492290 Elavl1 Rat thiram decreases expression ISO ELAVL1 (Homo sapiens) 6480464 Thiram results in decreased expression of ELAVL1 mRNA CTD PMID:38568856 Elavl1 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of ELAVL1 mRNA CTD PMID:33387578 Elavl1 Rat trichostatin A multiple interactions ISO ELAVL1 (Homo sapiens) 6480464 [Decitabine co-treated with trichostatin A] affects the localization of ELAVL1 protein more ... CTD PMID:17891453 and PMID:27188386 Elavl1 Rat trichostatin A decreases expression ISO ELAVL1 (Homo sapiens) 6480464 trichostatin A results in decreased expression of ELAVL1 mRNA CTD PMID:24935251 and PMID:26272509 Elavl1 Rat triphenyl phosphate affects expression ISO ELAVL1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of ELAVL1 mRNA CTD PMID:37042841 Elavl1 Rat urethane affects localization ISO Elavl1 (Mus musculus) 6480464 Urethane affects the localization of ELAVL1 protein CTD PMID:10900464 Elavl1 Rat urethane increases expression ISO Elavl1 (Mus musculus) 6480464 Urethane results in increased expression of ELAVL1 protein CTD PMID:10900464 Elavl1 Rat valproic acid decreases expression ISO ELAVL1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of ELAVL1 mRNA CTD PMID:19101580 Elavl1 Rat valproic acid increases expression ISO ELAVL1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of ELAVL1 mRNA CTD PMID:19101580 more ... Elavl1 Rat valproic acid affects expression ISO ELAVL1 (Homo sapiens) 6480464 Valproic Acid affects the expression of ELAVL1 mRNA CTD PMID:25979313 Elavl1 Rat valsartan multiple interactions EXP 6480464 Valsartan inhibits the reaction [AGT protein affects the localization of ELAVL1 protein] CTD PMID:19246637 Elavl1 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of ELAVL1 mRNA CTD PMID:19015723 Elavl1 Rat vorinostat decreases expression ISO Elavl1 (Mus musculus) 6480464 vorinostat results in decreased expression of ELAVL1 protein CTD PMID:22749963
(-)-epigallocatechin 3-gallate (ISO) (Z)-3-butylidenephthalide (ISO) 1,2-dimethylhydrazine (ISO) 1,4-benzoquinone (ISO) 1-chloro-2,4-dinitrobenzene (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4,6-tribromophenol (ISO) 2,6-di-tert-butyl-4-methylphenol (ISO) 3',5'-cyclic UMP (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 3-methyladenine (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 4-vinylcyclohexene dioxide (ISO) 5-aza-2'-deoxycytidine (ISO) 6-propyl-2-thiouracil (EXP) aflatoxin B1 (ISO) AICA ribonucleotide (ISO) all-trans-retinoic acid (ISO) amitrole (EXP) amsacrine (ISO) antimycin A (ISO) Aroclor 1254 (ISO) arsenic trichloride (ISO) arsenous acid (ISO) atrazine (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP) Bisphenol B (ISO) bisphenol F (EXP) cadmium dichloride (ISO) caffeine (ISO) carbon nanotube (ISO) copper(II) sulfate (ISO) crotonaldehyde (ISO) Cuprizon (EXP) cycloheximide (ISO) DDE (ISO) decabromodiphenyl ether (ISO) deguelin (ISO) deoxynivalenol (ISO) dexamethasone (EXP) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP,ISO) dorsomorphin (ISO) enzyme inhibitor (ISO) flurbiprofen (ISO) folic acid (ISO) folpet (ISO) formaldehyde (ISO) furfural (ISO) genistein (ISO) gentamycin (EXP) Goe 6976 (ISO) hydroquinone (ISO) ibuprofen (ISO) ivermectin (ISO) lipopolysaccharide (ISO) menadione (ISO) muramyl dipeptide (ISO) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) N-methyl-4-phenylpyridinium (ISO) N-methyl-D-aspartic acid (ISO) nefazodone (EXP) nickel atom (ISO) nitrates (ISO) ozone (ISO) p-toluidine (EXP) paracetamol (ISO) paraquat (ISO) phenobarbital (EXP) pirinixic acid (ISO) pregnenolone 16alpha-carbonitrile (EXP) putrescine (EXP) resveratrol (ISO) rotenone (ISO) rottlerin (EXP) SB 431542 (ISO) sepantronium (ISO) sevoflurane (ISO) sodium arsenite (ISO) sodium azide (ISO) sodium chloride (ISO) Soman (EXP) sulfadimethoxine (EXP) sunitinib (ISO) tamoxifen (ISO) tebufenpyrad (ISO) tert-butyl hydroperoxide (ISO) tetrachloroethene (ISO) tetrachloromethane (EXP) thapsigargin (EXP) thioacetamide (EXP) thiram (ISO) trichloroethene (EXP) trichostatin A (ISO) triphenyl phosphate (ISO) urethane (ISO) valproic acid (ISO) valsartan (EXP) vinclozolin (EXP) vorinostat (ISO)
