Symbol:
Slfn2
Name:
schlafen family member 2
RGD ID:
1308645
Description:
Predicted to enable tRNA binding activity. Predicted to be involved in T cell mediated immunity; T cell proliferation involved in immune response; and tRNA stabilization. Predicted to act upstream of or within negative regulation of cell population proliferation and response to bacterium. Predicted to be active in cytoplasm. Orthologous to human SLFN12L (schlafen family member 12 like); INTERACTS WITH 1-naphthyl isothiocyanate; 2,3,7,8-tetrachlorodibenzodioxine; 4,4'-diaminodiphenylmethane.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC303380; schlafen 2; schlafen family member 12-like
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Candidate Gene For:
Bp312
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 68,450,861 - 68,457,198 (+) NCBI GRCr8 mRatBN7.2 10 67,953,322 - 67,959,659 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 67,953,171 - 67,959,458 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 72,573,354 - 72,579,691 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 72,078,736 - 72,085,073 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 67,542,782 - 67,549,119 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 70,370,381 - 70,376,718 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 70,370,300 - 70,376,331 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 70,001,084 - 70,007,628 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 71,236,408 - 71,242,745 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 71,248,325 - 71,279,012 (+) NCBI Celera 10 66,897,016 - 66,903,353 (+) NCBI Celera Cytogenetic Map 10 q26 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Slfn2 Rat (+)-catechin multiple interactions ISO SLFN12L (Homo sapiens) 6480464 [Catechin co-treated with Grape Seed Proanthocyanidins] results in decreased expression of SLFN12L mRNA CTD PMID:24763279 Slfn2 Rat (1->4)-beta-D-glucan multiple interactions ISO Slfn2 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of SLFN2 mRNA CTD PMID:36331819 Slfn2 Rat 1,2-dichloroethane decreases expression ISO Slfn2 (Mus musculus) 6480464 ethylene dichloride results in decreased expression of SLFN2 mRNA CTD PMID:28960355 Slfn2 Rat 1,2-dimethylhydrazine increases expression ISO Slfn2 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of SLFN2 mRNA CTD PMID:22206623 Slfn2 Rat 1-chloro-2,4-dinitrobenzene affects binding ISO SLFN12L (Homo sapiens) 6480464 Dinitrochlorobenzene binds to SLFN12L protein CTD PMID:32991956 Slfn2 Rat 1-naphthyl isothiocyanate decreases expression EXP 6480464 1-Naphthylisothiocyanate results in decreased expression of SLFN2 mRNA CTD PMID:25380136 Slfn2 Rat 17beta-estradiol decreases expression ISO Slfn2 (Mus musculus) 6480464 Estradiol results in decreased expression of SLFN2 mRNA CTD PMID:39298647 Slfn2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of SLFN2 mRNA CTD PMID:34747641 Slfn2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Slfn2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of SLFN2 mRNA CTD PMID:21570461 and PMID:28922406 Slfn2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of SLFN2 mRNA CTD PMID:33387578 Slfn2 Rat 2,4-diaminotoluene increases expression ISO Slfn2 (Mus musculus) 6480464 2 and 4-diaminotoluene results in increased expression of SLFN2 mRNA CTD PMID:20713471 Slfn2 Rat 3-methylcholanthrene decreases expression ISO Slfn2 (Mus musculus) 6480464 Methylcholanthrene results in decreased expression of SLFN2 mRNA CTD PMID:20713471 Slfn2 Rat 4,4'-diaminodiphenylmethane decreases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of SLFN2 mRNA CTD PMID:25380136 Slfn2 Rat 4,4'-sulfonyldiphenol decreases expression ISO Slfn2 (Mus musculus) 6480464 bisphenol S results in decreased expression of SLFN2 mRNA CTD PMID:39298647 Slfn2 Rat 4,4'-sulfonyldiphenol increases methylation ISO Slfn2 (Mus musculus) 6480464 bisphenol S results in increased methylation of SLFN2 promoter CTD PMID:33297965 Slfn2 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of SLFN2 mRNA CTD