Symbol:
Heatr3
Name:
HEAT repeat containing 3
RGD ID:
1308267
Description:
Predicted to enable unfolded protein binding activity. Predicted to be involved in erythrocyte maturation; protein import into nucleus; and ribosomal large subunit biogenesis. Human ortholog(s) of this gene implicated in Diamond-Blackfan anemia. Orthologous to human HEATR3 (HEAT repeat containing 3); INTERACTS WITH 4,4'-sulfonyldiphenol; alpha-Zearalanol; amphetamine.
Type:
protein-coding
RefSeq Status:
MODEL
Previously known as:
HEAT repeat-containing protein 3; LOC361375; RGD1308267; similar to hypothetical protein FLJ20718
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
HEATR3 (HEAT repeat containing 3) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Heatr3 (HEAT repeat containing 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Heatr3 (HEAT repeat containing 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
HEATR3 (HEAT repeat containing 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
HEATR3 (HEAT repeat containing 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Heatr3 (HEAT repeat containing 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
HEATR3 (HEAT repeat containing 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
HEATR3 (HEAT repeat containing 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Heatr3 (HEAT repeat containing 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
XPO4 (exportin 4) HGNC
OMA
Alliance orthologs 3
Mus musculus (house mouse):
Heatr3 (HEAT repeat containing 3)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
HEATR3 (HEAT repeat containing 3)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
heatr3 (HEAT repeat containing 3)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG10286
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):
SYO1
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder|PANTHER)
Xenopus tropicalis (tropical clawed frog):
heatr3
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 19 35,065,915 - 35,103,779 (-) NCBI GRCr8 mRatBN7.2 19 18,892,477 - 18,930,502 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 19 18,893,144 - 18,930,509 (-) Ensembl mRatBN7.2 Ensembl Rnor_6.0 19 19,858,419 - 19,896,782 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 19 19,858,416 - 19,896,421 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 19 30,883,214 - 30,921,221 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 19 20,204,999 - 20,242,364 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 19 20,210,399 - 20,247,067 (-) NCBI Celera 19 18,777,148 - 18,815,511 (-) NCBI Celera Cytogenetic Map 19 p11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Heatr3 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO RGD:1602884 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of HEATR3 mRNA CTD PMID:22079256 Heatr3 Rat 1,2-dimethylhydrazine increases expression ISO RGD:1332478 6480464 1,2-Dimethylhydrazine results in increased expression of HEATR3 mRNA CTD PMID:22206623 Heatr3 Rat 17beta-estradiol decreases expression ISO RGD:1602884 6480464 Estradiol results in decreased expression of HEATR3 mRNA CTD PMID:20106945 Heatr3 Rat 17beta-estradiol increases expression ISO RGD:1602884 6480464 Estradiol results in increased expression of HEATR3 mRNA CTD PMID:31614463 Heatr3 Rat 17beta-estradiol increases expression ISO RGD:1332478 6480464 Estradiol results in increased expression of HEATR3 mRNA CTD PMID:39298647 Heatr3 Rat 17beta-estradiol affects expression ISO RGD:1602884 6480464 Estradiol affects the expression of HEATR3 mRNA CTD PMID:21632981 Heatr3 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1332478 6480464 Tetrachlorodibenzodioxin affects the expression of HEATR3 mRNA CTD PMID:21570461 Heatr3 Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:1332478 6480464 bisphenol S results in increased expression of HEATR3 mRNA CTD PMID:39298647 Heatr3 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of more ... CTD PMID:36041667 Heatr3 Rat all-trans-retinoic acid decreases expression ISO RGD:1602884 6480464 Tretinoin results in decreased expression of HEATR3 mRNA CTD PMID:33167477 Heatr3 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of HEATR3 mRNA CTD PMID:35163327 Heatr3 Rat amphetamine decreases expression EXP 6480464 Amphetamine