Symbol:
Stoml2
Name:
stomatin like 2
RGD ID:
1308285
Description:
Predicted to enable GTPase binding activity; T cell receptor binding activity; and cardiolipin binding activity. Predicted to be involved in several processes, including positive regulation of interleukin-2 production; proton motive force-driven mitochondrial ATP synthesis; and stress-induced mitochondrial fusion. Predicted to act upstream of or within T cell receptor signaling pathway. Predicted to be located in several cellular components, including immunological synapse; membrane raft; and mitochondrial envelope. Predicted to be active in mitochondrion. Orthologous to human STOML2 (stomatin like 2); PARTICIPATES IN mitochondria fusion pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dibromophenyl 2,4,5-tribromophenyl ether.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC298203; MGC116331; SLP-2; stomatin (Epb7.2)-like 2; stomatin-like protein 2; stomatin-like protein 2, mitochondrial
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
STOML2 (stomatin like 2) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Stoml2 (stomatin (Epb7.2)-like 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Stoml2 (stomatin like 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
STOML2 (stomatin like 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
STOML2 (stomatin like 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Stoml2 (stomatin like 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
STOML2 (stomatin like 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
STOML2 (stomatin like 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Stoml2 (stomatin like 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
STOML2 (stomatin like 2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Stoml2 (stomatin (Epb7.2)-like 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
stoml2 (stomatin (EPB72)-like 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Stoml2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
stl-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
stoml2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 62,052,042 - 62,055,639 (-) NCBI GRCr8 mRatBN7.2 5 57,256,227 - 57,259,824 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 57,256,220 - 57,259,920 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 59,229,312 - 59,232,909 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 61,048,128 - 61,051,725 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 61,033,300 - 61,036,897 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 58,472,561 - 58,476,158 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 58,472,550 - 58,476,251 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 62,998,097 - 63,001,694 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 59,518,467 - 59,522,064 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 59,518,582 - 59,522,264 (-) NCBI Celera 5 55,844,984 - 55,848,581 (-) NCBI Celera Cytogenetic Map 5 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Stoml2 Rat 1,2-dimethylhydrazine increases expression ISO Stoml2 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of STOML2 mRNA CTD PMID:22206623 Stoml2 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of STOML2 protein CTD PMID:32145629 Stoml2 Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO Stoml2 (Mus musculus) 6480464 2 more ... CTD PMID:31388691 Stoml2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of STOML2 mRNA CTD PMID:21215274 Stoml2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of STOML2 mRNA CTD PMID:33387578 Stoml2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Stoml2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of STOML2 mRNA CTD PMID:21570461 Stoml2 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether increases expression EXP 6480464 2 more ... CTD PMID:19954255 Stoml2 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether increases expression ISO Stoml2 (Mus musculus) 6480464 2 more ... CTD PMID:18550172 Stoml2 Rat 2,6-dimethoxyphenol multiple interactions ISO STOML2 (Homo sapiens) 6480464 [pyrogallol 1 and 3-dimethyl ether co-treated with Furaldehyde] results in increased expression of and affects the localization of STOML2 protein CTD PMID:38598786 Stoml2 Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of STOML2 protein CTD PMID:34915118 Stoml2 Rat 4,4'-diaminodiphenylmethane decreases expression ISO Stoml2 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of STOML2 mRNA CTD PMID:18648102 Stoml2 Rat 4,4'-sulfonyldiphenol increases expression ISO Stoml2 (Mus musculus) 6480464 bisphenol S results in increased expression of STOML2 mRNA CTD PMID:39298647 Stoml2 