Symbol:
Fgd5
Name:
FYVE, RhoGEF and PH domain containing 5
RGD ID:
1305589
Description:
Predicted to enable guanyl-nucleotide exchange factor activity. Predicted to be located in plasma membrane. Predicted to be active in cytoplasm. Orthologous to human FGD5 (FYVE, RhoGEF and PH domain containing 5); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; bisphenol A; cocaine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
FYVE, RhoGEF and PH domain-containing protein 5; LOC362402
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
FGD5 (FYVE, RhoGEF and PH domain containing 5) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Fgd5 (FYVE, RhoGEF and PH domain containing 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Fgd5 (FYVE, RhoGEF and PH domain containing 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
FGD5 (FYVE, RhoGEF and PH domain containing 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
FGD5 (FYVE, RhoGEF and PH domain containing 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Fgd5 (FYVE, RhoGEF and PH domain containing 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
FGD5 (FYVE, RhoGEF and PH domain containing 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
FGD5 (FYVE, RhoGEF and PH domain containing 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Fgd5 (FYVE, RhoGEF and PH domain containing 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
USP38 (ubiquitin specific peptidase 38) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
FGD5 (FYVE, RhoGEF and PH domain containing 5)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Fgd5 (FYVE, RhoGEF and PH domain containing 5)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
fgd5a (FYVE, RhoGEF and PH domain containing 5a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
fgd5
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 126,054,201 - 126,151,698 (+) NCBI GRCr8 mRatBN7.2 4 124,497,061 - 124,594,564 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 124,497,068 - 124,594,563 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 129,964,067 - 130,061,661 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 125,738,497 - 125,836,093 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 124,363,028 - 124,460,626 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 123,865,557 - 123,962,904 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 123,865,725 - 123,962,881 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 189,298,419 - 189,395,965 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 126,237,049 - 126,276,419 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 126,432,006 - 126,521,133 (+) NCBI Celera 4 113,414,985 - 113,512,420 (+) NCBI Celera Cytogenetic Map 4 q34 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Fgd5 Rat 1,1-dichloroethene decreases expression ISO Fgd5 (Mus musculus) 6480464 vinylidene chloride results in decreased expression of FGD5 mRNA CTD PMID:26682919 Fgd5 Rat 1,2-dimethylhydrazine increases expression ISO Fgd5 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of FGD5 mRNA CTD PMID:22206623 Fgd5 Rat 17beta-estradiol multiple interactions ISO FGD5 (Homo sapiens) 6480464 [Estradiol binds to ESR2 protein] which results in increased expression of FGD5 mRNA CTD PMID:20404318 Fgd5 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Fgd5 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of FGD5 mRNA CTD PMID:21570461 Fgd5 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of FGD5 mRNA CTD PMID:34747641 Fgd5 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of FGD5 mRNA CTD PMID:32109520 Fgd5 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Fgd5 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of FGD5 mRNA CTD PMID:23994337 Fgd5 Rat 3,3',4,4',5-pentachlorobiphenyl increases expression ISO Fgd5 (Mus musculus) 6480464 3 more ... CTD PMID:23994337 Fgd5 Rat 3,4-methylenedioxymethamphetamine increases expression ISO Fgd5 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of FGD5 mRNA CTD PMID:26251327 