results in decreased expression of HEATR3 mRNA CTD PMID:30779732 Heatr3 Rat atrazine decreases expression ISO RGD:1602884 6480464 Atrazine results in decreased expression of HEATR3 mRNA CTD PMID:22378314 Heatr3 Rat benzo[a]pyrene decreases expression ISO RGD:1602884 6480464 Benzo(a)pyrene results in decreased expression of HEATR3 mRNA CTD PMID:20064835|PMID:21632981 Heatr3 Rat benzo[a]pyrene increases methylation ISO RGD:1602884 6480464 Benzo(a)pyrene results in increased methylation of HEATR3 promoter CTD PMID:27901495 Heatr3 Rat bis(2-ethylhexyl) phthalate decreases expression ISO RGD:1332478 6480464 Diethylhexyl Phthalate results in decreased expression of HEATR3 mRNA CTD PMID:34319233 Heatr3 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of HEATR3 mRNA CTD PMID:25181051 Heatr3 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of more ... CTD PMID:36041667 Heatr3 Rat bisphenol F increases expression ISO RGD:1332478 6480464 bisphenol F results in increased expression of HEATR3 mRNA CTD PMID:38685157 Heatr3 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of more ... CTD PMID:36041667 Heatr3 Rat butan-1-ol multiple interactions ISO RGD:1602884 6480464 [[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic more ... CTD PMID:29432896 Heatr3 Rat cadmium dichloride decreases expression ISO RGD:1602884 6480464 Cadmium Chloride results in decreased expression of HEATR3 mRNA CTD PMID:38568856 Heatr3 Rat caffeine decreases phosphorylation ISO RGD:1602884 6480464 Caffeine results in decreased phosphorylation of HEATR3 protein CTD PMID:35688186 Heatr3 Rat cisplatin increases expression ISO RGD:1602884 6480464 Cisplatin results in increased expression of HEATR3 mRNA CTD PMID:27392435 Heatr3 Rat cobalt dichloride decreases expression ISO RGD:1602884 6480464 cobaltous chloride results in decreased expression of HEATR3 mRNA CTD PMID:19320972 Heatr3 Rat copper(II) sulfate decreases expression ISO RGD:1602884 6480464 Copper Sulfate results in decreased expression of HEATR3 mRNA CTD PMID:19549813 Heatr3 Rat cylindrospermopsin increases expression ISO RGD:1602884 6480464 cylindrospermopsin results in increased expression of HEATR3 mRNA CTD PMID:24921660 Heatr3 Rat diquat decreases expression ISO RGD:1332478 6480464 Diquat results in decreased expression of HEATR3 protein CTD PMID:36851058 Heatr3 Rat dorsomorphin multiple interactions ISO RGD:1602884 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Heatr3 Rat enzyme inhibitor multiple interactions ISO RGD:1602884 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation more ... CTD PMID:23301498 Heatr3 Rat ethyl methanesulfonate decreases expression ISO RGD:1602884 6480464 Ethyl Methanesulfonate results in decreased expression of HEATR3 mRNA CTD PMID:23649840 Heatr3 Rat ferric oxide decreases expression ISO RGD:1332478 6480464 ferric oxide analog results in decreased expression of HEATR3 mRNA CTD PMID:25086211 Heatr3 Rat formaldehyde decreases expression ISO RGD:1602884 6480464 Formaldehyde results in decreased expression of HEATR3 mRNA CTD PMID:23649840 Heatr3 Rat FR900359 decreases phosphorylation ISO RGD:1602884 6480464 FR900359 results in decreased phosphorylation of HEATR3 protein CTD PMID:37730182 Heatr3 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of HEATR3 mRNA CTD PMID:33387578 Heatr3 Rat ivermectin decreases expression ISO RGD:1602884 6480464 Ivermectin results in decreased expression of HEATR3 protein CTD PMID:32959892 Heatr3 Rat lead(0) affects expression ISO RGD:1602884 6480464 Lead affects the expression of HEATR3 mRNA CTD PMID:28903495 Heatr3 Rat manganese(II) chloride increases expression EXP 6480464 manganese chloride results in increased expression of HEATR3 mRNA CTD PMID:28801915 Heatr3 Rat methyl methanesulfonate decreases expression ISO RGD:1602884 6480464 Methyl Methanesulfonate results in decreased expression of HEATR3 mRNA CTD PMID:23649840 Heatr3 Rat methylmercury chloride decreases expression ISO RGD:1602884 6480464 methylmercuric chloride results in decreased expression of HEATR3 mRNA CTD PMID:28001369 Heatr3 Rat nickel atom increases expression ISO RGD:1602884 6480464 Nickel results in increased expression of HEATR3 mRNA CTD PMID:24768652|PMID:25583101 Heatr3 Rat ozone multiple interactions ISO RGD:1332478 6480464 [Air Pollutants results in