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of STOML2 mRNA CTD PMID:31881176 Stoml2 Rat aflatoxin B1 decreases methylation ISO STOML2 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of STOML2 gene CTD PMID:27153756 Stoml2 Rat all-trans-retinoic acid decreases expression ISO STOML2 (Homo sapiens) 6480464 Tretinoin results in decreased expression of STOML2 mRNA CTD PMID:23724009 and PMID:33167477 Stoml2 Rat arsenite(3-) multiple interactions ISO STOML2 (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to STOML2 mRNA] CTD PMID:32406909 Stoml2 Rat arsenous acid multiple interactions ISO STOML2 (Homo sapiens) 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to STOML2 protein] CTD PMID:26598702 Stoml2 Rat benzo[a]pyrene decreases expression ISO Stoml2 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of STOML2 mRNA CTD PMID:22228805 Stoml2 Rat benzo[a]pyrene multiple interactions ISO STOML2 (Homo sapiens) 6480464 PARG affects the reaction [Benzo(a)pyrene results in increased expression of STOML2 protein] CTD PMID:25628927 Stoml2 Rat benzo[a]pyrene increases expression ISO STOML2 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of STOML2 protein CTD PMID:25628927 Stoml2 Rat bisphenol A decreases expression ISO Stoml2 (Mus musculus) 6480464 bisphenol A results in decreased expression of STOML2 mRNA CTD PMID:26063408 Stoml2 Rat bisphenol A increases expression ISO STOML2 (Homo sapiens) 6480464 bisphenol A results in increased expression of STOML2 protein CTD PMID:37567409 Stoml2 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of STOML2 mRNA CTD PMID:25181051 and PMID:34947998 Stoml2 Rat bisphenol F increases expression ISO STOML2 (Homo sapiens) 6480464 bisphenol F results in increased expression of STOML2 protein CTD PMID:34186270 Stoml2 Rat cadmium dichloride decreases methylation EXP 6480464 Cadmium Chloride results in decreased methylation of STOML2 promoter CTD PMID:22457795 Stoml2 Rat carbon nanotube increases expression ISO Stoml2 (Mus musculus) 6480464 Nanotubes and Carbon results in increased expression of STOML2 mRNA CTD PMID:25554681 Stoml2 Rat CGP 52608 multiple interactions ISO STOML2 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to STOML2 gene] CTD PMID:28238834 Stoml2 Rat chloropicrin increases expression ISO STOML2 (Homo sapiens) 6480464 chloropicrin results in increased expression of STOML2 mRNA CTD PMID:26352163 Stoml2 Rat cobalt dichloride decreases expression ISO STOML2 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of STOML2 mRNA CTD PMID:19320972 Stoml2 Rat copper(II) sulfate decreases expression ISO STOML2 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of STOML2 mRNA CTD PMID:19549813 Stoml2 Rat diarsenic trioxide multiple interactions ISO STOML2 (Homo sapiens) 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to STOML2 protein] CTD PMID:26598702 Stoml2 Rat dibenzo[a,l]pyrene decreases expression ISO Stoml2 (Mus musculus) 6480464 dibenzo(a and l)pyrene results in decreased expression of STOML2 mRNA CTD PMID:25908611 Stoml2 Rat dibutyl phthalate decreases expression ISO Stoml2 (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of STOML2 mRNA CTD PMID:21266533 Stoml2 Rat elemental selenium increases expression ISO STOML2 (Homo sapiens) 6480464 Selenium results in increased expression of STOML2 mRNA CTD PMID:19244175 Stoml2 Rat enzyme inhibitor multiple interactions ISO STOML2 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of STOML2 protein CTD PMID:23301498 Stoml2 Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of STOML2 mRNA CTD PMID:24136188 Stoml2 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of STOML2 mRNA CTD PMID:24136188 Stoml2 Rat FR900359 increases phosphorylation ISO STOML2 (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of STOML2 protein CTD PMID:37730182 Stoml2 Rat furfural multiple interactions ISO STOML2 (Homo sapiens) 6480464 [pyrogallol 1 more ... CTD PMID:38598786 Stoml2 Rat ivermectin decreases expression ISO STOML2 (Homo sapiens) 6480464 Ivermectin results in decreased expression of STOML2 protein CTD PMID:32959892 Stoml2 Rat lipopolysaccharide multiple interactions ISO STOML2 (Homo sapiens) 6480464 [NAT10 protein affects the susceptibility to Lipopolysaccharides] which affects the expression of STOML2 mRNA CTD PMID:35877022 Stoml2 Rat methylparaben increases expression ISO STOML2 (Homo sapiens) 6480464 methylparaben results in increased expression of STOML2 mRNA CTD PMID:31745603 Stoml2 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of STOML2 mRNA CTD PMID:24136188 Stoml2 Rat nimesulide increases expression EXP 6480464 nimesulide results in increased expression of STOML2 mRNA CTD PMID:24136188 Stoml2 Rat ozone decreases expression EXP 6480464 Ozone results