Fgd5 Rat 4,4'-diaminodiphenylmethane increases expression ISO Fgd5 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of FGD5 mRNA CTD PMID:18648102 Fgd5 Rat 4,4'-sulfonyldiphenol increases expression ISO Fgd5 (Mus musculus) 6480464 bisphenol S results in increased expression of FGD5 mRNA CTD PMID:30951980 and PMID:33297965 Fgd5 Rat 4,4'-sulfonyldiphenol decreases methylation ISO FGD5 (Homo sapiens) 6480464 bisphenol S results in decreased methylation of FGD5 gene CTD PMID:31601247 Fgd5 Rat 4,4'-sulfonyldiphenol decreases methylation ISO Fgd5 (Mus musculus) 6480464 bisphenol S results in decreased methylation of FGD5 exon CTD PMID:33297965 Fgd5 Rat 4-hydroxyphenyl retinamide increases expression ISO Fgd5 (Mus musculus) 6480464 Fenretinide results in increased expression of FGD5 mRNA CTD PMID:28973697 Fgd5 Rat 5-aza-2'-deoxycytidine affects expression ISO FGD5 (Homo sapiens) 6480464 Decitabine affects the expression of FGD5 mRNA CTD PMID:23300844 Fgd5 Rat aflatoxin B1 decreases methylation ISO FGD5 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of FGD5 exon CTD PMID:30157460 Fgd5 Rat aflatoxin B1 decreases expression ISO FGD5 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of FGD5 mRNA CTD PMID:32234424 Fgd5 Rat Aflatoxin B2 alpha increases methylation ISO FGD5 (Homo sapiens) 6480464 aflatoxin B2 results in increased methylation of FGD5 exon CTD PMID:30157460 Fgd5 Rat amiodarone increases expression ISO FGD5 (Homo sapiens) 6480464 Amiodarone results in increased expression of FGD5 mRNA CTD PMID:19774075 Fgd5 Rat benzo[a]pyrene increases mutagenesis ISO FGD5 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased mutagenesis of FGD5 gene CTD PMID:25435355 Fgd5 Rat benzo[a]pyrene decreases expression ISO FGD5 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of FGD5 mRNA CTD PMID:32234424 Fgd5 Rat benzo[a]pyrene affects methylation ISO FGD5 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of FGD5 intron and Benzo(a)pyrene affects the methylation of FGD5 promoter CTD PMID:27901495 and PMID:30157460 Fgd5 Rat benzo[a]pyrene increases expression ISO Fgd5 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of FGD5 mRNA CTD PMID:22228805 and PMID:32417428 Fgd5 Rat benzo[a]pyrene decreases expression ISO Fgd5 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of FGD5 mRNA CTD PMID:27195522 Fgd5 Rat benzo[b]fluoranthene increases expression ISO Fgd5 (Mus musculus) 6480464 benzo(b)fluoranthene results in increased expression of FGD5 mRNA CTD PMID:26377693 Fgd5 Rat benzo[e]pyrene increases methylation ISO FGD5 (Homo sapiens) 6480464 benzo(e)pyrene results in increased methylation of FGD5 exon and benzo(e)pyrene results in increased methylation of FGD5 intron CTD PMID:30157460 Fgd5 Rat beta-naphthoflavone increases expression ISO Fgd5 (Mus musculus) 6480464 beta-Naphthoflavone results in increased expression of FGD5 mRNA CTD PMID:23994337 Fgd5 Rat bisphenol A decreases expression ISO Fgd5 (Mus musculus) 6480464 bisphenol A results in decreased expression of FGD5 mRNA CTD PMID:26063408 Fgd5 Rat bisphenol A increases expression ISO Fgd5 (Mus musculus) 6480464 bisphenol A results in increased expression of FGD5 mRNA CTD PMID:30951980 Fgd5 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of FGD5 mRNA CTD PMID:30816183 and PMID:32145629 Fgd5 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of FGD5 mRNA CTD PMID:25181051 Fgd5 Rat bisphenol F increases expression ISO Fgd5 (Mus musculus) 6480464 bisphenol F results in increased expression of FGD5 mRNA CTD PMID:30951980 Fgd5 Rat CGP 52608 multiple interactions ISO FGD5 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to FGD5 gene] CTD PMID:28238834 Fgd5 Rat chlorpyrifos increases expression ISO Fgd5 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of FGD5 mRNA CTD PMID:37019170 Fgd5 Rat cisplatin affects expression ISO FGD5 (Homo sapiens) 6480464 Cisplatin affects the expression of FGD5 mRNA CTD PMID:23300844 Fgd5 Rat cobalt dichloride decreases expression ISO FGD5 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of