Symbol:
Cblc
Name:
Cbl proto-oncogene C
RGD ID:
1307651
Description:
Predicted to enable several functions, including SH3 domain binding activity; phosphotyrosine residue binding activity; and signaling receptor binding activity. Predicted to be involved in several processes, including negative regulation of signal transduction; protein ubiquitination; and ubiquitin-dependent protein catabolic process. Predicted to act upstream of or within several processes, including negative regulation of neuron apoptotic process; protein stabilization; and response to glial cell derived neurotrophic factor. Predicted to be active in membrane raft and plasma membrane. Orthologous to human CBLC (Cbl proto-oncogene C); PARTICIPATES IN chronic myeloid leukemia pathway; endocytosis pathway; epidermal growth factor/neuregulin signaling pathway; INTERACTS WITH 1-naphthyl isothiocyanate; 1-nitropropane; 17alpha-ethynylestradiol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
Cas-Br-M (murine) ecotropic retroviral transforming sequence c; Casitas B-lineage lymphoma C; Cbl proto-oncogene C, E3 ubiquitin protein ligase; Cbl proto-oncogene, E3 ubiquitin protein ligase C; E3 ubiquitin-protein ligase CBL-C; LOC292699; MGC124804; RING-type E3 ubiquitin transferase CBL-C
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CBLC (Cbl proto-oncogene C) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Cblc (Casitas B-lineage lymphoma c) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Cblc (Cbl proto-oncogene C) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
CBLC (Cbl proto-oncogene C) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CBLC (Cbl proto-oncogene C) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Cblc (Cbl proto-oncogene C) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
CBLC (Cbl proto-oncogene C) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
CBLC (Cbl proto-oncogene C) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Cblc (Cbl proto-oncogene C) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
DNASE1 (deoxyribonuclease 1) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
CBLC (Cbl proto-oncogene C)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Cblc (Casitas B-lineage lymphoma c)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Cbl
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER)
Caenorhabditis elegans (roundworm):
sli-1
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 88,567,930 - 88,584,709 (-) NCBI GRCr8 mRatBN7.2 1 79,439,975 - 79,456,755 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 79,439,977 - 79,456,755 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 84,834,432 - 84,851,213 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 93,385,937 - 93,402,717 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 86,589,544 - 86,606,331 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 80,699,321 - 80,716,146 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 80,699,323 - 80,716,146 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 81,964,679 - 81,981,515 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 79,091,412 - 79,108,189 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 79,170,940 - 79,186,278 (-) NCBI Celera 1 73,898,303 - 73,914,949 (-) NCBI Celera Cytogenetic Map 1 q21 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Cblc Rat (1->4)-beta-D-glucan multiple interactions ISO Cblc (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of CBLC mRNA CTD PMID:36331819 Cblc Rat 1,2-dichloroethane decreases expression ISO Cblc (Mus musculus) 6480464 ethylene dichloride results in decreased expression of CBLC mRNA CTD PMID:28960355 Cblc Rat 1,2-dimethylhydrazine increases expression ISO Cblc (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of CBLC mRNA CTD PMID:22206623 Cblc Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of CBLC mRNA CTD PMID:30723492 Cblc Rat 1-nitropropane decreases expression EXP 6480464 1-nitropropane results in decreased expression of CBLC mRNA CTD PMID:17070881 Cblc Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of CBLC