increased abundance of Ozone] which results in increased expression of HEATR3 more ... CTD PMID:34911549 Heatr3 Rat paracetamol decreases expression ISO RGD:1602884 6480464 Acetaminophen results in decreased expression of HEATR3 mRNA CTD PMID:21420995|PMID:29067470 Heatr3 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of HEATR3 mRNA CTD PMID:33387578 Heatr3 Rat pentachlorophenol increases expression ISO RGD:1332478 6480464 Pentachlorophenol results in increased expression of HEATR3 mRNA CTD PMID:23892564 Heatr3 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of HEATR3 mRNA CTD PMID:35163327 Heatr3 Rat potassium chromate decreases expression ISO RGD:1602884 6480464 potassium chromate(VI) results in decreased expression of HEATR3 mRNA CTD PMID:22079256 Heatr3 Rat potassium chromate multiple interactions ISO RGD:1602884 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of HEATR3 mRNA CTD PMID:22079256 Heatr3 Rat quercetin decreases expression ISO RGD:1602884 6480464 Quercetin results in decreased expression of HEATR3 mRNA CTD PMID:21632981 Heatr3 Rat quinolin-8-ol decreases expression ISO RGD:1602884 6480464 Oxyquinoline results in decreased expression of HEATR3 mRNA CTD PMID:21632981 Heatr3 Rat resveratrol multiple interactions ISO RGD:1602884 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of HEATR3 mRNA CTD PMID:23557933 Heatr3 Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of HEATR3 mRNA CTD PMID:28374803 Heatr3 Rat SB 431542 multiple interactions ISO RGD:1602884 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Heatr3 Rat sodium arsenite decreases expression ISO RGD:1602884 6480464 sodium arsenite results in decreased expression of HEATR3 mRNA CTD PMID:38568856 Heatr3 Rat sodium arsenite increases expression ISO RGD:1602884 6480464 sodium arsenite results in increased expression of HEATR3 mRNA CTD PMID:34032870 Heatr3 Rat sunitinib increases expression ISO RGD:1602884 6480464 Sunitinib results in increased expression of HEATR3 mRNA CTD PMID:31533062 Heatr3 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of HEATR3 mRNA CTD PMID:34492290 Heatr3 Rat titanium dioxide increases methylation ISO RGD:1332478 6480464 titanium dioxide results in increased methylation of HEATR3 promoter CTD PMID:35295148 Heatr3 Rat triphenyl phosphate affects expression ISO RGD:1602884 6480464 triphenyl phosphate affects the expression of HEATR3 mRNA CTD PMID:37042841 Heatr3 Rat triptonide decreases expression ISO RGD:1332478 6480464 triptonide results in decreased expression of HEATR3 mRNA CTD PMID:33045310 Heatr3 Rat urethane decreases expression ISO RGD:1602884 6480464 Urethane results in decreased expression of HEATR3 mRNA CTD PMID:28818685 Heatr3 Rat valproic acid increases expression ISO RGD:1602884 6480464 Valproic Acid results in increased expression of HEATR3 mRNA CTD PMID:23179753|PMID:26272509 Heatr3 Rat valproic acid multiple interactions ISO RGD:1602884 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Heatr3 Rat vorinostat increases expression ISO RGD:1602884 6480464 vorinostat results in increased expression of HEATR3 mRNA CTD PMID:27188386
Heatr3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 19 35,065,915 - 35,103,779 (-) NCBI GRCr8 mRatBN7.2 19 18,892,477 - 18,930,502 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 19 18,893,144 - 18,930,509 (-) Ensembl mRatBN7.2 Ensembl Rnor_6.0 19 19,858,419 - 19,896,782 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 19 19,858,416 - 19,896,421 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 19 30,883,214 - 30,921,221 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 19 20,204,999 - 20,242,364 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 19 20,210,399 - 20,247,067 (-) NCBI Celera 19 18,777,148 - 18,815,511 (-) NCBI Celera Cytogenetic Map 19 p11 NCBI
HEATR3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 16 50,065,970 - 50,107,272 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 16 50,065,967 - 50,107,272 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 16 50,099,881 - 50,141,183 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 16 48,657,382 - 48,696,893 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 16 34,613,203 - 34,679,975 (+) NCBI Celera Cytogenetic Map 16 q12.1 NCBI HuRef 16 35,988,200 - 36,053,654 (+) NCBI HuRef CHM1_1 16 51,507,140 - 51,546,658 (+) NCBI CHM1_1 T2T-CHM13v2.0 16 55,863,712 - 55,905,022 (+) NCBI T2T-CHM13v2.0