FGD5 mRNA CTD PMID:19320972 Fgd5 Rat cocaine increases expression EXP 6480464 Cocaine results in increased expression of FGD5 mRNA CTD PMID:17898221 Fgd5 Rat cyclosporin A decreases expression ISO FGD5 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of FGD5 mRNA CTD PMID:27989131 Fgd5 Rat diquat decreases expression ISO Fgd5 (Mus musculus) 6480464 Diquat results in decreased expression of FGD5 protein CTD PMID:36851058 Fgd5 Rat dorsomorphin multiple interactions ISO FGD5 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Fgd5 Rat entinostat increases expression ISO FGD5 (Homo sapiens) 6480464 entinostat results in increased expression of FGD5 mRNA CTD PMID:26272509 and PMID:27188386 Fgd5 Rat entinostat multiple interactions ISO FGD5 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of FGD5 mRNA CTD PMID:27188386 Fgd5 Rat ethylparaben increases expression ISO FGD5 (Homo sapiens) 6480464 ethyl-p-hydroxybenzoate results in increased expression of FGD5 mRNA CTD PMID:37690743 Fgd5 Rat glyphosate increases expression ISO Fgd5 (Mus musculus) 6480464 Glyphosate results in increased expression of FGD5 protein CTD PMID:37208198 Fgd5 Rat lipopolysaccharide multiple interactions ISO FGD5 (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Fgd5 Rat lipopolysaccharide decreases expression ISO FGD5 (Homo sapiens) 6480464 Lipopolysaccharides results in decreased expression of FGD5 mRNA CTD PMID:35811015 Fgd5 Rat methapyrilene increases methylation ISO FGD5 (Homo sapiens) 6480464 Methapyrilene results in increased methylation of FGD5 exon and Methapyrilene results in increased methylation of FGD5 intron CTD PMID:30157460 Fgd5 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of FGD5 gene CTD PMID:35440735 Fgd5 Rat N-Nitrosopyrrolidine decreases expression ISO FGD5 (Homo sapiens) 6480464 N-Nitrosopyrrolidine results in decreased expression of FGD5 mRNA CTD PMID:32234424 Fgd5 Rat nickel atom decreases expression ISO FGD5 (Homo sapiens) 6480464 Nickel results in decreased expression of FGD5 mRNA CTD PMID:25583101 Fgd5 Rat O-methyleugenol decreases expression ISO FGD5 (Homo sapiens) 6480464 methyleugenol results in decreased expression of FGD5 mRNA CTD PMID:32234424 Fgd5 Rat orphenadrine affects expression EXP 6480464 Orphenadrine affects the expression of FGD5 mRNA CTD PMID:23665939 Fgd5 Rat ozone multiple interactions ISO Fgd5 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of FGD5 mRNA and [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of FGD5 mRNA CTD PMID:27106289 and PMID:34911549 Fgd5 Rat panobinostat multiple interactions ISO FGD5 (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of FGD5 mRNA CTD PMID:27188386 Fgd5 Rat panobinostat increases expression ISO FGD5 (Homo sapiens) 6480464 panobinostat results in increased expression of FGD5 mRNA CTD PMID:26272509 Fgd5 Rat phenylmercury acetate multiple interactions ISO FGD5 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of FGD5 mRNA CTD PMID:27188386 Fgd5 Rat resveratrol multiple interactions ISO FGD5 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of FGD5 mRNA CTD PMID:23557933 Fgd5 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO FGD5 (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Fgd5 Rat S-(1,2-dichlorovinyl)-L-cysteine decreases expression ISO FGD5 (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine results in decreased expression of FGD5 mRNA CTD PMID:35811015 Fgd5 Rat SB 431542 multiple interactions ISO FGD5 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Fgd5 Rat Soman decreases expression EXP 6480464 Soman results in decreased expression of FGD5 mRNA CTD PMID:19281266 Fgd5 Rat titanium dioxide increases expression ISO Fgd5 (Mus musculus) 6480464 titanium dioxide results in increased expression of FGD5 mRNA CTD PMID:23557971 Fgd5 Rat titanium dioxide increases methylation ISO Fgd5 (Mus musculus) 6480464 titanium dioxide results in increased methylation of FGD5 promoter CTD PMID:35295148 Fgd5 Rat toluene increases expression EXP 6480464 Toluene results in increased