Biological Process
3'-UTR-mediated mRNA stabilization (IEA,ISO,ISS) cell population proliferation (IMP) lncRNA-mediated post-transcriptional gene silencing (IEA,ISO) mRNA destabilization (IMP) mRNA stabilization (IEA,ISO,ISS) negative regulation of miRNA-mediated gene silencing (IEA,ISO,ISS) positive regulation of autophagosome size (IMP) positive regulation of autophagy (IMP) positive regulation of superoxide anion generation (IMP) positive regulation of translation (IEA,ISO) post-transcriptional gene silencing (IEA,ISO) protein homooligomerization (IEA,ISO,ISS) protein import into nucleus (IEA,ISO) regulation of stem cell population maintenance (IEA,ISO) response to glucose (IEP)
Cellular Component
cytoplasm (IDA,IEA,ISO,ISS) cytoplasmic stress granule (IEA,ISO,ISS) cytoplasmic vesicle (IEA,ISO) cytosol (IEA,ISO,ISS) endoplasmic reticulum (IEA,ISO) glutamatergic synapse (IEA,ISO) nucleoplasm (IEA,ISO,ISS) nucleus (IDA,IEA,ISO,ISS) P-body (IEA) postsynapse (IEA,ISO) ribonucleoprotein complex (IEA,ISO,ISS) sarcoplasm (IEA,ISO)
Molecular Function
double-stranded RNA binding (IEA,ISO) lncRNA binding (IEA,ISO) miRNA binding (IEA,ISO,ISS) mRNA 3'-UTR AU-rich region binding (IEA,ISO,ISS) mRNA 3'-UTR binding (IDA,IEA,ISO) mRNA binding (IDA,IEA,ISO) nucleic acid binding (IEA) protein binding (IPI,ISO) protein homodimerization activity (IEA,ISO) protein kinase binding (IEA,IPI,ISO) RNA binding (IEA,ISO)
1.
Hu antigen R is required for NOX-1 but not NOX-4 regulation by inflammatory stimuli in vascular smooth muscle cells.
Aguado A, etal., J Hypertens. 2016 Feb;34(2):253-65. doi: 10.1097/HJH.0000000000000801.
2.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
3.
Reconstitution of HuR-Inhibited CUGBP1 Expression Protects Cardiomyocytes from Acute Myocardial Infarction-Induced Injury.
Gu L, etal., Antioxid Redox Signal. 2017 Nov 10;27(14):1013-1026. doi: 10.1089/ars.2016.6880. Epub 2017 Mar 28.
4.
Polyamines regulate c-Myc translation through Chk2-dependent HuR phosphorylation.
Liu L, etal., Mol Biol Cell. 2009 Dec;20(23):4885-98. doi: 10.1091/mbc.E09-07-0550. Epub 2009 Oct 7.
5.
Natural antisense transcript stabilizes inducible nitric oxide synthase messenger RNA in rat hepatocytes.
Matsui K, etal., Hepatology. 2008 Feb;47(2):686-97.
6.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
7.
Postage for the messenger: designating routes for nuclear mRNA export.
Natalizio BJ and Wente SR, Trends Cell Biol. 2013 Aug;23(8):365-73. doi: 10.1016/j.tcb.2013.03.006. Epub 2013 Apr 11.
8.
Destabilization of the ornithine decarboxylase mRNA transcript by the RNA-binding protein tristetraprolin.
Nowotarski SL, etal., Amino Acids. 2016 May 19.
9.
GOA pipeline
RGD automated data pipeline
10.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
11.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
12.
RNA-binding protein HuR suppresses senescence through Atg7 mediated autophagy activation in diabetic intervertebral disc degeneration.
Shao Z, etal., Cell Prolif. 2021 Feb;54(2):e12975. doi: 10.1111/cpr.12975. Epub 2020 Dec 28.
13.
Hu protein R-mediated posttranscriptional regulation of VEGF expression in rat gastrocnemius muscle.