Heatr3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 88,864,453 - 88,901,656 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 88,864,483 - 88,898,655 (+) Ensembl GRCm39 Ensembl GRCm38 8 88,137,885 - 88,171,952 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 88,137,855 - 88,172,027 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 90,661,784 - 90,695,851 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 91,027,990 - 91,062,057 (+) NCBI MGSCv36 mm8 Celera 8 92,409,477 - 92,444,792 (+) NCBI Celera Cytogenetic Map 8 C3 NCBI cM Map 8 43.06 NCBI
Heatr3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955433 8,183,395 - 8,224,117 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955433 8,183,701 - 8,224,117 (+) NCBI ChiLan1.0 ChiLan1.0
HEATR3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 18 59,523,229 - 59,563,729 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 16 65,428,284 - 65,469,664 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 16 30,329,163 - 30,369,658 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 16 49,212,645 - 49,251,043 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 16 49,212,645 - 49,251,043 (+) Ensembl panpan1.1 panPan2
HEATR3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 2 65,178,268 - 65,218,129 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 2 65,151,717 - 65,218,109 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 2 61,751,008 - 61,790,828 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 2 65,723,708 - 65,763,860 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 2 65,694,868 - 65,764,431 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 2 62,546,824 - 62,586,651 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 2 63,566,436 - 63,606,242 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 2 64,455,290 - 64,495,117 (-) NCBI UU_Cfam_GSD_1.0
Heatr3 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409349 56,367,114 - 56,400,056 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936475 3,188,820 - 3,222,354 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936475 3,189,008 - 3,222,242 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
HEATR3
HEATR3 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 5 35,865,090 - 35,906,611 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 5 35,865,134 - 35,908,271 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666047 40,588,241 - 40,643,761 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Heatr3
.
Predicted Target Of
Count of predictions: 61 Count of miRNA genes: 53 Interacting mature miRNAs: 56 Transcripts: ENSRNOT00000020793 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1549847 Bss8 Bone structure and strength QTL 8 4 lumbar vertebra strength trait (VT:0010574) vertebra ultimate force (CMO:0001678) 19 1 31963836 Rat 61447 Tcas1 Tongue tumor susceptibility QTL 1 6.08 tongue integrity trait (VT:0010553) squamous cell carcinoma of the tongue maximum tumor diameter (CMO:0001875) 19 2316121 47316121 Rat 631681 Cm12 Cardiac mass QTL 12 3.33 0.00053 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 19 1 28982497 Rat 9590298 Uminl5 Urine mineral level QTL 5 3.59 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 19 1 36824771 Rat 1331737 Uae29 Urinary albumin excretion QTL 29 5.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 19 4096155 55283277 Rat 2298478 Eau8 Experimental allergic uveoretinitis QTL 8 0.0163 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 19 17154433 57337602 Rat 1578764 Stresp19 Stress response QTL 19 3.6 0.001 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 19 15630201 57337602 Rat 1558656 Prcs1 Prostate cancer susceptibility QTL 1 5 prostate integrity trait (VT:0010571) percentage of study population developing ventral prostate tumorous lesions during a period of time (CMO:0000943) 19 15114598 34521833 Rat 9590090 Insglur8 Insulin/glucose ratio QTL 8 10.81 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 19 1 36824771 Rat 1331788 Rf45 Renal function QTL 45 2.818 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 19 15605023 46559041 Rat 724566 Uae12 Urinary albumin excretion