mRNA CTD PMID:17557909 Cblc Rat 17beta-estradiol multiple interactions ISO CBLC (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in decreased expression of CBLC mRNA CTD PMID:30165855 Cblc Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Cblc (Mus musculus) 6480464 Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to CBLC promoter] CTD PMID:19654925 Cblc Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Cblc (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of CBLC mRNA CTD PMID:21570461 Cblc Rat 2,4-diaminotoluene increases expression EXP 6480464 2 and 4-diaminotoluene results in increased expression of CBLC mRNA CTD PMID:17070881 Cblc Rat 2,6-diaminotoluene decreases expression EXP 6480464 2 and 6-diaminotoluene results in decreased expression of CBLC mRNA CTD PMID:17070881 Cblc Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of CBLC mRNA CTD PMID:21346803 Cblc Rat 2-acetamidofluorene increases expression EXP 6480464 2-Acetylaminofluorene results in increased expression of CBLC mRNA CTD PMID:17070881 Cblc Rat 2-nitro-p-phenylenediamine decreases expression EXP 6480464 2-nitro-4-phenylenediamine results in decreased expression of CBLC mRNA CTD PMID:17070881 Cblc Rat 2-nitropropane increases expression EXP 6480464 2-nitropropane results in increased expression of CBLC mRNA CTD PMID:17070881 Cblc Rat 4,4'-diaminodiphenylmethane increases expression ISO Cblc (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of CBLC mRNA CTD PMID:18648102 Cblc Rat 4,4'-sulfonyldiphenol decreases expression ISO Cblc (Mus musculus) 6480464 bisphenol S results in decreased expression of CBLC mRNA CTD PMID:39298647 Cblc Rat 4-acetylaminofluorene increases expression EXP 6480464 4-acetylaminofluorene results in increased expression of CBLC mRNA CTD PMID:17070881 Cblc Rat 4-nitro-1,2-phenylenediamine decreases expression EXP 6480464 1 and 2-diamino-4-nitrobenzene results in decreased expression of CBLC mRNA CTD PMID:17070881 Cblc Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of CBLC mRNA CTD PMID:28959563 Cblc Rat aflatoxin B1 decreases expression ISO CBLC (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of CBLC mRNA CTD PMID:27153756 Cblc Rat benzo[a]pyrene decreases methylation ISO CBLC (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of CBLC 5' UTR more ... CTD PMID:27901495 Cblc Rat benzo[e]pyrene decreases methylation ISO CBLC (Homo sapiens) 6480464 benzo(e)pyrene results in decreased methylation of CBLC intron CTD PMID:30157460 Cblc Rat beta-naphthoflavone multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of CBLC mRNA CTD PMID:18164116 Cblc Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of CBLC mRNA CTD PMID:25181051 more ... Cblc Rat bisphenol A increases expression ISO Cblc (Mus musculus) 6480464 bisphenol A results in increased expression of CBLC mRNA CTD PMID:32156529 and PMID:33221593 Cblc Rat bisphenol A decreases expression ISO CBLC (Homo sapiens) 6480464 bisphenol A results in decreased expression of CBLC mRNA CTD PMID:31715268 Cblc Rat bisphenol F decreases expression ISO Cblc (Mus musculus) 6480464 bisphenol F results in decreased expression of CBLC mRNA CTD PMID:38685157 Cblc Rat bromobenzene decreases expression EXP 6480464 bromobenzene results in decreased expression of CBLC mRNA CTD PMID:32479839 Cblc Rat cadmium dichloride decreases expression ISO CBLC (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of CBLC mRNA CTD PMID:38568856 Cblc Rat caffeine decreases phosphorylation ISO CBLC (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of CBLC protein CTD PMID:35688186 Cblc Rat carbon nanotube decreases expression ISO Cblc (Mus musculus) 6480464 Nanotubes and Carbon results in decreased expression of CBLC mRNA CTD PMID:25620056 Cblc Rat copper(II) chloride decreases expression ISO CBLC (Homo sapiens) 6480464 cupric chloride results in decreased expression of CBLC mRNA CTD PMID:38568856 Cblc Rat dibutyl phthalate increases expression ISO Cblc (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of CBLC mRNA CTD PMID:17361019 Cblc Rat diethyl phthalate decreases expression EXP 6480464 