Symbol:
Rad18
Name:
RAD18 E3 ubiquitin protein ligase
RGD ID:
1306993
Description:
Predicted to enable several functions, including Y-form DNA binding activity; identical protein binding activity; and ubiquitin protein ligase binding activity. Predicted to be involved in positive regulation of chromosome segregation; postreplication repair; and protein monoubiquitination. Predicted to act upstream of or within several processes, including negative regulation of DNA recombination; protein autoubiquitination; and response to UV. Predicted to be located in centrosome; chromosome; and nucleus. Predicted to be part of Rad6-Rad18 complex. Predicted to be active in nucleus. Orthologous to human RAD18 (RAD18 E3 ubiquitin protein ligase); INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
E3 ubiquitin-protein ligase RAD18; LOC362412; MGC156682; RAD18 homolog; RAD18 homolog (S. cerevisiae)
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 147,291,463 - 147,376,904 (-) NCBI GRCr8 mRatBN7.2 4 145,735,654 - 145,821,102 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 145,735,654 - 145,821,069 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 151,128,531 - 151,213,335 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 146,909,335 - 146,994,147 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 145,530,588 - 145,615,388 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 144,537,329 - 144,620,606 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 144,536,729 - 144,620,731 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 207,837,216 - 207,920,089 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 148,452,664 - 148,543,743 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 148,697,688 - 148,788,534 (-) NCBI Celera 4 134,304,974 - 134,388,922 (-) NCBI Celera Cytogenetic Map 4 q42 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Rad18 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of RAD18 mRNA] CTD PMID:31150632 Rad18 Rat 1,2-dibromoethane decreases expression ISO Rad18 (Mus musculus) 6480464 Ethylene Dibromide results in decreased expression of RAD18 protein CTD PMID:22434383 Rad18 Rat 1,2-dichloroethane decreases expression ISO Rad18 (Mus musculus) 6480464 ethylene dichloride results in decreased expression of RAD18 mRNA CTD PMID:28960355 Rad18 Rat 1,2-dimethylhydrazine increases expression ISO Rad18 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of RAD18 mRNA CTD PMID:22206623 Rad18 Rat 1H-pyrazole increases expression ISO Rad18 (Mus musculus) 6480464 pyrazole results in increased expression of RAD18 mRNA CTD PMID:17945193 Rad18 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Rad18 (Mus musculus) 6480464 Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to RAD18 promoter] CTD PMID:19654925 Rad18 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of RAD18 mRNA CTD PMID:32109520 Rad18 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Rad18 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of RAD18 mRNA CTD PMID:21570461 Rad18 Rat 2-nitrotoluene decreases expression ISO Rad18 (Mus musculus) 6480464 2-nitrotoluene results in decreased expression of RAD18 protein CTD PMID:22434383 Rad18 Rat 4-hydroxyphenyl retinamide increases expression ISO Rad18 (Mus musculus) 6480464 Fenretinide results in increased expression of RAD18 mRNA CTD PMID:28973697 Rad18 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of RAD18 mRNA CTD PMID:30047161 Rad18 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of RAD18 mRNA CTD PMID:31881176 Rad18 Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of RAD18 mRNA CTD PMID:23630614 Rad18 Rat all-trans-retinoic acid decreases expression ISO RAD18 (Homo sapiens) 6480464 Tretinoin results in decreased expression of RAD18 mRNA CTD PMID:33167477 Rad18 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of RAD18 mRNA CTD PMID:30047161 Rad18 Rat arsane decreases expression ISO Rad18 (Mus musculus) 6480464 Arsenic results in decreased expression of RAD18 mRNA CTD PMID:22641096 Rad18 Rat arsenic atom decreases expression ISO Rad18 (Mus musculus) 6480464 Arsenic results in decreased expression of RAD18 mRNA CTD PMID:22641096 Rad18 Rat arsenite(3-) decreases expression ISO Rad18 (Mus musculus) 6480464 arsenite results in decreased expression of RAD18 mRNA CTD PMID:18929588 Rad18 Rat avobenzone increases expression ISO RAD18 (Homo sapiens) 6480464 avobenzone results in increased expression of RAD18 mRNA CTD PMID:31016361 Rad18 Rat belinostat decreases expression ISO Rad18 (Mus musculus) 6480464 belinostat results in decreased expression of RAD18 mRNA CTD PMID:29733868 Rad18 Rat benzo[a]pyrene decreases expression ISO RAD18 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of RAD18 mRNA CTD PMID:20064835 Rad18 Rat benzo[a]pyrene increases expression ISO RAD18 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of RAD18 mRNA CTD PMID:26238291 Rad18 Rat benzo[a]pyrene increases expression ISO Rad18 