expression of FGD5 mRNA CTD PMID:22967744 Fgd5 Rat trichostatin A increases expression ISO FGD5 (Homo sapiens) 6480464 trichostatin A results in increased expression of FGD5 mRNA CTD PMID:24935251 and PMID:26272509 Fgd5 Rat trichostatin A multiple interactions ISO FGD5 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of FGD5 mRNA CTD PMID:27188386 Fgd5 Rat triptonide increases expression ISO Fgd5 (Mus musculus) 6480464 triptonide results in increased expression of FGD5 mRNA CTD PMID:33045310 Fgd5 Rat troglitazone decreases expression ISO Fgd5 (Mus musculus) 6480464 troglitazone results in decreased expression of FGD5 mRNA CTD PMID:28973697 Fgd5 Rat valproic acid affects expression ISO FGD5 (Homo sapiens) 6480464 Valproic Acid affects the expression of FGD5 mRNA CTD PMID:25979313 Fgd5 Rat valproic acid increases expression ISO FGD5 (Homo sapiens) 6480464 Valproic Acid results in increased expression of FGD5 mRNA CTD PMID:23179753 more ... Fgd5 Rat valproic acid multiple interactions ISO FGD5 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of FGD5 mRNA CTD PMID:27188386 Fgd5 Rat valproic acid increases methylation ISO FGD5 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of FGD5 gene CTD PMID:29154799 Fgd5 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of FGD5 mRNA CTD PMID:19015723
1,1-dichloroethene (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3,3',4,4',5-pentachlorobiphenyl (ISO) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 5-aza-2'-deoxycytidine (ISO) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) amiodarone (ISO) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) benzo[e]pyrene (ISO) beta-naphthoflavone (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) CGP 52608 (ISO) chlorpyrifos (ISO) cisplatin (ISO) cobalt dichloride (ISO) cocaine (EXP) cyclosporin A (ISO) diquat (ISO) dorsomorphin (ISO) entinostat (ISO) ethylparaben (ISO) glyphosate (ISO) lipopolysaccharide (ISO) methapyrilene (ISO) methoxychlor (EXP) N-Nitrosopyrrolidine (ISO) nickel atom (ISO) O-methyleugenol (ISO) orphenadrine (EXP) ozone (ISO) panobinostat (ISO) phenylmercury acetate (ISO) resveratrol (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) Soman (EXP) titanium dioxide (ISO) toluene (EXP) trichostatin A (ISO) triptonide (ISO) troglitazone (ISO) valproic acid (ISO) vinclozolin (EXP)
Fgd5 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 126,054,201 - 126,151,698 (+) NCBI GRCr8 mRatBN7.2 4 124,497,061 - 124,594,564 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 124,497,068 - 124,594,563 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 129,964,067 - 130,061,661 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 125,738,497 - 125,836,093 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 124,363,028 - 124,460,626 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 123,865,557 - 123,962,904 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 123,865,725 - 123,962,881 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 189,298,419 - 189,395,965 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 126,237,049 - 126,276,419 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 126,432,006 - 126,521,133 (+) NCBI Celera 4 113,414,985 - 113,512,420 (+) NCBI Celera Cytogenetic Map 4 q34 NCBI
FGD5 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 14,810,688 - 14,934,571 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 14,810,853 - 14,934,571 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 14,860,469 - 14,976,078 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 14,835,810 - 14,950,899 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 3 14,835,809 - 14,950,899 NCBI Celera 3 14,798,707 - 14,914,334 (+) NCBI Celera Cytogenetic Map 3 p25.1 NCBI HuRef 3 14,796,239 - 14,911,901 (+) NCBI HuRef CHM1_1 3 14,811,508 - 14,927,026 (+) NCBI CHM1_1 T2T-CHM13v2.0 3 14,813,154 - 14,937,021 (+) NCBI T2T-CHM13v2.0