PMID:36041667 Slfn2 Rat 4,4'-sulfonyldiphenol increases expression ISO Slfn2 (Mus musculus) 6480464 bisphenol S results in increased expression of SLFN2 mRNA CTD PMID:30951980 Slfn2 Rat 4-hydroxyphenyl retinamide increases expression ISO Slfn2 (Mus musculus) 6480464 Fenretinide results in increased expression of SLFN2 mRNA CTD PMID:28973697 Slfn2 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of SLFN2 mRNA CTD PMID:31881176 Slfn2 Rat aflatoxin B1 increases methylation ISO SLFN12L (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of SLFN12L gene CTD PMID:27153756 Slfn2 Rat benzo[a]pyrene decreases methylation ISO SLFN12L (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of SLFN12L promoter CTD PMID:27901495 Slfn2 Rat benzo[a]pyrene increases expression ISO Slfn2 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of SLFN2 mRNA CTD PMID:22228805 Slfn2 Rat benzo[a]pyrene multiple interactions ISO Slfn2 (Mus musculus) 6480464 AHR protein affects the reaction [Benzo(a)pyrene affects the expression of SLFN2 mRNA] CTD PMID:22228805 Slfn2 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Slfn2 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of SLFN2 mRNA CTD PMID:39150890 Slfn2 Rat bisphenol A increases expression ISO Slfn2 (Mus musculus) 6480464 bisphenol A results in increased expression of SLFN2 mRNA CTD PMID:38701888 Slfn2 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of SLFN2 mRNA CTD PMID:36041667 Slfn2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of SLFN2 mRNA CTD PMID:34947998 Slfn2 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of SLFN12L mRNA CTD PMID:25181051 Slfn2 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of SLFN2 mRNA CTD PMID:36041667 Slfn2 Rat Butylbenzyl phthalate multiple interactions ISO Slfn2 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of SLFN2 mRNA CTD PMID:39150890 Slfn2 Rat cadmium atom increases expression ISO SLFN12L (Homo sapiens) 6480464 Cadmium results in increased expression of SLFN12L mRNA CTD PMID:24376830 Slfn2 Rat carbon nanotube increases expression ISO Slfn2 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Slfn2 Rat chloroprene decreases expression ISO Slfn2 (Mus musculus) 6480464 Chloroprene results in decreased expression of SLFN2 mRNA CTD PMID:23125180 Slfn2 Rat choline multiple interactions ISO Slfn2 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of SLFN2 mRNA CTD PMID:20938992 Slfn2 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of SLFN2 mRNA CTD PMID:27523638 Slfn2 Rat dibutyl phthalate multiple interactions ISO Slfn2 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of SLFN2 mRNA CTD PMID:39150890 Slfn2 Rat diethyl phthalate multiple interactions ISO Slfn2 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of SLFN2 mRNA CTD PMID:39150890 Slfn2 Rat diethylstilbestrol decreases expression EXP 6480464 Diethylstilbestrol results in decreased expression of SLFN2 mRNA CTD PMID:36653537 Slfn2 Rat diisobutyl phthalate multiple interactions ISO Slfn2 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of SLFN2 mRNA CTD PMID:39150890 Slfn2 Rat diisononyl phthalate multiple interactions ISO Slfn2 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of SLFN2 mRNA CTD PMID:39150890 Slfn2 Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of SLFN2 mRNA CTD PMID:25152437 Slfn2 Rat folic acid multiple interactions ISO Slfn2 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of SLFN2 mRNA CTD PMID:20938992 Slfn2 Rat Genipin multiple interactions ISO Slfn2 (Mus musculus) 6480464 genipin inhibits the reaction [Lipopolysaccharides results in increased expression of SLFN2 mRNA] CTD PMID:22687549 Slfn2 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of SLFN2 mRNA CTD PMID:22061828 and PMID:33387578 Slfn2 Rat L-methionine multiple interactions ISO Slfn2 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of SLFN2 mRNA CTD PMID:20938992 Slfn2 Rat lipopolysaccharide decreases expression ISO SLFN12L (Homo sapiens) 6480464 Lipopolysaccharides results in decreased expression of SLFN12L mRNA CTD PMID:35811015 