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of RAD18 mRNA CTD PMID:20713471 Rad18 Rat benzo[a]pyrene diol epoxide I decreases expression ISO RAD18 (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 and PMID:20382639 Rad18 Rat biphenyl-4-amine multiple interactions ISO RAD18 (Homo sapiens) 6480464 Acetylcysteine inhibits the reaction [4-biphenylamine results in decreased expression of RAD18 protein] CTD PMID:32433928 Rad18 Rat biphenyl-4-amine decreases expression ISO RAD18 (Homo sapiens) 6480464 4-biphenylamine results in decreased expression of RAD18 mRNA and 4-biphenylamine results in decreased expression of RAD18 protein CTD PMID:24857880 and PMID:32433928 Rad18 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of RAD18 mRNA CTD PMID:26982218 Rad18 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of RAD18 mRNA CTD PMID:32145629 Rad18 Rat bisphenol A decreases expression ISO RAD18 (Homo sapiens) 6480464 bisphenol A results in decreased expression of RAD18 mRNA CTD PMID:29275510 Rad18 Rat Brevetoxin B increases expression ISO RAD18 (Homo sapiens) 6480464 brevetoxin 2 results in increased expression of RAD18 mRNA CTD PMID:20498034 Rad18 Rat cadmium dichloride decreases expression ISO RAD18 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of RAD18 mRNA CTD PMID:38568856 Rad18 Rat caffeine decreases phosphorylation ISO RAD18 (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of RAD18 protein CTD PMID:35688186 Rad18 Rat calcitriol decreases expression ISO RAD18 (Homo sapiens) 6480464 Calcitriol results in decreased expression of RAD18 mRNA CTD PMID:21592394 Rad18 Rat calcitriol multiple interactions ISO RAD18 (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in decreased expression of RAD18 mRNA CTD PMID:21592394 Rad18 Rat carbon nanotube increases expression ISO Rad18 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Rad18 Rat cefaloridine increases expression EXP 6480464 Cephaloridine results in increased expression of RAD18 mRNA CTD PMID:18500788 Rad18 Rat chlordecone multiple interactions ISO RAD18 (Homo sapiens) 6480464 Chlordecone inhibits the reaction [ESR1 protein binds to RAD18 promoter] CTD PMID:33837044 Rad18 Rat chlorpyrifos decreases expression ISO Rad18 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of RAD18 mRNA CTD PMID:37019170 Rad18 Rat cisplatin increases expression ISO Rad18 (Mus musculus) 6480464 Cisplatin results in increased expression of RAD18 mRNA CTD PMID:21151649 Rad18 Rat clotrimazole increases expression EXP 6480464 Clotrimazole results in increased expression of RAD18 mRNA CTD PMID:30047161 Rad18 Rat copper atom decreases expression ISO Rad18 (Mus musculus) 6480464 Copper results in decreased expression of RAD18 mRNA CTD PMID:22641096 Rad18 Rat copper(0) decreases expression ISO Rad18 (Mus musculus) 6480464 Copper results in decreased expression of RAD18 mRNA CTD PMID:22641096 Rad18 Rat coumestrol increases expression ISO RAD18 (Homo sapiens) 6480464 Coumestrol results in increased expression of RAD18 mRNA CTD PMID:19167446 Rad18 Rat DDE increases expression ISO RAD18 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of RAD18 mRNA CTD PMID:38568856 Rad18 Rat Dibutyl phosphate affects expression ISO RAD18 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of RAD18 mRNA CTD PMID:37042841 Rad18 Rat dibutyl phthalate increases expression ISO Rad18 (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of RAD18 mRNA CTD PMID:21266533 Rad18 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of RAD18 mRNA CTD PMID:21266533 Rad18 Rat doxorubicin decreases expression EXP 6480464 Doxorubicin results in decreased expression of RAD18 mRNA CTD PMID:27181935 Rad18 Rat doxorubicin multiple interactions ISO RAD18 (Homo sapiens) 6480464 [TP53 protein affects the susceptibility to Doxorubicin] which affects the expression of RAD18 mRNA CTD PMID:36634904 Rad18 Rat doxorubicin decreases expression ISO RAD18 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of RAD18 mRNA CTD PMID:36634904 Rad18 Rat doxorubicin multiple interactions EXP 6480464 Fungal Polysaccharides inhibits the reaction [Doxorubicin results in decreased expression of RAD18 mRNA] CTD PMID:27181935 Rad18 Rat fenthion multiple interactions ISO RAD18 (Homo sapiens) 6480464 [terbufos co-treated with Fenthion] results in increased expression of RAD18 mRNA CTD PMID:33221015 Rad18 Rat fenthion decreases expression ISO RAD18 (Homo sapiens) 6480464 Fenthion results in decreased expression of RAD18 mRNA CTD PMID:33221015 Rad18 Rat flumequine multiple interactions ISO Rad18 (Mus musculus) 6480464 [flumequine co-treated with 2-amino-3 more ... CTD PMID:23681119 Rad18 Rat FR900359 affects phosphorylation ISO RAD18 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of RAD18 protein CTD PMID:37730182 Rad18 Rat furan increases expression EXP 6480464 furan results in increased expression of RAD18 mRNA CTD PMID:22079235 Rad18 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of