Fgd5 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 6 91,955,809 - 92,052,986 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 6 91,955,859 - 92,052,985 (+) Ensembl GRCm39 Ensembl GRCm38 6 91,978,827 - 92,076,005 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 6 91,978,878 - 92,076,004 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 6 91,937,104 - 92,025,999 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 6 91,952,614 - 92,041,509 (+) NCBI MGSCv36 mm8 Celera 6 93,881,166 - 93,970,222 (+) NCBI Celera Cytogenetic Map 6 D1 NCBI cM Map 6 41.0 NCBI
Fgd5 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955429 17,304,992 - 17,366,051 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955429 17,297,123 - 17,367,365 (+) NCBI ChiLan1.0 ChiLan1.0
FGD5 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 14,792,284 - 14,915,818 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 14,797,051 - 14,920,581 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 14,732,712 - 14,856,251 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 15,072,214 - 15,195,608 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 3 15,072,214 - 15,195,608 (+) Ensembl panpan1.1 panPan2
FGD5 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 20 4,905,898 - 5,028,637 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 20 4,906,800 - 5,027,537 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 20 4,937,689 - 5,065,901 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 20 4,921,741 - 5,050,020 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 20 4,928,132 - 5,050,017 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 20 4,640,172 - 4,768,367 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 20 4,991,109 - 5,119,078 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 20 4,974,498 - 5,102,732 (+) NCBI UU_Cfam_GSD_1.0
Fgd5
FGD5 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 69,594,223 - 69,724,056 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 69,594,225 - 69,724,051 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 77,089,973 - 77,129,974 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
FGD5 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 22 50,746,210 - 50,868,659 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 22 50,746,303 - 50,870,049 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666041 115,624,838 - 115,748,381 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Fgd5
.
Predicted Target Of
Count of predictions: 152 Count of miRNA genes: 67 Interacting mature miRNAs: 70 Transcripts: ENSRNOT00000051022, ENSRNOT00000072925 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1582232 Gluco25 Glucose level QTL 25 3.6 0.0023 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 85253748 148090731 Rat 631689 Scl4 Serum cholesterol level QTL 4 1.9 0.008 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 4 95174120 140174120 Rat 1358352 Srcrt3 Stress Responsive Cort QTL 3 2.29 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 38465774 146803430 Rat 1578655 Bmd11 Bone mineral density QTL 11 11 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 4 90850165 135850165 Rat 1300116 Hrtrt5 Heart rate QTL 5 3.76 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 4 116179486 151161268 Rat 10755501 Bp390 Blood pressure QTL 390 2.5 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 4 26775591 168368347 Rat 631683 Bp116 Blood pressure QTL 116 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 124303370 169303370 Rat 61330 Eau1 Experimental allergic uveoretinitis QTL 1 0.0003 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 4 70362013 132642728 Rat 731165 Uae21 Urinary albumin excretion QTL 21 2.4 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 4 106649412 151649412 Rat 737821 Hcar9 Hepatocarcinoma resistance QTL 9 3.7 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 4 109866907 167139601 Rat 1549832 Bss3 Bone structure and strength QTL 3 11 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 4 109827074 154827074 Rat 70177 Xhs1 X-ray hypersensitivity QTL 1 25.1 intestine integrity trait (VT:0010554) post-insult time to onset of moribundity (CMO:0001896) 4 82798864 152731274 Rat 61476 Aia3 Adjuvant induced arthritis QTL 3 3.