in decreased expression of STOML2 protein CTD PMID:33146391 Stoml2 Rat paracetamol decreases expression ISO STOML2 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of STOML2 mRNA CTD PMID:25704631 Stoml2 Rat paraquat decreases expression ISO STOML2 (Homo sapiens) 6480464 Paraquat results in decreased expression of STOML2 protein CTD PMID:34064677 Stoml2 Rat perfluorooctanoic acid increases expression ISO STOML2 (Homo sapiens) 6480464 perfluorooctanoic acid results in increased expression of STOML2 protein CTD PMID:22609092 Stoml2 Rat pirinixic acid decreases expression ISO Stoml2 (Mus musculus) 6480464 pirinixic acid results in decreased expression of STOML2 mRNA CTD PMID:18445702 Stoml2 Rat pirinixic acid increases expression ISO Stoml2 (Mus musculus) 6480464 pirinixic acid results in increased expression of STOML2 mRNA CTD PMID:23811191 Stoml2 Rat resveratrol increases expression ISO Stoml2 (Mus musculus) 6480464 resveratrol results in increased expression of STOML2 protein CTD PMID:25505154 Stoml2 Rat resveratrol multiple interactions ISO STOML2 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of STOML2 mRNA CTD PMID:23557933 Stoml2 Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of STOML2 protein CTD PMID:35544339 Stoml2 Rat SB 431542 multiple interactions ISO STOML2 (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in increased expression of STOML2 protein CTD PMID:37664457 Stoml2 Rat selenium atom increases expression ISO STOML2 (Homo sapiens) 6480464 Selenium results in increased expression of STOML2 mRNA CTD PMID:19244175 Stoml2 Rat sodium arsenite decreases expression ISO STOML2 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of STOML2 mRNA CTD PMID:38568856 Stoml2 Rat sodium chloride multiple interactions ISO STOML2 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of STOML2 protein CTD PMID:38598786 Stoml2 Rat sodium fluoride increases expression ISO Stoml2 (Mus musculus) 6480464 Sodium Fluoride results in increased expression of STOML2 protein CTD PMID:27548804 Stoml2 Rat sulindac increases expression EXP 6480464 Sulindac results in increased expression of STOML2 mRNA CTD PMID:24136188 Stoml2 Rat T-2 toxin affects expression EXP 6480464 T-2 Toxin affects the expression of STOML2 protein CTD PMID:26141394 Stoml2 Rat thiram decreases expression ISO STOML2 (Homo sapiens) 6480464 Thiram results in decreased expression of STOML2 mRNA CTD PMID:38568856 Stoml2 Rat titanium dioxide decreases methylation ISO Stoml2 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of STOML2 gene CTD PMID:35295148 Stoml2 Rat trimellitic anhydride increases expression ISO Stoml2 (Mus musculus) 6480464 trimellitic anhydride results in increased expression of STOML2 mRNA CTD PMID:19042947 Stoml2 Rat vitamin E increases expression ISO STOML2 (Homo sapiens) 6480464 Vitamin E results in increased expression of STOML2 mRNA CTD PMID:19244175 Stoml2 Rat zearalenone increases expression ISO Stoml2 (Mus musculus) 6480464 Zearalenone results in increased expression of STOML2 protein CTD PMID:25058043
1,2-dimethylhydrazine (ISO) 17beta-estradiol (EXP) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP,ISO) 2,6-dimethoxyphenol (ISO) 3-chloropropane-1,2-diol (EXP) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) acetamide (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) arsenite(3-) (ISO) arsenous acid (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) cadmium dichloride (EXP) carbon nanotube (ISO) CGP 52608 (ISO) chloropicrin (ISO) cobalt dichloride (ISO) copper(II) sulfate (ISO) diarsenic trioxide (ISO) dibenzo[a,l]pyrene (ISO) dibutyl phthalate (ISO) elemental selenium (ISO) enzyme inhibitor (ISO) finasteride (EXP) flutamide (EXP) FR900359 (ISO) furfural (ISO) ivermectin (ISO) lipopolysaccharide (ISO) methylparaben (ISO) nefazodone (EXP) nimesulide (EXP) ozone (EXP) paracetamol (ISO) paraquat (ISO) perfluorooctanoic acid (ISO) pirinixic acid (ISO) resveratrol (ISO) rotenone (EXP) SB 431542 (ISO) selenium atom (ISO) sodium arsenite (ISO) sodium chloride (ISO) sodium fluoride (ISO) sulindac (EXP) T-2 toxin (EXP) thiram (ISO) titanium dioxide (ISO) trimellitic anhydride (ISO) vitamin E (ISO) zearalenone (ISO)
Biological Process
biological_process (ND) CD4-positive, alpha-beta T cell activation (IEA,ISO,ISS) intracellular calcium ion homeostasis (IEA,ISO,ISS) lipid localization (IEA,ISO,ISS) mitochondrial protein processing (IEA,ISO,ISS) mitochondrion localization (ISO) mitochondrion organization (IBA,IEA,ISO,ISS) positive regulation of interleukin-2 production (IEA,ISO,ISS) protein complex oligomerization (IEA,ISO,ISS) proton motive force-driven mitochondrial ATP synthesis (IEA,ISO) stress-induced mitochondrial fusion (IEA,ISO,ISS) T cell receptor signaling pathway (IEA,ISO,ISS)