Slfn2 Rat lipopolysaccharide multiple interactions ISO Slfn2 (Mus musculus) 6480464 genipin inhibits the reaction [Lipopolysaccharides results in increased expression of SLFN2 mRNA] CTD PMID:22687549 Slfn2 Rat lipopolysaccharide increases expression ISO Slfn2 (Mus musculus) 6480464 Lipopolysaccharides results in increased expression of SLFN2 mRNA CTD PMID:22687549 and PMID:25890327 Slfn2 Rat lipopolysaccharide multiple interactions ISO SLFN12L (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine inhibits the reaction [Lipopolysaccharides results in decreased expression of SLFN12L mRNA] CTD PMID:35811015 Slfn2 Rat maneb multiple interactions ISO Slfn2 (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in increased expression of SLFN2 mRNA CTD PMID:36117858 Slfn2 Rat N-nitrosodimethylamine decreases expression EXP 6480464 Dimethylnitrosamine results in decreased expression of SLFN2 mRNA CTD PMID:25380136 Slfn2 Rat oxaliplatin multiple interactions EXP 6480464 [Oxaliplatin co-treated with Topotecan] results in increased expression of SLFN2 mRNA CTD PMID:25729387 Slfn2 Rat oxaliplatin increases expression EXP 6480464 Oxaliplatin results in increased expression of SLFN2 mRNA CTD PMID:25729387 Slfn2 Rat ozone multiple interactions ISO Slfn2 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of SLFN2 mRNA and [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of SLFN2 mRNA CTD PMID:34911549 Slfn2 Rat paracetamol affects expression ISO Slfn2 (Mus musculus) 6480464 Acetaminophen affects the expression of SLFN2 mRNA CTD PMID:17562736 Slfn2 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of SLFN2 mRNA CTD PMID:33387578 Slfn2 Rat paraquat multiple interactions ISO Slfn2 (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in increased expression of SLFN2 mRNA CTD PMID:36117858 Slfn2 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Slfn2 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of SLFN2 mRNA CTD PMID:36331819 Slfn2 Rat resveratrol multiple interactions ISO SLFN12L (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of SLFN12L mRNA CTD PMID:23557933 Slfn2 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO SLFN12L (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine inhibits the reaction [Lipopolysaccharides results in decreased expression of SLFN12L mRNA] CTD PMID:35811015 Slfn2 Rat silicon dioxide increases expression ISO Slfn2 (Mus musculus) 6480464 Silicon Dioxide results in increased expression of SLFN2 mRNA CTD PMID:19073995 and PMID:29341224 Slfn2 Rat silver atom decreases expression ISO Slfn2 (Mus musculus) 6480464 Silver results in decreased expression of SLFN2 mRNA CTD PMID:27131904 Slfn2 Rat silver(0) decreases expression ISO Slfn2 (Mus musculus) 6480464 Silver results in decreased expression of SLFN2 mRNA CTD PMID:27131904 Slfn2 Rat succimer multiple interactions ISO Slfn2 (Mus musculus) 6480464 [Succimer binds to Magnetite Nanoparticles] which results in increased expression of SLFN2 mRNA CTD PMID:21641980 Slfn2 Rat tetrachloromethane affects expression ISO Slfn2 (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of SLFN2 mRNA CTD PMID:17484886 Slfn2 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of SLFN2 mRNA CTD PMID:34492290 Slfn2 Rat titanium dioxide increases expression ISO Slfn2 (Mus musculus) 6480464 titanium dioxide results in increased expression of SLFN2 mRNA CTD PMID:23557971 Slfn2 Rat topotecan increases expression EXP 6480464 Topotecan results in increased expression of SLFN2 mRNA CTD PMID:25729387 Slfn2 Rat topotecan multiple interactions EXP 6480464 [Oxaliplatin co-treated with Topotecan] results in increased expression of SLFN2 mRNA CTD PMID:25729387 Slfn2 Rat triphenyl phosphate affects expression ISO SLFN12L (Homo sapiens) 6480464 triphenyl phosphate affects the expression of SLFN12L mRNA CTD PMID:37042841 Slfn2 Rat triptonide increases expression ISO Slfn2 (Mus musculus) 6480464 triptonide results in increased expression of SLFN2 mRNA CTD PMID:33045310 Slfn2 Rat trovafloxacin increases expression ISO Slfn2 (Mus musculus) 6480464 trovafloxacin results in increased expression of SLFN2 mRNA CTD PMID:35537566 Slfn2 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of SLFN2 mRNA CTD PMID:22570695 and PMID:23034163 Slfn2 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of SLFN2 mRNA CTD PMID:19015723