QTL 12 5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 19 2187927 56457239 Rat 724565 Tcas5 Tongue tumor susceptibility QTL 5 10.04 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 19 9977753 39654489 Rat 61407 Scl12 Serum cholesterol level QTL 12 0.001 blood HDL cholesterol amount (VT:0000184) serum high density lipoprotein cholesterol level (CMO:0000361) 19 13926401 30303727 Rat 8552935 Pigfal10 Plasma insulin-like growth factor 1 level QTL 10 5.7 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 19 1 36824771 Rat 631840 Niddm38 Non-insulin dependent diabetes mellitus QTL 38 3.86 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 19 10323180 23069265 Rat 7411549 Bw130 Body weight QTL 130 5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 19 15455860 57337602 Rat 10054132 Srcrt9 Stress Responsive Cort QTL 9 2.87 0.0017 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 19 1 27355345 Rat 724518 Uae19 Urinary albumin excretion QTL 19 5.5 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 19 7457249 42983518 Rat 8694186 Bw152 Body weight QTL 152 3.34 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 19 569374 45569374 Rat 61423 Cia14 Collagen induced arthritis QTL 14 3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 19 10827970 43544039 Rat 7411590 Foco7 Food consumption QTL 7 6.8 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 19 1 24688055 Rat 631678 Cm9 Cardiac mass QTL 9 4.27 0.0001 aorta mass (VT:0002845) aorta weight (CMO:0000076) 19 1 28982497 Rat 9590250 Scort11 Serum corticosterone level QTL 11 23.45 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 19 1 36824771 Rat 2317848 Alcrsp21 Alcohol response QTL 21 1.899999976158142 0.05 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 19 3204777 48204777 Rat 9589102 Slep13 Serum leptin concentration QTL 13 4.63 0.001 blood leptin amount (VT:0005667) plasma leptin level (CMO:0000781) 19 569374 45569374 Rat 7247442 Uae39 Urinary albumin excretion QTL 39 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 19 2187927 46708701 Rat
RH131555
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 19 18,892,556 - 18,892,767 (+) MAPPER mRatBN7.2 Rnor_6.0 19 19,858,499 - 19,858,709 NCBI Rnor6.0 Rnor_5.0 19 30,883,294 - 30,883,504 UniSTS Rnor5.0 RGSC_v3.4 19 20,204,457 - 20,204,667 UniSTS RGSC3.4 Celera 19 18,777,228 - 18,777,438 UniSTS Cytogenetic Map 19 p11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000020793 ⟹ ENSRNOP00000020793
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 18,893,144 - 18,930,509 (-) Ensembl Rnor_6.0 Ensembl 19 19,858,416 - 19,896,421 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000119599 ⟹ ENSRNOP00000087597
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 18,893,144 - 18,930,077 (-) Ensembl
RefSeq Acc Id:
XM_341654 ⟹ XP_341655
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 35,065,915 - 35,103,779 (-) NCBI mRatBN7.2 19 18,892,477 - 18,930,502 (-) NCBI Rnor_6.0 19 19,858,419 - 19,896,782 (-) NCBI Rnor_5.0 19 30,883,214 - 30,921,221 (-) NCBI RGSC_v3.4 19 20,204,999 - 20,242,364 (-) RGD
Sequence:
CGTTTTTTTATGTTTATGTTAAGTTTGTCTCAGTCCCTAGCGCAGTCAAATAAGACTAGCTTGAAAGTCATTAGGCTCCTAAAACTATGGGTGGATGGGGAATGGTTCCTAAGAATGGTTAAAGAAAA
hide sequence
RefSeq Acc Id:
XP_341655 ⟸ XM_341654
- UniProtKB:
D3ZV81 (UniProtKB/TrEMBL)
- Sequence:
MGKSRTKRFKRPQFSPVGSCQAEAAATANGTGDEEDDGLAAELLEKLQHPSAEVRECACAGLARLVQQRPALPDLARRDAVRRLGPLLLDSSLAVRETAAGALRNLSACGGFDVCDDMVAKDIMTPLV
hide sequence
Ensembl Acc Id:
ENSRNOP00000020793 ⟸ ENSRNOT00000020793
Ensembl Acc Id:
ENSRNOP00000087597 ⟸ ENSRNOT00000119599
RGD ID: 13700983 Promoter ID: EPDNEW_R11504 Type: initiation region Name: Heatr3_1 Description: HEAT repeat containing 3 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 19 19,896,418 - 19,896,478 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-02-26
Heatr3
HEAT repeat containing 3
RGD1308267_predicted
similar to hypothetical protein FLJ20718 (predicted)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-01-20
RGD1308267_predicted
similar to hypothetical protein FLJ20718 (predicted)
LOC361375_predicted
Symbol and Name status set to approved
1331353 APPROVED
2005-01-12
LOC361375_predicted
similar to hypothetical protein FLJ20718 (predicted)
Symbol and Name status set to provisional
70820 PROVISIONAL