Tang K, etal., Am J Physiol Heart Circ Physiol 2002 Oct;283(4):H1497-504.
Elavl1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 7,441,699 - 7,482,625 (-) NCBI GRCr8 mRatBN7.2 12 2,640,936 - 2,684,787 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 2,645,061 - 2,684,784 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 3,291,952 - 3,332,869 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 3,915,541 - 3,956,458 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 2,678,578 - 2,719,442 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 2,461,502 - 2,502,432 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 2,461,502 - 2,502,432 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 4,614,839 - 4,655,379 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 1,459,046 - 1,500,042 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 12 1,458,769 - 1,500,043 (+) NCBI Celera 12 4,459,379 - 4,500,318 (-) NCBI Celera Cytogenetic Map 12 p12 NCBI
ELAVL1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 19 7,958,573 - 8,005,641 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 19 7,958,573 - 8,005,659 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 19 8,023,457 - 8,070,525 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 19 7,929,457 - 7,976,529 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 19 7,929,457 - 7,976,529 NCBI Celera 19 7,894,704 - 7,941,773 (-) NCBI Celera Cytogenetic Map 19 p13.2 NCBI HuRef 19 7,693,669 - 7,740,685 (-) NCBI HuRef CHM1_1 19 8,022,943 - 8,069,993 (-) NCBI CHM1_1 T2T-CHM13v2.0 19 7,959,562 - 8,006,636 (-) NCBI T2T-CHM13v2.0
Elavl1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 4,334,781 - 4,375,104 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 4,335,382 - 4,375,413 (-) Ensembl GRCm39 Ensembl GRCm38 8 4,284,781 - 4,325,140 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 4,285,382 - 4,325,413 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 4,284,782 - 4,325,100 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 4,288,343 - 4,324,906 (-) NCBI MGSCv36 mm8 Celera 8 4,485,398 - 4,525,701 (-) NCBI Celera Cytogenetic Map 8 A1.1 NCBI cM Map 8 2.0 NCBI
Elavl1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955563 1,283,421 - 1,315,283 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955563 1,283,424 - 1,315,283 (+) NCBI ChiLan1.0 ChiLan1.0
ELAVL1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 20 12,645,019 - 12,688,426 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 19 11,758,555 - 11,805,677 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 19 7,259,829 - 7,306,808 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 19 8,114,849 - 8,147,142 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 19 8,114,849 - 8,147,137 (-) Ensembl panpan1.1 panPan2
ELAVL1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 20 52,648,878 - 52,677,578 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 20 52,454,132 - 52,491,784 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 20 53,179,951 - 53,217,640 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 20 53,180,820 - 53,217,660 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 20 52,383,218 - 52,420,649 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 20 52,827,713 - 52,865,411 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 20 53,059,378 - 53,097,043 (-) NCBI UU_Cfam_GSD_1.0
Elavl1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 212,875,753 - 212,906,793 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936588 4,927,950 - 4,959,064 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936588 4,931,665 - 4,959,032 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ELAVL1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 71,207,096 - 71,248,906 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 71,207,141 - 71,245,863 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 71,607,515 - 71,646,238 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ELAVL1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 6 7,419,489 - 7,448,917 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 6 7,414,757 - 7,448,445 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666081 353,624 - 400,190 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Elavl1
.