RAD18 mRNA CTD PMID:33387578 Rad18 Rat hexadecanoic acid increases phosphorylation ISO RAD18 (Homo sapiens) 6480464 Palmitic Acid results in increased phosphorylation of RAD18 protein CTD PMID:28073184 Rad18 Rat indole-3-methanol multiple interactions EXP 6480464 [indole-3-carbinol co-treated with Diethylnitrosamine] results in increased expression of RAD18 mRNA CTD PMID:22129741 Rad18 Rat lead(0) decreases expression ISO Rad18 (Mus musculus) 6480464 Lead results in decreased expression of RAD18 mRNA CTD PMID:22641096 Rad18 Rat lithium atom decreases expression ISO Rad18 (Mus musculus) 6480464 Lithium results in decreased expression of RAD18 mRNA CTD PMID:22641096 Rad18 Rat lithium hydride decreases expression ISO Rad18 (Mus musculus) 6480464 Lithium results in decreased expression of RAD18 mRNA CTD PMID:22641096 Rad18 Rat MeIQx multiple interactions ISO Rad18 (Mus musculus) 6480464 [flumequine co-treated with 2-amino-3 more ... CTD PMID:23681119 Rad18 Rat mercury atom decreases expression ISO Rad18 (Mus musculus) 6480464 Mercury results in decreased expression of RAD18 mRNA CTD PMID:22641096 Rad18 Rat mercury(0) decreases expression ISO Rad18 (Mus musculus) 6480464 Mercury results in decreased expression of RAD18 mRNA CTD PMID:22641096 Rad18 Rat methamphetamine decreases expression ISO Rad18 (Mus musculus) 6480464 Methamphetamine results in decreased expression of RAD18 mRNA CTD PMID:26307267 Rad18 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of RAD18 mRNA CTD PMID:30047161 Rad18 Rat N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine decreases ubiquitination ISO RAD18 (Homo sapiens) 6480464 N more ... CTD PMID:36087615 Rad18 Rat N-acetyl-L-cysteine multiple interactions ISO RAD18 (Homo sapiens) 6480464 Acetylcysteine inhibits the reaction [4-biphenylamine results in decreased expression of RAD18 protein] CTD PMID:32433928 Rad18 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [indole-3-carbinol co-treated with Diethylnitrosamine] results in increased expression of RAD18 mRNA CTD PMID:22129741 Rad18 Rat nickel atom decreases expression ISO Rad18 (Mus musculus) 6480464 Nickel results in decreased expression of RAD18 mRNA CTD PMID:22641096 Rad18 Rat ochratoxin A increases expression EXP 6480464 ochratoxin A results in increased expression of RAD18 mRNA CTD PMID:18417182 more ... Rad18 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of RAD18 mRNA CTD PMID:25729387 Rad18 Rat ozone multiple interactions ISO Rad18 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of RAD18 mRNA and [Air Pollutants results in increased abundance of Ozone] which results in increased expression of RAD18 mRNA CTD PMID:34911549 Rad18 Rat p-toluidine increases expression EXP 6480464 4-toluidine results in increased expression of RAD18 mRNA CTD PMID:27638505 Rad18 Rat paracetamol affects expression ISO Rad18 (Mus musculus) 6480464 Acetaminophen affects the expression of RAD18 mRNA CTD PMID:17562736 Rad18 Rat paracetamol increases expression ISO RAD18 (Homo sapiens) 6480464 Acetaminophen results in increased expression of RAD18 mRNA CTD PMID:22230336 Rad18 Rat pentachlorophenol increases expression ISO Rad18 (Mus musculus) 6480464 Pentachlorophenol results in increased expression of RAD18 mRNA CTD PMID:23892564 Rad18 Rat perfluorohexanesulfonic acid increases expression ISO Rad18 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in increased expression of RAD18 mRNA CTD PMID:37995155 Rad18 Rat pirinixic acid multiple interactions ISO Rad18 (Mus musculus) 6480464 [pirinixic acid co-treated with PPARA] results in increased expression of RAD18 mRNA and PPARA protein affects the reaction [pirinixic acid results in increased expression of RAD18 mRNA] CTD PMID:20813756 and PMID:21318169 Rad18 Rat pirinixic acid increases expression ISO Rad18 (Mus musculus) 6480464 pirinixic acid results in increased expression of RAD18 mRNA CTD PMID:18301758 more ... Rad18 Rat potassium dichromate decreases expression ISO RAD18 (Homo sapiens) 6480464 Potassium Dichromate results in decreased expression of RAD18 protein CTD PMID:23718831 Rad18 Rat resveratrol decreases expression ISO Rad18 (Mus musculus) 6480464 resveratrol results in decreased expression of RAD18 protein CTD PMID:25505154 Rad18 Rat resveratrol decreases expression EXP 6480464 Resveratrol results in decreased expression of RAD18 mRNA CTD PMID:33775663 Rad18 Rat rotenone increases expression ISO RAD18 (Homo sapiens) 6480464 Rotenone results in increased expression of RAD18 mRNA CTD PMID:18191903 Rad18 Rat silicon dioxide increases expression ISO RAD18 (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of RAD18 mRNA CTD PMID:25895662 Rad18 Rat sodium arsenite multiple interactions ISO RAD18 (Homo sapiens) 6480464 sodium arsenite inhibits the reaction [Zinc binds to RAD18 protein] and sodium arsenite results in decreased ubiquitination of and affects the localization of RAD18 protein CTD PMID:36087615 Rad18 Rat sodium