(+)-catechin (ISO) (1->4)-beta-D-glucan (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 1-chloro-2,4-dinitrobenzene (ISO) 1-naphthyl isothiocyanate (EXP) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-diaminotoluene (ISO) 3-methylcholanthrene (ISO) 4,4'-diaminodiphenylmethane (EXP) 4,4'-sulfonyldiphenol (EXP,ISO) 4-hydroxyphenyl retinamide (ISO) acetamide (EXP) aflatoxin B1 (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (EXP) Butylbenzyl phthalate (ISO) cadmium atom (ISO) carbon nanotube (ISO) chloroprene (ISO) choline (ISO) Cuprizon (EXP) dibutyl phthalate (ISO) diethyl phthalate (ISO) diethylstilbestrol (EXP) diisobutyl phthalate (ISO) diisononyl phthalate (ISO) diuron (EXP) folic acid (ISO) Genipin (ISO) gentamycin (EXP) L-methionine (ISO) lipopolysaccharide (ISO) maneb (ISO) N-nitrosodimethylamine (EXP) oxaliplatin (EXP) ozone (ISO) paracetamol (EXP,ISO) paraquat (ISO) perfluorooctane-1-sulfonic acid (ISO) resveratrol (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) silicon dioxide (ISO) silver atom (ISO) silver(0) (ISO) succimer (ISO) tetrachloromethane (ISO) thioacetamide (EXP) titanium dioxide (ISO) topotecan (EXP) triphenyl phosphate (ISO) triptonide (ISO) trovafloxacin (ISO) vinclozolin (EXP)
Slfn2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 68,450,861 - 68,457,198 (+) NCBI GRCr8 mRatBN7.2 10 67,953,322 - 67,959,659 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 67,953,171 - 67,959,458 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 72,573,354 - 72,579,691 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 72,078,736 - 72,085,073 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 67,542,782 - 67,549,119 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 70,370,381 - 70,376,718 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 70,370,300 - 70,376,331 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 70,001,084 - 70,007,628 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 71,236,408 - 71,242,745 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 71,248,325 - 71,279,012 (+) NCBI Celera 10 66,897,016 - 66,903,353 (+) NCBI Celera Cytogenetic Map 10 q26 NCBI
SLFN12L Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 35,464,254 - 35,537,678 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 35,464,249 - 35,537,683 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 33,791,273 - 33,864,697 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 30,822,269 - 30,888,993 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 17 30,708,342 - 30,775,018 (-) NCBI Celera Cytogenetic Map 17 q12 NCBI HuRef 17 29,986,904 - 29,999,709 (-) NCBI HuRef CHM1_1 17 33,866,214 - 33,879,034 (-) NCBI CHM1_1 T2T-CHM13v2.0 17 36,412,245 - 36,485,638 (-) NCBI T2T-CHM13v2.0
Slfn2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 82,955,938 - 82,961,504 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 82,955,938 - 82,961,504 (+) Ensembl GRCm39 Ensembl GRCm38 11 83,065,112 - 83,070,678 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 83,065,112 - 83,070,678 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 82,878,614 - 82,884,180 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 82,881,307 - 82,886,873 (+) NCBI MGSCv36 mm8 Celera 11 92,688,834 - 92,694,433 (+) NCBI Celera Cytogenetic Map 11 C NCBI cM Map 11 50.3 NCBI
SLFN12L Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 19 28,936,467 - 29,009,032 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 17 30,817,469 - 30,890,008 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 17 21,256,494 - 21,318,659 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 17 21,550,104 - 21,611,943 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 17 21,599,330 - 21,611,851 (+) Ensembl panpan1.1 panPan2
SLFN12L
.