diethyl phthalate results in decreased expression of CBLC mRNA CTD PMID:32341500 Cblc Rat dioxygen multiple interactions ISO Cblc (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of CBLC mRNA CTD PMID:30529165 Cblc Rat dorsomorphin multiple interactions ISO CBLC (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Cblc Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of CBLC mRNA CTD PMID:29391264 Cblc Rat entinostat increases expression ISO CBLC (Homo sapiens) 6480464 entinostat results in increased expression of CBLC mRNA CTD PMID:26272509 Cblc Rat entinostat multiple interactions ISO CBLC (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CBLC mRNA CTD PMID:27188386 Cblc Rat folic acid decreases expression ISO Cblc (Mus musculus) 6480464 Folic Acid results in decreased expression of CBLC mRNA CTD PMID:25629700 Cblc Rat furan increases expression EXP 6480464 furan results in increased expression of CBLC mRNA CTD PMID:25539665 and PMID:27387713 Cblc Rat glycidol decreases expression EXP 6480464 glycidol results in decreased expression of CBLC mRNA CTD PMID:24395379 Cblc Rat inulin multiple interactions ISO Cblc (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of CBLC mRNA CTD PMID:36331819 Cblc Rat irinotecan affects expression EXP 6480464 Irinotecan affects the expression of CBLC mRNA CTD PMID:20097248 Cblc Rat methapyrilene decreases methylation ISO CBLC (Homo sapiens) 6480464 Methapyrilene results in decreased methylation of CBLC intron CTD PMID:30157460 Cblc Rat methylmercury chloride decreases expression ISO Cblc (Mus musculus) 6480464 methylmercuric chloride results in decreased expression of CBLC mRNA CTD PMID:20061341 Cblc Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of CBLC mRNA CTD PMID:18164116 Cblc Rat orphenadrine affects expression EXP 6480464 Orphenadrine affects the expression of CBLC mRNA CTD PMID:23665939 Cblc Rat ozone multiple interactions ISO Cblc (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of CBLC mRNA CTD PMID:34911549 Cblc Rat panobinostat increases expression ISO CBLC (Homo sapiens) 6480464 panobinostat results in increased expression of CBLC mRNA CTD PMID:26272509 Cblc Rat panobinostat multiple interactions ISO CBLC (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CBLC mRNA CTD PMID:27188386 Cblc Rat paracetamol increases expression ISO CBLC (Homo sapiens) 6480464 Acetaminophen results in increased expression of CBLC mRNA CTD PMID:26690555 Cblc Rat PCB138 decreases expression EXP 6480464 2 more ... CTD PMID:23829299 Cblc Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Cblc (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of CBLC mRNA more ... CTD PMID:36331819 Cblc Rat pirinixic acid multiple interactions ISO Cblc (Mus musculus) 6480464 PPARA protein affects the reaction [pirinixic acid results in decreased expression of CBLC mRNA] CTD PMID:21318169 Cblc Rat pirinixic acid decreases expression ISO Cblc (Mus musculus) 6480464 pirinixic acid results in decreased expression of CBLC mRNA CTD PMID:21318169 and PMID:23811191 Cblc Rat potassium dichromate decreases expression ISO Cblc (Mus musculus) 6480464 Potassium Dichromate results in decreased expression of CBLC mRNA CTD PMID:23608068 Cblc Rat progesterone decreases expression ISO CBLC (Homo sapiens) 6480464 Progesterone results in decreased expression of CBLC mRNA CTD PMID:21540246 Cblc Rat SB 431542 multiple interactions ISO CBLC (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Cblc Rat sodium arsenite increases expression ISO CBLC (Homo sapiens) 6480464 sodium arsenite results in increased expression of CBLC mRNA CTD PMID:24570342 Cblc Rat sodium arsenite decreases expression ISO CBLC (Homo sapiens) 6480464 sodium arsenite results in decreased expression of CBLC mRNA CTD PMID:38568856 Cblc Rat sodium arsenite decreases methylation ISO CBLC (Homo sapiens) 6480464 sodium arsenite results in decreased methylation of CBLC gene CTD PMID:24570342 Cblc Rat testosterone increases expression ISO Cblc (Mus musculus) 6480464 Testosterone deficiency results in increased expression of CBLC mRNA CTD PMID:33848595 Cblc Rat