arsenite affects methylation ISO RAD18 (Homo sapiens) 6480464 sodium arsenite affects the methylation of RAD18 gene CTD PMID:28589171 Rad18 Rat sodium dichromate increases expression EXP 6480464 sodium bichromate results in increased expression of RAD18 mRNA CTD PMID:25993096 Rad18 Rat succimer multiple interactions ISO Rad18 (Mus musculus) 6480464 [Succimer binds to Magnetite Nanoparticles] which results in decreased expression of RAD18 mRNA and [Succimer co-treated with Magnetite Nanoparticles] affects the expression of RAD18 mRNA CTD PMID:21641980 and PMID:26378955 Rad18 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of RAD18 mRNA CTD PMID:30047161 Rad18 Rat sunitinib increases expression ISO RAD18 (Homo sapiens) 6480464 Sunitinib results in increased expression of RAD18 mRNA CTD PMID:31533062 Rad18 Rat terbufos decreases expression ISO RAD18 (Homo sapiens) 6480464 terbufos results in decreased expression of RAD18 mRNA CTD PMID:33221015 Rad18 Rat terbufos multiple interactions ISO RAD18 (Homo sapiens) 6480464 [terbufos co-treated with Fenthion] results in increased expression of RAD18 mRNA CTD PMID:33221015 Rad18 Rat testosterone multiple interactions ISO RAD18 (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in decreased expression of RAD18 mRNA CTD PMID:21592394 Rad18 Rat testosterone decreases expression ISO RAD18 (Homo sapiens) 6480464 Testosterone results in decreased expression of RAD18 mRNA CTD PMID:21592394 Rad18 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of RAD18 mRNA CTD PMID:31150632 Rad18 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of RAD18 mRNA] CTD PMID:31150632 Rad18 Rat thimerosal increases expression ISO RAD18 (Homo sapiens) 6480464 Thimerosal results in increased expression of RAD18 mRNA CTD PMID:27188386 Rad18 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of RAD18 mRNA CTD PMID:23411599 and PMID:34492290 Rad18 Rat titanium dioxide increases expression ISO Rad18 (Mus musculus) 6480464 titanium dioxide results in increased expression of RAD18 mRNA CTD PMID:23557971 Rad18 Rat titanium dioxide decreases methylation ISO Rad18 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of RAD18 gene CTD PMID:35295148 Rad18 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of RAD18 mRNA CTD PMID:25729387 Rad18 Rat tributylstannane increases expression EXP 6480464 tributyltin results in increased expression of RAD18 mRNA CTD PMID:31129395 Rad18 Rat trichostatin A decreases expression ISO RAD18 (Homo sapiens) 6480464 trichostatin A results in decreased expression of RAD18 mRNA CTD PMID:24935251 Rad18 Rat triphenyl phosphate increases expression EXP 6480464 triphenyl phosphate results in increased expression of RAD18 mRNA CTD PMID:30589522 Rad18 Rat triphenyl phosphate affects expression ISO RAD18 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of RAD18 mRNA CTD PMID:37042841 Rad18 Rat valproic acid affects expression ISO RAD18 (Homo sapiens) 6480464 Valproic Acid affects the expression of RAD18 mRNA CTD PMID:25979313 Rad18 Rat valproic acid decreases expression ISO RAD18 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of RAD18 mRNA CTD PMID:23179753 more ... Rad18 Rat vorinostat increases expression ISO RAD18 (Homo sapiens) 6480464 vorinostat results in increased expression of RAD18 mRNA CTD PMID:27188386 Rad18 Rat vorinostat decreases expression ISO Rad18 (Mus musculus) 6480464 Vorinostat results in decreased expression of RAD18 mRNA CTD PMID:32512035 Rad18 Rat zinc atom multiple interactions ISO RAD18 (Homo sapiens) 6480464 sodium arsenite inhibits the reaction [Zinc binds to RAD18 protein] CTD PMID:36087615 Rad18 Rat zinc atom affects binding ISO RAD18 (Homo sapiens) 6480464 Zinc binds to RAD18 protein CTD PMID:36087615 Rad18 Rat zinc(0) affects binding ISO RAD18 (Homo sapiens) 6480464 Zinc binds to RAD18 protein CTD PMID:36087615 Rad18 Rat zinc(0) multiple interactions ISO RAD18 (Homo sapiens) 6480464 sodium arsenite inhibits the reaction [Zinc binds to RAD18 protein] CTD PMID:36087615
(+)-schisandrin B (EXP) 1,2-dibromoethane (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 1H-pyrazole (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-nitrotoluene (ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) aflatoxin B1 (EXP) all-trans-retinoic acid (ISO) amitrole (EXP) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) avobenzone (ISO) belinostat (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) biphenyl-4-amine (ISO) bisphenol A (EXP,ISO) Brevetoxin B (ISO) cadmium dichloride (ISO) caffeine (ISO) calcitriol (ISO) carbon nanotube (ISO) cefaloridine (EXP) chlordecone (ISO) chlorpyrifos (ISO) cisplatin (ISO) clotrimazole (EXP) copper atom (ISO) copper(0) (ISO) coumestrol (ISO) DDE (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP,ISO) doxorubicin (EXP,ISO) fenthion (ISO) flumequine (ISO) FR900359 (ISO) furan (EXP) gentamycin (EXP) hexadecanoic acid (ISO) indole-3-methanol (EXP) lead(0) (ISO) lithium