Predicted Target Of
Count of predictions: 71 Count of miRNA genes: 64 Interacting mature miRNAs: 66 Transcripts: ENSRNOT00000055957 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
1549846 Scl47 Serum cholesterol level QTL 47 3.6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 50574707 95574707 Rat 152025229 Scl83 Serum cholesterol level QTL 83 4.33 blood cholesterol amount (VT:0000180) 10 35710580 68663659 Rat 1578779 Tcas10 Tongue tumor susceptibility QTL 10 3.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 10 31297439 76297439 Rat 152025227 Bw195 Body weight QTL 195 5.73 body mass (VT:0001259) 10 46989699 68663659 Rat 631565 Hcuc4 Hepatic copper content QTL 4 4.15 liver copper amount (VT:0003065) liver copper weight to liver dry weight ratio (CMO:0001512) 10 66941813 73452992 Rat 1298069 Bp168 Blood pressure QTL 168 5.5 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 10 26521957 98003205 Rat 2293669 Bmd33 Bone mineral density QTL 33 4.5 0.0001 femur strength trait (VT:0010010) femoral neck polar moment of inertia (CMO:0001670) 10 49444551 81709989 Rat 152025224 Bw193 Body weight QTL 193 6.47 body mass (VT:0001259) 10 51663405 75085664 Rat 631552 Vetf2 Vascular elastic tissue fragility QTL 2 4.5 0.0002 aorta elastic tissue integrity trait (VT:0010556) artery internal elastic lamina non-tumorous lesion count (CMO:0001913) 10 41142633 86142633 Rat 61449 Ciaa2 CIA Autoantibody QTL 2 7.1 blood autoantibody amount (VT:0003725) calculated serum anti-type 2 collagen antibody titer (CMO:0001279) 10 63221094 107211142 Rat 631557 Bp136 Blood pressure QTL 136 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 30632053 75632053 Rat 61325 Aia5 Adjuvant induced arthritis QTL 5 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1298078 Stresp5 Stress response QTL 5 2.99 0.00025 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 42045676 104670812 Rat 2293679 Bmd30 Bone mineral density QTL 30 3.5 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 10 49444551 81709989 Rat 1549831 Bss6 Bone structure and strength QTL 6 4 lumbar vertebra strength trait (VT:0010574) vertebra ultimate force (CMO:0001678) 10 57576521 102576521 Rat 70164 Bw21 Body weight QTL 21 4.36 0.00005 body mass (VT:0001259) body weight (CMO:0000012) 10 53797494 98952626 Rat 1579917 Bp282 Blood pressure QTL 282 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 67400316 68164786 Rat 61463 Bp12 Blood pressure QTL 12 6.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 41333258 86333258 Rat 8694173 Bw149 Body weight QTL 149 4.38 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 10 44441699 89441699 Rat 2300218 Hpcl2 Hepatic cholesterol level QTL 2 liver cholesterol amount (VT:0010498) liver cholesterol level (CMO:0001597) 10 45029650 95600334 Rat 1554317 Bmd4 Bone mineral density QTL 4 9.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 19816042 99406971 Rat 70171 Cari1 Carrageenan-induced inflammation QTL 1 4.9 0.0005 hypodermis integrity trait (VT:0010550) inflammatory exudate volume (CMO:0001429) 10 53797385 107211142 Rat 724527 Bp148 Blood pressure QTL 148 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 28453136 73453136 Rat 2300171 Bmd58 Bone mineral density QTL 58 4.9 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 26944628 71944628 Rat 61354 Pia10 Pristane induced arthritis QTL 10 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2301967 Cm73 Cardiac mass QTL 73 4.55 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 10 14487011 89062041 Rat 2313103 Bss80 Bone structure and strength QTL 80 2 0.0001 tibia strength trait (VT:1000284) tibia midshaft endosteal cross-sectional area (CMO:0001716) 10 62057807 107057807 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 70188 BpQTLcluster1 Blood pressure QTL cluster 1 4.864 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 42323132 87323132 Rat 12880372 Am12 Aortic mass QTL 12 0.003 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 10 66319447 68164786 Rat 2313105 Bss79 Bone structure and strength QTL 79 1.8 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 10 62057807 107057807 Rat 12880375 Kidm66 Kidney mass QTL 66 0.009 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 10 66319447 68164786 Rat 9589030 Epfw9 Epididymal fat weight QTL 9 19.24 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 10 44441699 89441699 Rat 1357344 Bp249 Blood pressure QTL 249 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 66743655 98003205 Rat 10402859 Bp381 Blood pressure QTL 381 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2316949 Gluco60 Glucose level QTL 60 3.