testosterone multiple interactions ISO Cblc (Mus musculus) 6480464 1 more ... CTD PMID:33848595 Cblc Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of CBLC mRNA CTD PMID:23411599 Cblc Rat thiram decreases expression ISO CBLC (Homo sapiens) 6480464 Thiram results in decreased expression of CBLC mRNA CTD PMID:38568856 Cblc Rat titanium dioxide increases expression ISO Cblc (Mus musculus) 6480464 titanium dioxide results in increased expression of CBLC mRNA CTD PMID:35295148 Cblc Rat titanium dioxide increases methylation ISO Cblc (Mus musculus) 6480464 titanium dioxide results in increased methylation of CBLC promoter CTD PMID:35295148 Cblc Rat triadimefon decreases expression ISO Cblc (Mus musculus) 6480464 triadimefon results in decreased expression of CBLC mRNA CTD PMID:16730040 Cblc Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of CBLC mRNA CTD PMID:33387578 Cblc Rat Triptolide decreases expression EXP 6480464 triptolide results in decreased expression of CBLC mRNA CTD PMID:23639586 Cblc Rat troglitazone decreases expression ISO Cblc (Mus musculus) 6480464 troglitazone results in decreased expression of CBLC mRNA CTD PMID:28973697 Cblc Rat valproic acid affects expression ISO Cblc (Mus musculus) 6480464 Valproic Acid affects the expression of CBLC mRNA CTD PMID:17963808 Cblc Rat valproic acid increases expression ISO CBLC (Homo sapiens) 6480464 Valproic Acid results in increased expression of CBLC mRNA CTD PMID:24383497
Imported Annotations - KEGG (archival)
(1->4)-beta-D-glucan (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 1-naphthyl isothiocyanate (EXP) 1-nitropropane (EXP) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4-diaminotoluene (EXP) 2,6-diaminotoluene (EXP) 2,6-dinitrotoluene (EXP) 2-acetamidofluorene (EXP) 2-nitro-p-phenylenediamine (EXP) 2-nitropropane (EXP) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-acetylaminofluorene (EXP) 4-nitro-1,2-phenylenediamine (EXP) acrylamide (EXP) aflatoxin B1 (ISO) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) beta-naphthoflavone (EXP) bisphenol A (EXP,ISO) bisphenol F (ISO) bromobenzene (EXP) cadmium dichloride (ISO) caffeine (ISO) carbon nanotube (ISO) copper(II) chloride (ISO) dibutyl phthalate (ISO) diethyl phthalate (EXP) dioxygen (ISO) dorsomorphin (ISO) endosulfan (EXP) entinostat (ISO) folic acid (ISO) furan (EXP) glycidol (EXP) inulin (ISO) irinotecan (EXP) methapyrilene (ISO) methylmercury chloride (ISO) N-nitrosodiethylamine (EXP) orphenadrine (EXP) ozone (ISO) panobinostat (ISO) paracetamol (ISO) PCB138 (EXP) perfluorooctane-1-sulfonic acid (ISO) pirinixic acid (ISO) potassium dichromate (ISO) progesterone (ISO) SB 431542 (ISO) sodium arsenite (ISO) testosterone (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) triadimefon (ISO) trichloroethene (EXP) Triptolide (EXP) troglitazone (ISO) valproic acid (ISO)
Cblc Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 88,567,930 - 88,584,709 (-) NCBI GRCr8 mRatBN7.2 1 79,439,975 - 79,456,755 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 79,439,977 - 79,456,755 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 84,834,432 - 84,851,213 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 93,385,937 - 93,402,717 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 86,589,544 - 86,606,331 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 80,699,321 - 80,716,146 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 80,699,323 - 80,716,146 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 81,964,679 - 81,981,515 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 79,091,412 - 79,108,189 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 79,170,940 - 79,186,278 (-) NCBI Celera 1 73,898,303 - 73,914,949 (-) NCBI Celera Cytogenetic Map 1 q21 NCBI
CBLC Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 19 44,777,869 - 44,800,652 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 19 44,777,869 - 44,800,652 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 19 45,281,126 - 45,303,909 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 19 49,972,988 - 49,995,731 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 19 49,972,987 - 49,995,731 NCBI Celera 19 42,085,488 - 42,107,328 (+) NCBI Celera Cytogenetic Map 19 q13.32 NCBI HuRef 19 41,713,154 - 41,735,790 (+) NCBI HuRef CHM1_1 19 45,283,856 - 45,306,632 (+) NCBI CHM1_1 T2T-CHM13v2.0 19 47,602,623 - 47,625,402 (+) NCBI T2T-CHM13v2.0