atom (ISO) lithium hydride (ISO) MeIQx (ISO) mercury atom (ISO) mercury(0) (ISO) methamphetamine (ISO) methimazole (EXP) N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine (ISO) N-acetyl-L-cysteine (ISO) N-nitrosodiethylamine (EXP) nickel atom (ISO) ochratoxin A (EXP) oxaliplatin (EXP) ozone (ISO) p-toluidine (EXP) paracetamol (ISO) pentachlorophenol (ISO) perfluorohexanesulfonic acid (ISO) pirinixic acid (ISO) potassium dichromate (ISO) resveratrol (EXP,ISO) rotenone (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sodium dichromate (EXP) succimer (ISO) sulfadimethoxine (EXP) sunitinib (ISO) terbufos (ISO) testosterone (ISO) tetrachloromethane (EXP) thimerosal (ISO) thioacetamide (EXP) titanium dioxide (ISO) topotecan (EXP) tributylstannane (EXP) trichostatin A (ISO) triphenyl phosphate (EXP,ISO) valproic acid (ISO) vorinostat (ISO) zinc atom (ISO) zinc(0) (ISO)
Rad18 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 147,291,463 - 147,376,904 (-) NCBI GRCr8 mRatBN7.2 4 145,735,654 - 145,821,102 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 145,735,654 - 145,821,069 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 151,128,531 - 151,213,335 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 146,909,335 - 146,994,147 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 145,530,588 - 145,615,388 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 144,537,329 - 144,620,606 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 144,536,729 - 144,620,731 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 207,837,216 - 207,920,089 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 148,452,664 - 148,543,743 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 148,697,688 - 148,788,534 (-) NCBI Celera 4 134,304,974 - 134,388,922 (-) NCBI Celera Cytogenetic Map 4 q42 NCBI
RAD18 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 8,877,075 - 8,963,472 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 8,775,402 - 8,963,773 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 8,918,759 - 9,005,156 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 8,896,560 - 8,980,146 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 3 8,896,560 - 8,980,146 NCBI Celera 3 8,853,629 - 8,939,882 (-) NCBI Celera Cytogenetic Map 3 p25.3 NCBI HuRef 3 8,853,076 - 8,939,344 (-) NCBI HuRef CHM1_1 3 8,869,168 - 8,955,418 (-) NCBI CHM1_1 T2T-CHM13v2.0 3 8,868,283 - 8,960,543 (-) NCBI T2T-CHM13v2.0
Rad18 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 6 112,596,812 - 112,673,650 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 6 112,596,811 - 112,673,647 (-) Ensembl GRCm39 Ensembl GRCm38 6 112,619,851 - 112,696,691 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 6 112,619,850 - 112,696,686 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 6 112,569,845 - 112,646,664 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 6 112,586,582 - 112,662,371 (-) NCBI MGSCv36 mm8 Celera 6 114,452,215 - 114,522,098 (-) NCBI Celera Cytogenetic Map 6 E3 NCBI cM Map 6 52.42 NCBI
Rad18 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955561 464,343 - 599,789 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955561 463,586 - 602,354 (-) NCBI ChiLan1.0 ChiLan1.0
RAD18 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 8,891,471 - 8,977,466 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 8,896,229 - 8,982,224 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 8,832,910 - 8,918,067 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 9,076,500 - 9,161,585 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 3 9,076,500 - 9,161,585 (-) Ensembl panpan1.1 panPan2
RAD18 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 20 9,163,322 - 9,271,224 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 20 9,163,428 - 9,263,730 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 20 9,195,146 - 9,302,722 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 20 9,192,202 - 9,299,425 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 20 9,191,837 - 9,291,927 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 20 8,913,303 - 9,020,670 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 20 9,259,143 - 9,366,272 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 20 9,232,350 - 9,339,667 (+) NCBI UU_Cfam_GSD_1.0
Rad18 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404942 14,776,226 - 14,879,342 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936602 4,030,459 - 4,081,931 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936602 4,030,353 - 4,134,119 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
RAD18
RAD18 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 22 44,878,015 - 44,960,610 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 22 44,875,292 - 44,960,089 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666041 121,606,379 - 121,689,362 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Rad18
.