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 14487011 107057807 Rat 2293652 Bmd22 Bone mineral density QTL 22 4.9 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 10 49444551 81709989 Rat 12880370 Cm105 Cardiac mass QTL 105 0.008 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 10 66319447 68164786 Rat 70198 BpQTLcluster9 Blood pressure QTL cluster 9 2.94 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 42323132 87323132 Rat 12880371 Cm106 Cardiac mass QTL 106 0.007 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 10 66319447 68164786 Rat 2306970 Anxrr22 Anxiety related response QTL 22 5.95 fear/anxiety-related behavior trait (VT:1000241) number of periods of voluntary immobility (CMO:0001045) 10 61345276 98211570 Rat 1359017 Hrtrt21 Heart rate QTL 21 2.4 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 10 51772940 96772940 Rat 7387312 Bw125 Body weight QTL 125 3 0.0047 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight (CMO:0000356) 10 64890616 107211142 Rat 2312672 Insul15 Insulin level QTL 15 0.01 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 10 57134272 102134272 Rat 2317029 Aia19 Adjuvant induced arthritis QTL 19 2.98 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 10 66978955 107211142 Rat 724556 Pur2 Proteinuria QTL 2 5.5 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 10 22427500 90627625 Rat 8662860 Vetf10 Vascular elastic tissue fragility QTL 10 artery integrity trait (VT:0010639) number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562) 10 6154182 73453136 Rat 61387 Bp1 Blood pressure QTL 1 5.1 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 51770177 107211142 Rat 2317039 Aia6 Adjuvant induced arthritis QTL 6 4.31 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 10 66978955 107211142 Rat 70223 Bp57 Blood pressure QTL 57 5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 1 80676123 Rat 2317043 Aia7 Adjuvant induced arthritis QTL 7 3.82 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 10 37565079 82565079 Rat 2317042 Aia20 Adjuvant induced arthritis QTL 20 3.38 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 10 37565079 82565079 Rat 2298481 Eau9 Experimental allergic uveoretinitis QTL 9 0.0169 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 10 65927233 82565079 Rat 70363 Bp71 Blood pressure QTL 71 0.04 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 61345276 81714865 Rat 61402 Niddm3 Non-insulin dependent diabetes mellitus QTL 3 4.58 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 61345413 82564856 Rat 1331791 Cm31 Cardiac mass QTL 31 3.84606 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 29299504 107211142 Rat 70364 Bp72 Blood pressure QTL 72 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 51121100 96121100 Rat 10450498 Bp384 Blood pressure QTL 384 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 67750049 107211142 Rat 2293698 Bss43 Bone structure and strength QTL 43 5.33 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 10 59209888 104209888 Rat 631530 Tls3 T-lymphoma susceptibility QTL 3 0 0.0001 thymus integrity trait (VT:0010555) percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911) 10 51774612 95600334 Rat 2289985 Bp305 Blood pressure QTL 305 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 67502108 73579767 Rat 1354608 Cm33 Cardiac mass QTL 33 2.8 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 10 54809292 99809292 Rat 1558643 Cm44 Cardiac mass QTL 44 4.8 0.0000368 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 61345276 99703528 Rat 631535 Cm51 Cardiac mass QTL 51 3 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 10 51786282 91669536 Rat 1576319 Cia29 Collagen induced arthritis QTL 29 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 33973921 78973921 Rat 8552805 Bw145 Body weight QTL 145 2.2 body mass (VT:0001259) change in body weight to body weight ratio (CMO:0002216) 10 41944526 78307017 Rat 631267 Cia20 Collagen induced arthritis QTL 20 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2293705 Bmd25 Bone mineral density QTL 25 7.1 0.0001 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 10 49444551 81709989 Rat 1576308 Schws1 Schwannoma susceptibility QTL 1 0.0041 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 10 40035094 102359817 Rat 631269 Cia22 Collagen induced arthritis QTL 22 8.