Cblc Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 19,513,643 - 19,530,734 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 19,512,806 - 19,530,734 (-) Ensembl GRCm39 Ensembl GRCm38 7 19,779,718 - 19,796,809 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 19,778,881 - 19,796,809 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 20,365,067 - 20,382,158 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 18,938,242 - 18,955,331 (-) NCBI MGSCv36 mm8 Celera 7 17,187,514 - 17,204,632 (-) NCBI Celera Cytogenetic Map 7 A3 NCBI cM Map 7 9.94 NCBI
Cblc Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955555 1,921,912 - 1,935,096 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955555 1,921,896 - 1,941,247 (+) NCBI ChiLan1.0 ChiLan1.0
CBLC Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 20 50,933,383 - 50,960,455 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 19 52,808,296 - 52,832,395 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 19 41,726,272 - 41,748,829 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 19 50,331,257 - 50,353,865 (+) NCBI panpan1.1 PanPan1.1 panPan2
CBLC Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 1 110,590,548 - 110,606,775 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 1 110,590,804 - 110,606,781 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 1 110,071,648 - 110,088,645 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 1 111,153,520 - 111,169,844 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 1 111,153,776 - 111,169,908 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 1 110,794,862 - 110,811,626 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 1 110,430,583 - 110,447,333 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 1 111,299,843 - 111,316,680 (-) NCBI UU_Cfam_GSD_1.0
Cblc
CBLC Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 51,276,544 - 51,292,549 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 51,274,717 - 51,292,546 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 47,174,865 - 47,192,017 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
CBLC Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 6 38,257,418 - 38,285,534 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 6 38,257,672 - 38,280,051 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666073 17,821,913 - 17,852,623 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Cblc
.
Predicted Target Of
Count of predictions: 67 Count of miRNA genes: 62 Interacting mature miRNAs: 65 Transcripts: ENSRNOT00000025829 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2313059 Bss55 Bone structure and strength QTL 55 3.2 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 631688 Hcas2 Hepatocarcinoma susceptibility QTL 2 3 0.0001 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 5925874 115540829 Rat 1578649 Bmd8 Bone mineral density QTL 8 4.9 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 1 49393172 94393172 Rat 1582234 Gluco18 Glucose level QTL 18 3.4 0.0003 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 78479925 123479925 Rat 1358359 Sradr1 Stress Responsive Adrenal Weight QTL 1 4.74 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 30882023 123479925 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 4889929 Bss87 Bone structure and strength QTL 87 6.7 tibia area (VT:1000281) tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722) 1 53895117 82174945 Rat 2313062 Bmd73 Bone mineral density QTL 73 3.9 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 1 11481312 82174945 Rat 8552900 Pigfal1 Plasma insulin-like growth factor 1 level QTL 1 7.4 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 1 34836858 79836858 Rat 1578654 Bss10 Bone structure and strength QTL 10 4 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 