Cellular Component
actin cytoskeleton (IEA,ISO,ISS) cytoplasm (IEA) cytoskeleton (IEA) immunological synapse (IEA,ISO,ISS) membrane (IEA) membrane raft (IEA,ISO,ISS) mitochondrial inner membrane (IEA,ISO,ISS) mitochondrial intermembrane space (IEA,ISO,ISS) mitochondrion (IBA,IEA,ISO) plasma membrane (IEA,ISO,ISS)
Stoml2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 62,052,042 - 62,055,639 (-) NCBI GRCr8 mRatBN7.2 5 57,256,227 - 57,259,824 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 57,256,220 - 57,259,920 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 59,229,312 - 59,232,909 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 61,048,128 - 61,051,725 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 61,033,300 - 61,036,897 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 58,472,561 - 58,476,158 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 58,472,550 - 58,476,251 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 62,998,097 - 63,001,694 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 59,518,467 - 59,522,064 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 59,518,582 - 59,522,264 (-) NCBI Celera 5 55,844,984 - 55,848,581 (-) NCBI Celera Cytogenetic Map 5 q22 NCBI
STOML2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 9 35,099,776 - 35,103,195 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 9 35,099,776 - 35,103,195 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 9 35,099,773 - 35,103,192 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 9 35,089,888 - 35,093,154 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 9 35,089,892 - 35,093,154 NCBI Celera 9 35,031,870 - 35,035,129 (-) NCBI Celera Cytogenetic Map 9 p13.3 NCBI HuRef 9 35,055,364 - 35,058,623 (-) NCBI HuRef CHM1_1 9 35,099,754 - 35,103,015 (-) NCBI CHM1_1 T2T-CHM13v2.0 9 35,118,954 - 35,122,373 (-) NCBI T2T-CHM13v2.0
Stoml2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 43,027,690 - 43,031,402 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 43,027,690 - 43,031,710 (-) Ensembl GRCm39 Ensembl GRCm38 4 43,027,690 - 43,031,976 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 43,027,690 - 43,031,710 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 43,040,562 - 43,044,256 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 43,048,790 - 43,052,484 (-) NCBI MGSCv36 mm8 Celera 4 43,057,751 - 43,061,444 (-) NCBI Celera Cytogenetic Map 4 A5 NCBI cM Map 4 22.99 NCBI
Stoml2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955472 1,079,578 - 1,082,486 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955472 1,079,261 - 1,082,632 (+) NCBI ChiLan1.0 ChiLan1.0
STOML2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 11 89,486,677 - 89,489,997 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 9 89,492,617 - 89,495,937 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 9 34,950,387 - 34,953,707 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 9 35,755,790 - 35,759,091 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 9 35,755,790 - 35,759,091 (-) Ensembl panpan1.1 panPan2
STOML2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 11 51,675,963 - 51,679,313 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 11 51,675,963 - 51,679,199 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 11 50,244,774 - 50,248,124 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 11 52,741,661 - 52,745,011 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 11 52,741,665 - 52,744,982 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 11 51,285,489 - 51,288,839 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 11 51,270,641 - 51,273,991 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 11 51,972,516 - 51,975,866 (-) NCBI UU_Cfam_GSD_1.0
Stoml2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 166,581,569 - 166,584,841 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936524 3,129,148 - 3,133,056 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936524 3,129,149 - 3,132,405 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
STOML2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 235,890,679 - 235,894,737 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 235,891,479 - 235,894,944 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 263,416,861 - 263,420,324 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
STOML2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 12 45,513,578 - 45,516,876 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 12 45,513,307 - 45,517,110 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 42,628,934 - 42,632,249 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Stoml2
.