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 631268 Cia21 Collagen induced arthritis QTL 21 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 14487011 104060283 Rat 7207811 Bmd90 Bone mineral density QTL 90 5.2 femur size trait (VT:1000369) femoral neck cross-sectional area (CMO:0001697) 10 49444551 81709989 Rat 1576311 Pia26 Pristane induced arthritis QTL 26 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 31224026 75632053 Rat 631270 Cia23 Collagen induced arthritis QTL 23 3.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 7411614 Foco18 Food consumption QTL 18 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 10 44441699 89441699 Rat 6893336 Cm75 Cardiac mass QTL 75 0.1 0.87 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 10 61345276 99703528 Rat 631547 Bp87 Blood pressure QTL 87 4.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 47369470 92369470 Rat 61427 Cia16 Collagen induced arthritis QTL 16 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 6357896 96121100 Rat 2312662 Slep8 Serum leptin concentration QTL 8 0.05 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 10 57134272 102134272 Rat 6893342 Cm78 Cardiac mass QTL 78 0.1 0.88 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 10 42876766 79813922 Rat 2292440 Bp312 Blood pressure QTL 312 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 67750049 68164786 Rat 2292441 Bp308 Blood pressure QTL 308 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 631542 Bp82 Blood pressure QTL 82 6.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 26521957 98952741 Rat 2312668 Scl65 Serum cholesterol level QTL 65 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 57134272 102134272 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000055957 ⟹ ENSRNOP00000052810
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 67,953,171 - 67,959,458 (+) Ensembl Rnor_6.0 Ensembl 10 70,370,300 - 70,376,331 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000076536 ⟹ ENSRNOP00000068166
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 67,953,260 - 67,959,266 (+) Ensembl Rnor_6.0 Ensembl 10 70,370,447 - 70,376,331 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000094055 ⟹ ENSRNOP00000090704
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 67,953,227 - 67,959,456 (+) Ensembl
RefSeq Acc Id:
NM_001107031 ⟹ NP_001100501
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 68,450,861 - 68,457,198 (+) NCBI mRatBN7.2 10 67,953,322 - 67,959,659 (+) NCBI Rnor_6.0 10 70,370,381 - 70,376,718 (+) NCBI Rnor_5.0 10 70,001,084 - 70,007,628 (+) NCBI RGSC_v3.4 10 71,236,408 - 71,242,745 (+) RGD Celera 10 66,897,016 - 66,903,353 (+) RGD
Sequence:
CTTCAATGCAGCAAAGAACAGAGAACTCAAGTGAGCTTAGAGGTGAGCTCACAGCCAGGGCTGCAGATAGAACTCTCCCAAGTGCCAACAACCAGCCTCGAAGACGTCCCCGGCCAGGACTTGTTGCA
hide sequence
RefSeq Acc Id:
XM_039086039 ⟹ XP_038941967
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 68,450,963 - 68,456,809 (+) NCBI mRatBN7.2 10 67,953,453 - 67,959,272 (+) NCBI
RefSeq Acc Id:
NP_001100501 ⟸ NM_001107031
- UniProtKB:
A6HHF9 (UniProtKB/TrEMBL), A0A096MJK8 (UniProtKB/TrEMBL)
- Sequence:
MGAGLHAAEQDNHRAHRKGTGQQNAKAAGKMGISVDLEAEYAKLGLNLGAITLGEKDRRKMKNSHLRKKENENISLAVCALLNSGGGAIKVKIENENYSLTRDGLGLDLETSLCKCLPFVQWYLDFTE
hide sequence
Ensembl Acc Id:
ENSRNOP00000052810 ⟸ ENSRNOT00000055957
Ensembl Acc Id:
ENSRNOP00000068166 ⟸ ENSRNOT00000076536
RefSeq Acc Id:
XP_038941967 ⟸ XM_039086039
- Peptide Label:
isoform X1
- UniProtKB:
D4A2D6 (UniProtKB/TrEMBL), A0A096MJK8 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000090704 ⟸ ENSRNOT00000094055
RGD ID: 13697524 Promoter ID: EPDNEW_R8049 Type: initiation region Name: Slfn2_1 Description: schlafen 2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 10 70,370,340 - 70,370,400 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2019-10-04
Slfn2
schlafen family member 2
Slfn2
schlafen 2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Slfn2
schlafen 2
Slfn2_predicted
schlafen 2 (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Slfn2_predicted
schlafen 2 (predicted)
Symbol and Name status set to approved
70820 APPROVED