1 49393172 159356837 Rat 1554320 Bmd1 Bone mineral density QTL 1 12.2 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 509108 86060548 Rat 2302059 Pia36 Pristane induced arthritis QTL 36 3.8 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 1 43333002 88333002 Rat 2313065 Bss67 Bone structure and strength QTL 67 3.1 0.0001 tibia area (VT:1000281) tibia total energy absorbed before break (CMO:0001736) 1 11481312 82174945 Rat 1300121 Hrtrt1 Heart rate QTL 1 3.7 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 65789093 115540829 Rat 7421628 Bp361 Blood pressure QTL 361 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 66023617 118608521 Rat 2313069 Bss68 Bone structure and strength QTL 68 2.9 0.0001 tibia size trait (VT:0100001) tibia total energy absorbed before break (CMO:0001736) 1 11481312 82174945 Rat 631495 Bp96 Blood pressure QTL 96 4.52 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 22340647 102268831 Rat 2313075 Bss66 Bone structure and strength QTL 66 3.4 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 1 11481312 82174945 Rat 70225 Bp58 Blood pressure QTL 58 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32356093 162846471 Rat 631512 Scl6 Serum cholesterol level QTL 6 9.6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 1 72197680 90508767 Rat 2298545 Neuinf8 Neuroinflammation QTL 8 4.6 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 1 57336763 151090257 Rat 2313072 Bss53 Bone structure and strength QTL 53 4.3 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 1 43284731 118944897 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 2313078 Bss54 Bone structure and strength QTL 54 3.5 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 2313077 Bss69 Bone structure and strength QTL 69 3.5 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 1 11481312 82174945 Rat 1549903 Bp267 Blood pressure QTL 267 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 77876254 106047988 Rat 2313402 Anxrr24 Anxiety related response QTL 24 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 1 48963584 144267916 Rat 61342 Bp27 Blood pressure QTL 27 3.4 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 56732668 98773277 Rat 1300172 Bp172 Blood pressure QTL 172 3.56 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 32737273 90665040 Rat 4889962 Bss94 Bone structure and strength QTL 94 3.8 tibia area (VT:1000281) tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722) 1 49361465 82174945 Rat 61344 Bp29 Blood pressure QTL 29 7.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 78350581 123350581 Rat 1358192 Ept13 Estrogen-induced pituitary tumorigenesis QTL 13 3.4 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 77494165 122494165 Rat 2313094 Bss58 Bone structure and strength QTL 58 3.7 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 1 43284731 118944897 Rat 6903308 Scl36 Serum cholesterol QTL 36 2 0.0125 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 53863041 90532583 Rat 2313092 Bmd72 Bone mineral density QTL 72 2.5 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 1 11481312 82174945 Rat 2300164 Bmd44 Bone mineral density QTL 44 5.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 1 56949932 101949932 Rat 2313099 Bss56 Bone structure and strength QTL 56 2.4 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 1 43284731 118944897 Rat 2313098 Bmd70 Bone mineral density QTL 70 3.6 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 1 43284731 118944897 Rat 2313097 Bss70 Bone structure and strength QTL 70 3.5 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 1 11481312 82174945 Rat 9589820 Insglur3 Insulin/glucose ratio QTL 3 10.75 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 1 34836858 79836858 Rat 152025249 Scl82 Serum cholesterol level QTL 82 4.77 blood cholesterol amount (VT:0000180) 1 50343510 99980958 Rat 10054135 Gmadr2 Adrenal mass QTL 2 1.97 0.0129 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 77857876 122857876 Rat 7411712 Strs4 Sensitivity to stroke QTL 4 8.7 cerebrum integrity trait (VT:0010549) percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932) 1 78430536 123430536 Rat 4889919 Bss86 Bone structure and strength QTL 86 4.1 tibia area (VT:1000281) tibia midshaft total cross-sectional area (CMO:0001715) 1 53895117 82174945 Rat 8552948 Pigfal11 Plasma insulin-like growth factor 1 level QTL 11 4.7 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 1 34836858 79836858 Rat 2313051 Bss57 Bone structure and strength QTL 57 3.7 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 1 43284731 118944897 Rat 61433 Cia2 Collagen induced arthritis QTL 2 5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 1 78430754 91209302 Rat
D1Rat261
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 1 88,577,808 - 88,577,965 (+) Marker Load Pipeline mRatBN7.2 1 79,449,854 - 79,450,011 (+) MAPPER mRatBN7.2 Rnor_6.0 1 80,709,251 - 80,709,404 NCBI Rnor6.0 Rnor_5.0 1 81,974,609 - 81,974,762 UniSTS Rnor5.0 RGSC_v3.4 1 79,101,290 - 79,101,447 RGD RGSC3.4 RGSC_v3.4 1 79,101,291 - 79,101,447 UniSTS RGSC3.4 RGSC_v3.1 1 79,179,402 - 79,179,558 RGD RH 3.4 Map 1 787.1 UniSTS RH 3.4 Map 1 787.1 RGD RH 2.0 Map 1 512.2 RGD SHRSP x BN Map 1 41.1399 RGD Cytogenetic Map 1 q21 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
41
49
90
90
59
21
59
6
205
84
30
45
59
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000025829 ⟹ ENSRNOP00000025829
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 79,439,977 - 79,456,755 (-) Ensembl Rnor_6.0 Ensembl 1 80,699,323 - 80,716,146 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000092048 ⟹ ENSRNOP00000070090
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 79,443,496 - 79,456,755 (-) Ensembl Rnor_6.0 Ensembl 1 80,700,479 - 80,716,143 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000110504 ⟹ ENSRNOP00000095345
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 79,439,977 - 79,456,755 (-) Ensembl
RefSeq Acc Id:
NM_001034920 ⟹ NP_001030092
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 88,567,930 - 88,584,709 (-) NCBI mRatBN7.2 1 79,439,975 - 79,456,755 (-) NCBI Rnor_6.0 1 80,699,321 - 80,716,146 (-) NCBI Rnor_5.0 1 81,964,679 - 81,981,515 (-) NCBI RGSC_v3.4 1 79,091,412 - 79,108,189 (-) RGD Celera 1 73,898,303 - 73,914,949 (-) RGD
Sequence:
TCCCAGGCCACCCGAGCGACCCATGGCTGCGGCTACAGCCCCGCAAGGGTGGCAGTGGGGAGAGCCACGCGCGCTTGGCCGGGCGGTAAAGTTGCTCCAGCGCCTGGAAGAGCAATGCAGGGATCTCA
hide sequence
RefSeq Acc Id:
NP_001030092 ⟸ NM_001034920
- UniProtKB:
Q3KRC9 (UniProtKB/Swiss-Prot), G3V8H4 (UniProtKB/Swiss-Prot)
- Sequence:
MAAATAPQGWQWGEPRALGRAVKLLQRLEEQCRDLRLFVGPPSLRDLLPRTAQLLREVAKARSDKTRGDPEGPGGAGDFLVIYLTNLEAKGRQVAELLPHRGKKDANQDVFPEGSRFRRQLAKLALIF
hide sequence
Ensembl Acc Id:
ENSRNOP00000070090 ⟸ ENSRNOT00000092048
Ensembl Acc Id:
ENSRNOP00000025829 ⟸ ENSRNOT00000025829
Ensembl Acc Id:
ENSRNOP00000095345 ⟸ ENSRNOT00000110504
RGD ID: 13689783 Promoter ID: EPDNEW_R308 Type: multiple initiation site Name: Cblc_1 Description: Cbl proto-oncogene C SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 80,716,142 - 80,716,202 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-05-05
Cblc
Cbl proto-oncogene C
Cblc
Casitas B-lineage lymphoma C
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2016-05-04
Cblc
Casitas B-lineage lymphoma C
Cblc
Cbl proto-oncogene C, E3 ubiquitin protein ligase
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2013-07-18
Cblc
Cbl proto-oncogene C, E3 ubiquitin protein ligase
Cblc
Cbl proto-oncogene, E3 ubiquitin protein ligase C
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2012-07-13
Cblc
Cbl proto-oncogene, E3 ubiquitin protein ligase C
Cblc
Cas-Br-M (murine) ecotropic retroviral transforming sequence c
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-09-18
Cblc
Cas-Br-M (murine) ecotropic retroviral transforming sequence c
Cblc
Casitas B-lineage lymphoma c
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-12-06
Cblc
Casitas B-lineage lymphoma c
Cblc_predicted
Casitas B-lineage lymphoma c (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-12
Cblc_predicted
Casitas B-lineage lymphoma c (predicted)
Symbol and Name status set to approved
70820 APPROVED