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 86730991 131730991 Rat 1641919 Alc22 Alcohol consumption QTL 22 0.0005 drinking behavior trait (VT:0001422) ethanol drink intake rate (CMO:0001407) 4 81192555 126192555 Rat 1354660 Salc1 Saline consumption QTL 1 11.26 drinking behavior trait (VT:0001422) saline drink intake rate (CMO:0001627) 4 44463908 148090542 Rat 1298082 Stresp4 Stress response QTL 4 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 50119848 146803430 Rat 1578670 Bss14 Bone structure and strength QTL 14 16.4 femur morphology trait (VT:0000559) bone trabecular cross-sectional area (CMO:0002311) 4 87327165 132327165 Rat 70201 Gcr1 Gastric cancer resistance QTL 1 2.7 stomach morphology trait (VT:0000470) stomach tumor susceptibility score (CMO:0002043) 4 120260281 147278687 Rat 70200 Alc18 Alcohol consumption QTL 18 9.2 drinking behavior trait (VT:0001422) ethanol intake volume to total fluid intake volume ratio (CMO:0001591) 4 56647873 149491524 Rat 1331759 Hrtrt13 Heart rate QTL 13 3.54628 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 4 110275411 168266883 Rat 724535 Cm18 Cardiac mass QTL 18 2.6 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 4 118856416 163856416 Rat 2316958 Gluco58 Glucose level QTL 58 10 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 11320076 180699135 Rat 1578662 Bss15 Bone structure and strength QTL 15 19.6 femur width (VT:1000666) femoral neck width (CMO:0001695) 4 87327165 132327165 Rat 2302049 Pia32 Pristane induced arthritis QTL 32 5.1 0.001 blood autoantibody amount (VT:0003725) serum immunoglobulin G-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002112) 4 105789505 150789505 Rat 6478763 Anxrr46 Anxiety related response QTL 46 0.07428 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 110870972 155870972 Rat 6478760 Anxrr45 Anxiety related response QTL 45 0.06717 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 110870972 155870972 Rat 1331802 Srn5 Serum renin concentration QTL 5 3.045 renin activity (VT:0005581) plasma renin activity level (CMO:0000116) 4 119428175 157578333 Rat 738009 Sach4 Saccharine consumption QTL 4 4.9 0.000016 consumption behavior trait (VT:0002069) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 4 59948935 154902892 Rat 2312567 Glom19 Glomerulus QTL 19 1.9 0.006 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 4 45456990 146803430 Rat 738015 Pia9 Pristane induced arthritis QTL 9 4.5 0.048 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 80694870 125694870 Rat 7207480 Bss105 Bone structure and strength QTL 105 8.1 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 4 109827074 154827074 Rat 634335 Anxrr16 Anxiety related response QTL 16 7.22 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 4 93308457 167139447 Rat 631646 Stl4 Serum triglyceride level QTL 4 6.5 0.0001 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 4 73169846 132642728 Rat 634334 Xhs3 X-ray hypersensitivity QTL 3 10 intestine integrity trait (VT:0010554) post-insult time to onset of moribundity (CMO:0001896) 4 84728680 129854654 Rat 61406 Scwia1 Streptococcal cell wall induced arthritis QTL 1 2.3 joint integrity trait (VT:0010548) experimental arthritis severity measurement (CMO:0001459) 4 106805662 151805662 Rat 1354612 Foco1 Food consumption QTL 1 8.87 eating behavior trait (VT:0001431) food intake rate (CMO:0000427) 4 44463908 148090542 Rat 634347 Hcar8 Hepatocarcinoma resistance QTL 8 5.8 liver integrity trait (VT:0010547) liver tumorous lesion area to total liver area ratio (CMO:0001075) 4 123143783 168143783 Rat 2303168 Bp330 Blood pressure QTL 330 4.25 0.017 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 5214602 146446691 Rat 738031 Alc14 Alcohol consumption QTL 14 7.6 0.00003 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 4 59948935 154902892 Rat 1576316 Ept5 Estrogen-induced pituitary tumorigenesis QTL 5 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 