Predicted Target Of
Count of predictions: 117 Count of miRNA genes: 98 Interacting mature miRNAs: 108 Transcripts: ENSRNOT00000001415 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
2312418 Kidm41 Kidney mass QTL 41 3.7 0.0001 kidney mass (VT:0002707) single kidney wet weight to body weight ratio (CMO:0000622) 12 1 19611090 Rat 10755457 Coatc14 Coat color QTL 14 0.01759 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 12 1 22591684 Rat 634351 Apr5 Acute phase response QTL 5 6.7 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 12 1 44503507 Rat 8694179 Bw150 Body weight QTL 150 2.9 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 12 1 42110980 Rat 634350 Apr4 Acute phase response QTL 4 6 orosomucoid 1 amount (VT:0010541) plasma orosomucoid 1 level (CMO:0001467) 12 1172005 46172005 Rat 7411545 Bw128 Body weight QTL 128 5.2 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 12 1 42110980 Rat 7387292 Kidm42 Kidney mass QTL 42 3.03 0.0004 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 12 1 36247923 Rat 737979 Pia22 Pristane induced arthritis QTL 22 53.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 1 44465750 Rat 9590147 Scort7 Serum corticosterone level QTL 7 13.61 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 12 1 42110980 Rat 7411586 Foco5 Food consumption QTL 5 5.4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 1581516 Cm56 Cardiac mass QTL 56 4.2 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 12 1 29333307 Rat 9590086 Insglur6 Insulin/glucose ratio QTL 6 18.97 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 12 1 42110980 Rat 2303575 Insul14 Insulin level QTL 14 4 blood insulin amount (VT:0001560) blood insulin level (CMO:0000349) 12 1 42450532 Rat 6893681 Bw109 Body weight QTL 109 2.3 0.004 body mass (VT:0001259) body weight (CMO:0000012) 12 1 23297788 Rat 7243862 Mcs30 Mammary carcinoma susceptibility QTL 30 8.62 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 12 797729 8525593 Rat 2302042 Pia38 Pristane induced arthritis QTL 38 3.5 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 12 1 44503507 Rat 7411595 Foco9 Food consumption QTL 9 4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 1300174 Bw15 Body weight QTL 15 2.93 body mass (VT:0001259) body weight loss (CMO:0001399) 12 1 9318387 Rat 7411660 Foco28 Food consumption QTL 28 10.9 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 1598855 Bp294 Blood pressure QTL 294 3.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 1 34851688 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000001415 ⟹ ENSRNOP00000001415
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 2,645,061 - 2,684,784 (-) Ensembl Rnor_6.0 Ensembl 12 2,461,502 - 2,502,432 (+) Ensembl
RefSeq Acc Id:
NM_001108848 ⟹ NP_001102318
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 7,441,699 - 7,482,625 (-) NCBI mRatBN7.2 12 2,643,861 - 2,684,787 (-) NCBI Rnor_6.0 12 2,461,502 - 2,502,432 (+) NCBI Rnor_5.0 12 4,614,839 - 4,655,379 (+) NCBI RGSC_v3.4 12 1,459,046 - 1,500,042 (+) RGD Celera 12 4,459,379 - 4,500,318 (-) RGD
Sequence:
GCAGCCGTCGCCGTCGCCGTCGCCGTCGCCGCTACCGCTCTGCCGCCGCCACCACCGCTACCGAGGCCGTGCGGAGCCGTTATCACCGCGCCGCCCGCCCCGGAGCAGAGTCCCGGGCCTTCCCGCCC
hide sequence
RefSeq Acc Id:
NP_001102318 ⟸ NM_001108848
- UniProtKB:
B5DF91 (UniProtKB/TrEMBL)
- Sequence:
MSNGYEDHMAEDCRDDIGRTNLIVNYLPQNMTQEELRSLFSSIGEVESAKLIRDKVAGHSLGYGFVNYVTAKDAERAISTLNGLRLQSKTIKVSYARPSSEVIKDANLYISGLPRTMTQKDVEDMFSR
hide sequence
Ensembl Acc Id:
ENSRNOP00000001415 ⟸ ENSRNOT00000001415
RGD ID: 13698380 Promoter ID: EPDNEW_R8904 Type: initiation region Name: Elavl1_1 Description: ELAV like RNA binding protein 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 12 2,461,496 - 2,461,556 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2013-11-11
Elavl1
ELAV like RNA binding protein 1
Elavl1
ELAV (embryonic lethal, abnormal vision, Drosophila)-like 1 (Hu antigen R)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Elavl1
ELAV (embryonic lethal, abnormal vision, Drosophila)-like 1 (Hu antigen R)
Elavl1_predicted
ELAV (embryonic lethal, abnormal vision, Drosophila)-like 1 (Hu antigen R) (predicted)
'predicted' is removed
2292626 APPROVED
2007-04-23
Elavl1_predicted
ELAV (embryonic lethal, abnormal vision, Drosophila)-like 1 (Hu antigen R) (predicted)
Elavl1
ELAV (embryonic lethal, abnormal vision, Drosophila)-like 1 (Hu antigen R)
Data merged from RGD:731215
737654 APPROVED
2005-01-12
Elavl1_predicted
ELAV (embryonic lethal, abnormal vision, Drosophila)-like 1 (Hu antigen R) (predicted)
Symbol and Name status set to approved
70820 APPROVED
Note Type
Note
Reference
gene_function
binds with high affinity and specificity to adenylate/uridylate-rich elements (AREs) located in the 3-untranslated region (3-UTR) of several mRNAs
625662
gene_product
member of a family of RNA binding proteins
625662