Predicted Target Of
Count of predictions: 576 Count of miRNA genes: 253 Interacting mature miRNAs: 322 Transcripts: ENSRNOT00000066468 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1582232 Gluco25 Glucose level QTL 25 3.6 0.0023 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 85253748 148090731 Rat 1358352 Srcrt3 Stress Responsive Cort QTL 3 2.29 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 38465774 146803430 Rat 1300116 Hrtrt5 Heart rate QTL 5 3.76 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 4 116179486 151161268 Rat 6478693 Anxrr32 Anxiety related response QTL 32 0.00092 locomotor behavior trait (VT:0001392) measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957) 4 144639524 182687754 Rat 10755501 Bp390 Blood pressure QTL 390 2.5 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 4 26775591 168368347 Rat 631683 Bp116 Blood pressure QTL 116 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 124303370 169303370 Rat 61451 Ciaa4 CIA Autoantibody QTL 4 3.1 blood autoantibody amount (VT:0003725) calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281) 4 126395976 167139601 Rat 1331738 Bp209 Blood pressure QTL 209 2.979 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 138503169 179293946 Rat 6478700 Anxrr33 Anxiety related response QTL 33 0.00896 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 144639524 182687754 Rat 1549827 Scl46 Serum cholesterol level QTL 46 3.5 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 4 132396220 177396220 Rat 731165 Uae21 Urinary albumin excretion QTL 21 2.4 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 4 106649412 151649412 Rat 737821 Hcar9 Hepatocarcinoma resistance QTL 9 3.7 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 4 109866907 167139601 Rat 7411558 Bw133 Body weight QTL 133 13.84 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 4 125590636 170590636 Rat 10401796 Kidm48 Kidney mass QTL 48 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 4 145568712 182687754 Rat 6478718 Anxrr34 Anxiety related response QTL 34 0.00896 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 144639524 182687754 Rat 1549832 Bss3 Bone structure and strength QTL 3 11 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 4 109827074 154827074 Rat 70177 Xhs1 X-ray hypersensitivity QTL 1 25.1 intestine integrity trait (VT:0010554) post-insult time to onset of moribundity (CMO:0001896) 4 82798864 152731274 Rat 2303623 Vencon2 Ventilatory control QTL 2 3.8 respiration trait (VT:0001943) minute ventilation (CMO:0000132) 4 135204660 180204660 Rat 1578674 Bmd12 Bone mineral density QTL 12 3.8 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 4 135699135 180699135 Rat 1354660 Salc1 Saline consumption QTL 1 11.26 drinking behavior trait (VT:0001422) saline drink intake rate (CMO:0001627) 4 44463908 148090542 Rat 1298082 Stresp4 Stress response QTL 4 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 50119848 146803430 Rat 737978 Pia23 Pristane induced arthritis QTL 23 5.3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 131730738 167139601 Rat 61362 Oia2 Oil induced arthritis QTL 2 0.001 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 138503169 173369699 Rat 70201 Gcr1 Gastric cancer resistance QTL 1 2.7 stomach morphology trait (VT:0000470) stomach tumor susceptibility score (CMO:0002043) 4 120260281 147278687 Rat 70200 Alc18 Alcohol consumption QTL 18 9.2 drinking behavior trait (VT:0001422) ethanol intake volume to total fluid intake volume ratio (CMO:0001591) 4 56647873 149491524 Rat 2293659 Bmd35 Bone mineral density QTL 35 4.5 0.0001 femur strength trait (VT:0010010) femoral neck ultimate force (CMO:0001703) 4 137755016 181392681 Rat 1331759 Hrtrt13 Heart rate QTL 13 3.54628 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 4 110275411 168266883 Rat 724535 Cm18 Cardiac mass QTL 18 2.6 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 4 118856416 163856416 Rat 2316958 Gluco58 Glucose level QTL 58 10 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 11320076 180699135 Rat 6478754 Anxrr43 Anxiety related response QTL 43 0.14035 locomotor behavior trait (VT:0001392) distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493) 4 144639524 182687754 Rat 2302049 Pia32 Pristane induced arthritis QTL 32 5.1 0.001 blood autoantibody amount (VT:0003725) serum immunoglobulin G-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002112) 4 105789505 150789505 Rat 724558 Plsm2 Polydactyly-luxate syndrome (PLS) morphotypes QTL 2 0.0003 hindlimb integrity trait (VT:0010563) hind foot phalanges count (CMO:0001949) 4 132422778 177422778 Rat 6478763 Anxrr46 Anxiety related response QTL 46 0.07428 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 110870972 155870972 Rat 6478760 Anxrr45 Anxiety related response QTL 45 0.06717 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 110870972 155870972 Rat 1331802 Srn5 Serum renin concentration QTL 5 3.045 renin activity (VT:0005581) plasma renin activity level (CMO:0000116) 4 119428175 157578333 Rat 1298524 Oia8 Oil induced arthritis QTL 8 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 138503169 173369699 Rat 738009 Sach4 Saccharine consumption QTL 4 4.9 0.000016 consumption behavior trait (VT:0002069) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 4 59948935 154902892 Rat 2312567 Glom19 Glomerulus QTL 19 1.9 0.006 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 4 45456990 146803430 Rat 7207480 Bss105 Bone structure and strength QTL 105 8.1 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 4 109827074 154827074 Rat 634335 Anxrr16 Anxiety related response QTL 16 7.22 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 4 93308457 167139447 Rat 6478778 Anxrr51 Anxiety related response QTL 51 0.25384 locomotor behavior trait (VT:0001392) measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957) 4 124778595 169778595 Rat 61406 Scwia1 Streptococcal cell wall induced arthritis QTL 1 2.3 joint integrity trait (VT:0010548) experimental arthritis severity measurement (CMO:0001459) 4 106805662 151805662 Rat 631511 Pia7 Pristane induced arthritis QTL 7 4.3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 131730738 167139601 Rat 1354612 Foco1 Food consumption QTL 1 8.87 eating behavior trait (VT:0001431) food intake rate (CMO:0000427) 4 44463908 148090542 Rat 634347 Hcar8 Hepatocarcinoma resistance QTL 8 5.8 liver integrity trait (VT:0010547) liver tumorous lesion area to total liver area ratio (CMO:0001075) 4 123143783 168143783 Rat 2303168 Bp330 Blood pressure QTL 330 4.25 0.017 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 5214602 146446691 Rat 738031 Alc14 Alcohol consumption QTL 14 7.6 0.00003 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 4 59948935 154902892 Rat 1576316 Ept5 Estrogen-induced pituitary tumorigenesis QTL 5 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 4 83428419 177635233 Rat 1576305 Emca6 Estrogen-induced mammary cancer QTL 6 5.8 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 4 44463720 155883716 Rat 738016 Alc16 Alcohol consumption QTL 16 3.6 0.00015 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 4 59948935 154902892 Rat 1358202 Gluco11 Glucose level QTL 11 2.4 0.02 adipocyte glucose uptake trait (VT:0004185) absolute change in adipocyte glucose uptake (CMO:0000873) 4 85379421 167139601 Rat 61422 Cia13 Collagen induced arthritis QTL 13 4.5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 132642577 167139601 Rat 631674 Iddm14 Insulin dependent diabetes mellitus QTL 14 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 4 64528739 157573521 Rat 2293840 Kiddil9 Kidney dilation QTL 9 2.9 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 4 120926564 148090731 Rat 12798519 Anxrr54 Anxiety related response QTL 54 2.54 0.05 locomotor behavior trait (VT:0001392) distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493) 4 114627026 159627026 Rat 12798523 Anxrr56 Anxiety related response QTL 56 2.83 0.05 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 85253748 150276390 Rat 61434 Cia3 Collagen induced arthritis QTL 3 4.8 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 103194656 148194656 Rat 12798527 Anxrr58 Anxiety related response QTL 58 4.11 0.05 locomotor behavior trait (VT:0001392) distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493) 4 119463257 147278687 Rat 6478748 Anxrr42 Anxiety related response QTL 42 0.28008 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 144639524 182687754 Rat