4 83428419 177635233 Rat 1576305 Emca6 Estrogen-induced mammary cancer QTL 6 5.8 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 4 44463720 155883716 Rat 61418 Pia5 Pristane induced arthritis QTL 5 4.5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 62277855 128289560 Rat 738016 Alc16 Alcohol consumption QTL 16 3.6 0.00015 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 4 59948935 154902892 Rat 1358202 Gluco11 Glucose level QTL 11 2.4 0.02 adipocyte glucose uptake trait (VT:0004185) absolute change in adipocyte glucose uptake (CMO:0000873) 4 85379421 167139601 Rat 1641833 Alc21 Alcohol consumption QTL 21 8.6 0.0001 drinking behavior trait (VT:0001422) ethanol drink intake rate (CMO:0001407) 4 56698790 126192555 Rat 631674 Iddm14 Insulin dependent diabetes mellitus QTL 14 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 4 64528739 157573521 Rat 2293840 Kiddil9 Kidney dilation QTL 9 2.9 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 4 120926564 148090731 Rat 12798519 Anxrr54 Anxiety related response QTL 54 2.54 0.05 locomotor behavior trait (VT:0001392) distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493) 4 114627026 159627026 Rat 12798523 Anxrr56 Anxiety related response QTL 56 2.83 0.05 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 85253748 150276390 Rat 61434 Cia3 Collagen induced arthritis QTL 3 4.8 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 103194656 148194656 Rat 12798527 Anxrr58 Anxiety related response QTL 58 4.11 0.05 locomotor behavior trait (VT:0001392) distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493) 4 119463257 147278687 Rat
RH127786
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 124,594,140 - 124,594,360 (+) MAPPER mRatBN7.2 Rnor_6.0 4 123,962,481 - 123,962,700 NCBI Rnor6.0 Rnor_5.0 4 189,298,627 - 189,298,846 UniSTS Rnor5.0 RGSC_v3.4 4 126,275,983 - 126,276,202 UniSTS RGSC3.4 Celera 4 113,511,997 - 113,512,216 UniSTS RH 3.4 Map 4 736.04 UniSTS Cytogenetic Map 4 q34 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000051022 ⟹ ENSRNOP00000040013
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 124,497,068 - 124,594,563 (+) Ensembl Rnor_6.0 Ensembl 4 123,865,725 - 123,962,881 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000094992 ⟹ ENSRNOP00000079142
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 124,505,240 - 124,592,840 (+) Ensembl
RefSeq Acc Id:
NM_001108637 ⟹ NP_001102107
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 126,054,210 - 126,151,698 (+) NCBI mRatBN7.2 4 124,497,068 - 124,594,564 (+) NCBI
RefSeq Acc Id:
XM_006236926 ⟹ XP_006236988
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 126,054,201 - 126,151,683 (+) NCBI mRatBN7.2 4 124,497,061 - 124,594,564 (+) NCBI Rnor_6.0 4 123,865,557 - 123,962,904 (+) NCBI Rnor_5.0 4 189,298,419 - 189,395,965 (-) NCBI
Sequence:
GAGGAAACATCTAGGAGCGGGCGGAGGCGCGGCCGGAGCCTGGAGCCCCGAGCTTGAGCGGACGCCCCGCCCAACCCGAGCCCCGCGCCCAGCGCCCCTCGCCTTACCGCGGAGTGCTGCGCCCGGGG
hide sequence
RefSeq Acc Id:
XP_006236988 ⟸ XM_006236926
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I5ZMC4 (UniProtKB/TrEMBL)
- Sequence:
MHRADSPKPPVAPKPKVTTNPSTPPAKFPASQRPNSFPSPNSMSRGPKPPIAPKPRLAGPSEYGAGVYLNNSLSKCSNGRLLCEDPSLYDGHHSTLNCLELETDEQYIMVPRAPQRDDALTDRATEKQ
hide sequence
Ensembl Acc Id:
ENSRNOP00000040013 ⟸ ENSRNOT00000051022
RefSeq Acc Id:
NP_001102107 ⟸ NM_001108637
- UniProtKB:
F1LTE6 (UniProtKB/TrEMBL), A0A8I5ZMC4 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000079142 ⟸ ENSRNOT00000094992
RGD ID: 13693269 Promoter ID: EPDNEW_R3782 Type: initiation region Name: Fgd5_1 Description: FYVE, RhoGEF and PH domain containing 5 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 4 123,865,629 - 123,865,689 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-04-30
Fgd5
FYVE, RhoGEF and PH domain containing 5
Fgd5_predicted
FYVE, RhoGEF and PH domain containing 5 (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Fgd5_predicted
FYVE, RhoGEF and PH domain containing 5 (predicted)
Symbol and Name status set to approved
70820 APPROVED