Predicted Target Of
Count of predictions: 106 Count of miRNA genes: 87 Interacting mature miRNAs: 94 Transcripts: ENSRNOT00000013151 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1578776 Stresp18 Stress response QTL 18 2.9 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 5 27955440 72955440 Rat 1298067 Scl15 Serum cholesterol level QTL 15 4.8 0.001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 33215665 78215665 Rat 1300115 Hrtrt7 Heart rate QTL 7 2.76 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 5 47869062 90099692 Rat 1549845 Scl44 Serum cholesterol level QTL 44 6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 40128307 148607290 Rat 70212 Niddm25 Non-insulin dependent diabetes mellitus QTL 25 3.54 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 5 1 131345958 Rat 1358353 Srcrtb2 Stress Responsive Cort Basal QTL 2 3.48 0.003 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 5 18873947 74251464 Rat 634305 Mamtr1 Mammary tumor resistance QTL 1 0.0001 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 12789751 113558310 Rat 1331801 Rf33 Renal function QTL 33 4.149 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 5 43726656 129132602 Rat 1598807 Glom12 Glomerulus QTL 12 2.7 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 5 33215665 78215665 Rat 1302786 Kidm8 Kidney mass QTL 8 28.15 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 5 33215665 78215665 Rat 6903292 Stl28 Serum triglyceride level QTL 28 2.6 0.0073 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 5 28515489 73515489 Rat 1578766 Tcas11 Tongue tumor susceptibility QTL 11 4.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 5 46711509 161317411 Rat 1578767 Stresp17 Stress response QTL 17 4.3 0.01 blood aldosterone amount (VT:0005346) plasma aldosterone level (CMO:0000551) 5 27955440 72955440 Rat 7411561 Bw134 Body weight QTL 134 24 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 49463600 94463600 Rat 1641922 Alcrsp8 Alcohol response QTL 8 alcohol metabolism trait (VT:0015089) blood ethanol level (CMO:0000535) 5 35189153 68564008 Rat 2303615 Vencon7 Ventilatory control QTL 7 0.001 respiration trait (VT:0001943) respiration rate (CMO:0000289) 5 50983895 95983895 Rat 1576312 Emca8 Estrogen-induced mammary cancer QTL 8 4.1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 50328551 141643988 Rat 1641912 Alcrsp18 Alcohol response QTL 18 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 5 35189153 141643988 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 6903306 Scl35 Serum cholesterol QTL 35 2.6 0.0073 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 28515489 73515489 Rat 1576317 Eutr2 Estrogen induced uterine response QTL 2 0.01 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 34730116 104251008 Rat 7394712 Emca13 Estrogen-induced mammary cancer QTL 13 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 9823266 99753708 Rat 1331773 Scl26 Serum cholesterol level QTL 26 3.065 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 43726656 86724018 Rat 70189 Mcs5 Mammary carcinoma susceptibility QTL 5 10.51 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 55805606 132207589 Rat 1331771 Rf35 Renal function QTL 35 4.36965 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 5 729470 86724018 Rat 61359 Eaex Experimental allergic encephalomyelitis QTL x 3 nervous system