AA800878
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 145,735,817 - 145,736,047 (+) MAPPER mRatBN7.2 Rnor_6.0 4 144,536,864 - 144,537,093 NCBI Rnor6.0 Rnor_5.0 4 207,836,751 - 207,836,980 UniSTS Rnor5.0 RGSC_v3.4 4 148,452,198 - 148,452,427 UniSTS RGSC3.4 Celera 4 134,304,508 - 134,304,737 UniSTS RH 3.4 Map 4 937.2 UniSTS Cytogenetic Map 4 q42 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000066468 ⟹ ENSRNOP00000063400
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 145,735,654 - 145,821,069 (-) Ensembl Rnor_6.0 Ensembl 4 144,536,729 - 144,620,731 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000099439 ⟹ ENSRNOP00000076533
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 145,735,654 - 145,821,069 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000115978 ⟹ ENSRNOP00000094440
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 145,735,676 - 145,821,067 (-) Ensembl
RefSeq Acc Id:
NM_001077673 ⟹ NP_001071141
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 147,292,093 - 147,376,869 (-) NCBI mRatBN7.2 4 145,736,284 - 145,821,065 (-) NCBI Rnor_6.0 4 144,537,330 - 144,620,584 (-) NCBI Rnor_5.0 4 207,837,216 - 207,920,089 (-) NCBI RGSC_v3.4 4 148,452,664 - 148,543,743 (-) RGD Celera 4 134,304,974 - 134,388,922 (-) RGD
Sequence:
AGAGGAACTGCGTGGCAGGCCGGTAGCTGGTGGTCTCGTCAAGTGCGACCATGGAGGACCTGGCCGAGCCACGGTGGCCTCCGGGGTTGGCGATGATGAAGACAATAGATGACTTGCTGCGCTGTGGG
hide sequence
RefSeq Acc Id:
XM_006237036 ⟹ XP_006237098
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 147,291,463 - 147,376,904 (-) NCBI mRatBN7.2 4 145,735,654 - 145,821,102 (-) NCBI Rnor_6.0 4 144,537,329 - 144,620,606 (-) NCBI Rnor_5.0 4 207,837,216 - 207,920,089 (-) NCBI
Sequence:
TGTAGCGCGGGGAATTTCGAGTAGAGGAACTGCGTGGCAGGCCGGTAGCTGGTGGTCTCGTCAAGTGCGACCATGGAGGACCTGGCCGAGCCACGGTGGCCTCCGGGGTTGGCGATGATGAAGACAAT
hide sequence
RefSeq Acc Id:
XM_006237037 ⟹ XP_006237099
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 147,291,463 - 147,376,904 (-) NCBI mRatBN7.2 4 145,735,654 - 145,821,102 (-) NCBI Rnor_6.0 4 144,537,339 - 144,620,606 (-) NCBI Rnor_5.0 4 207,837,216 - 207,920,089 (-) NCBI
Sequence:
TGTAGCGCGGGGAATTTCGAGTAGAGGAACTGCGTGGCAGGCCGGTAGCTGGTGGTCTCGTCAAGTGCGACCATGGAGGACCTGGCCGAGCCACGGTGGCCTCCGGGGTTGGCGATGATGAAGACAAT
hide sequence
RefSeq Acc Id:
XM_063286290 ⟹ XP_063142360
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 147,291,463 - 147,376,904 (-) NCBI
RefSeq Acc Id:
NP_001071141 ⟸ NM_001077673
- UniProtKB:
A0JPN0 (UniProtKB/TrEMBL), A0A8I5YBD2 (UniProtKB/TrEMBL)
- Sequence:
MEDLAEPRWPPGLAMMKTIDDLLRCGICFEYFNIAVIIPQCSHNYCSLCIRKFLSYKTQCPTCCVAVTEPDLRNNRLLDELVKSMSFARTRLLQFALESPPISPVSSTSKKVVVKVHNVEATQHPVKQ
hide sequence
RefSeq Acc Id:
XP_006237098 ⟸ XM_006237036
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I5YBD2 (UniProtKB/TrEMBL)
- Sequence:
MEDLAEPRWPPGLAMMKTIDDLLRCGICFEYFNIAVIIPQCSHNYCSLCIRKFLSYKTQCPTCCVAVTEPDLRNNRLLDELVKSMSFARTRLLQFALESPPISPVSSTSKKVVVKVHNVEATQHPVKQ
hide sequence
RefSeq Acc Id:
XP_006237099 ⟸ XM_006237037
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I6GKR5 (UniProtKB/TrEMBL), A6IBN3 (UniProtKB/TrEMBL)
- Sequence:
MEDLAEPRWPPGLAMMKTIDDLLRCGICFEYFNIAVIIPQCSHNYCSLCIRKFLSYKTQCPTCCVAVTEPDLRNNRLLDELVKSMSFARTRLLQFALESPPISPVSSTSKKVVVKVHNVEATQHPVKQ
hide sequence
Ensembl Acc Id:
ENSRNOP00000063400 ⟸ ENSRNOT00000066468
Ensembl Acc Id:
ENSRNOP00000076533 ⟸ ENSRNOT00000099439
Ensembl Acc Id:
ENSRNOP00000094440 ⟸ ENSRNOT00000115978
RefSeq Acc Id:
XP_063142360 ⟸ XM_063286290
- Peptide Label:
isoform X3
- UniProtKB:
A6IBN3 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2014-08-06
Rad18
RAD18 E3 ubiquitin protein ligase
Rad18
RAD18 homolog (S. cerevisiae)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Rad18
RAD18 homolog (S. cerevisiae)
Rad18_predicted
RAD18 homolog (S. cerevisiae) (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Rad18_predicted
RAD18 homolog (S. cerevisiae) (predicted)
Symbol and Name status set to approved
70820 APPROVED