integrity trait (VT:0010566) post-insult time to onset of experimental autoimmune encephalomyelitis (CMO:0001422) 5 55715622 100715622 Rat 8662454 Vetf3 Vascular elastic tissue fragility QTL 3 27.4 artery integrity trait (VT:0010639) number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562) 5 2282226 69540447 Rat 2290448 Scl54 Serum cholesterol level QTL 54 2.93 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 31663789 131345958 Rat 9589025 Epfw7 Epididymal fat weight QTL 7 20.66 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 5 49463600 94463600 Rat 2303574 Gluco42 Glucose level QTL 42 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 5 53496719 98496719 Rat 1641903 Alcrsp3 Alcohol response QTL 3 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 5 12689285 57689285 Rat 1331756 Rf34 Renal function QTL 34 4.16275 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 5 1 90450412 Rat 8552954 Pigfal14 Plasma insulin-like growth factor 1 level QTL 14 9 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 21226744 66226744 Rat 2316959 Gluco59 Glucose level QTL 59 4.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 5 34944474 113558310 Rat 1600358 Mamtr5 Mammary tumor resistance QTL 5 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 18873947 63873947 Rat
RH143927
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 5 62,054,339 - 62,054,758 (+) Marker Load Pipeline mRatBN7.2 5 57,258,524 - 57,258,943 (+) MAPPER mRatBN7.2 Rnor_6.0 5 58,474,859 - 58,475,277 NCBI Rnor6.0 Rnor_5.0 5 63,000,395 - 63,000,813 UniSTS Rnor5.0 RGSC_v3.4 5 59,520,765 - 59,521,183 UniSTS RGSC3.4 Celera 5 55,847,282 - 55,847,700 UniSTS RH 3.4 Map 5 273.93 UniSTS Cytogenetic Map 5 q22 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000013151 ⟹ ENSRNOP00000013151
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 57,256,220 - 57,259,920 (-) Ensembl Rnor_6.0 Ensembl 5 58,472,550 - 58,476,251 (-) Ensembl
RefSeq Acc Id:
NM_001031646 ⟹ NP_001026816
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 62,052,042 - 62,055,639 (-) NCBI mRatBN7.2 5 57,256,227 - 57,259,824 (-) NCBI Rnor_6.0 5 58,472,561 - 58,476,158 (-) NCBI Rnor_5.0 5 62,998,097 - 63,001,694 (-) NCBI RGSC_v3.4 5 59,518,467 - 59,522,064 (-) RGD Celera 5 55,844,984 - 55,848,581 (-) RGD
Sequence:
AATGCTGGCGCGCGCGGCGCGGGGCACTGGAGCCCTTTTGCTGAGGGGCTCCGTGCAGGCTTCTGGCCGCATTCCGCGCCGCGCCTCCTCTGGACTGCCCCGAAACACCGTGATACTGTTTGTGCCTC
hide sequence
RefSeq Acc Id:
NP_001026816 ⟸ NM_001031646
- UniProtKB:
Q4FZT0 (UniProtKB/Swiss-Prot), A6IJ00 (UniProtKB/TrEMBL)
- Sequence:
MLARAARGTGALLLRGSVQASGRIPRRASSGLPRNTVILFVPQQEAWVVERMGRFHRILEPGLNVLIPVLDRIRYVQSLKEIVINVPEQSAVTLDNVTLQIDGVLYLRIMDPYKASYGVEDPEYAVTQ
hide sequence
Ensembl Acc Id:
ENSRNOP00000013151 ⟸ ENSRNOT00000013151
RGD ID: 13693669 Promoter ID: EPDNEW_R4194 Type: multiple initiation site Name: Stoml2_1 Description: stomatin like 2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 5 58,476,189 - 58,476,249 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-12-09
Stoml2
stomatin like 2
Stoml2
stomatin (Epb7.2)-like 2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-12-06
Stoml2
stomatin (Epb7.2)-like 2
Stoml2_predicted
stomatin (Epb7.2)-like 2 (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-12
Stoml2_predicted
stomatin (Epb7.2)-like 2 (predicted)
Symbol and Name status set to approved
70820 APPROVED
