Advanced Search (OLGA)

Gene: Cdkl1 (cyclin dependent kinase like 1) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Cdkl1

Name:

cyclin dependent kinase like 1

RGD ID:

1305080

Description:

Predicted to enable protein serine/threonine kinase activity. Involved in heart development. Predicted to be located in ciliary transition zone and nucleoplasm. Predicted to be active in nucleus. Orthologous to human CDKL1 (cyclin dependent kinase like 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; 3,4-methylenedioxymethamphetamine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

Cdkl1_predicted; cyclin-dependent kinase-like 1; cyclin-dependent kinase-like 1 (CDC2-related kinase); cyclin-dependent kinase-like 1 (CDC2-related kinase) (predicted); LOC362689

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CDKL1 (cyclin dependent kinase like 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Cdkl1 (cyclin dependent kinase like 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Cdkl1 (cyclin dependent kinase like 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CDKL1 (cyclin dependent kinase like 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CDKL1 (cyclin dependent kinase like 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Cdkl1 (cyclin dependent kinase like 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CDKL1 (cyclin dependent kinase like 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CDKL1 (cyclin dependent kinase like 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Cdkl1 (cyclin dependent kinase like 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	PCF11 (PCF11 cleavage and polyadenylation factor subunit)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	CDKL1 (cyclin dependent kinase like 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Cdkl1 (cyclin dependent kinase like 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	cdkl1 (cyclin-dependent kinase-like 1 (CDC2-related kinase))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG7236	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	cdkl-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	cdkl1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	93,960,157 - 94,005,207 (-)	NCBI		GRCr8
mRatBN7.2	6	88,224,154 - 88,273,434 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	88,224,143 - 88,270,276 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	88,623,989 - 88,667,896 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	88,923,441 - 88,967,352 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	88,363,180 - 88,407,097 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	92,076,247 - 92,123,108 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	92,077,416 - 92,121,351 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	101,525,767 - 101,572,007 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	6	91,800,976 - 91,869,815 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	6	3,426,823 - 3,447,743 (-)	NCBI
Celera	6	86,720,262 - 86,764,060 (-)	NCBI		Celera
Cytogenetic Map	6	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cdkl1	Rat	Noonan syndrome 9		ISO	CDKL1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Noonan syndrome 9	ClinVar	PMID:28492532

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cdkl1	Rat	1,1-dichloroethene	decreases expression	ISO	Cdkl1 (Mus musculus)	6480464	vinylidene chloride results in decreased expression of CDKL1 mRNA	CTD	PMID:26682919
Cdkl1	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Cdkl1 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of CDKL1 mRNA	CTD	PMID:21570461
Cdkl1	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of CDKL1 mRNA	CTD	PMID:33387578
Cdkl1	Rat	2,3,7,8-Tetrachlorodibenzofuran	decreases expression	EXP		6480464	2 more ...	CTD	PMID:32109520
Cdkl1	Rat	3,4-methylenedioxymethamphetamine	decreases expression	EXP		6480464	N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of CDKL1 mRNA	CTD	PMID:30071829
Cdkl1	Rat	4,4'-sulfonyldiphenol	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of CDKL1 mRNA	CTD	PMID:36041667
Cdkl1	Rat	4,4'-sulfonyldiphenol	affects methylation	ISO	Cdkl1 (Mus musculus)	6480464	bisphenol S affects the methylation of CDKL1 gene	CTD	PMID:31683443
Cdkl1	Rat	4-hydroxyphenyl retinamide	increases expression	ISO	Cdkl1 (Mus musculus)	6480464	Fenretinide results in increased expression of CDKL1 mRNA	CTD	PMID:28973697
Cdkl1	Rat	6-propyl-2-thiouracil	increases expression	EXP		6480464	Propylthiouracil results in increased expression of CDKL1 mRNA	CTD	PMID:24780913
Cdkl1	Rat	6-propyl-2-thiouracil	decreases expression	EXP		6480464	Propylthiouracil results in decreased expression of CDKL1 mRNA	CTD	PMID:30047161
Cdkl1	Rat	acetamide	increases expression	EXP		6480464	acetamide results in increased expression of CDKL1 mRNA	CTD	PMID:31881176
Cdkl1	Rat	aflatoxin B1	increases expression	EXP		6480464	Aflatoxin B1 results in increased expression of CDKL1 mRNA	CTD	PMID:33354967
Cdkl1	Rat	amitrole	decreases expression	EXP		6480464	Amitrole results in decreased expression of CDKL1 mRNA	CTD	PMID:30047161
Cdkl1	Rat	benzo[a]pyrene	increases methylation	ISO	CDKL1 (Homo sapiens)	6480464	Benzo(a)pyrene results in increased methylation of CDKL1 exon	CTD	PMID:27901495
Cdkl1	Rat	benzo[a]pyrene	increases expression	ISO	CDKL1 (Homo sapiens)	6480464	Benzo(a)pyrene results in increased expression of CDKL1 mRNA	CTD	PMID:32234424
Cdkl1	Rat	bis(2-ethylhexyl) phthalate	increases expression	ISO	Cdkl1 (Mus musculus)	6480464	Diethylhexyl Phthalate results in increased expression of CDKL1 mRNA	CTD	PMID:34319233
Cdkl1	Rat	bisphenol A	increases expression	ISO	CDKL1 (Homo sapiens)	6480464	bisphenol A results in increased expression of CDKL1 mRNA	CTD	PMID:29275510
Cdkl1	Rat	bisphenol A	increases expression	ISO	Cdkl1 (Mus musculus)	6480464	bisphenol A results in increased expression of CDKL1 mRNA	CTD	PMID:32156529
Cdkl1	Rat	bisphenol A	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of CDKL1 mRNA	CTD	PMID:36041667
Cdkl1	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of CDKL1 mRNA	CTD	PMID:25181051 and PMID:30816183
Cdkl1	Rat	bisphenol F	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of CDKL1 mRNA	CTD	PMID:36041667
Cdkl1	Rat	carbon nanotube	decreases expression	ISO	Cdkl1 (Mus musculus)	6480464	Nanotubes and Carbon results in decreased expression of CDKL1 mRNA	CTD	PMID:25554681
Cdkl1	Rat	cefaloridine	decreases expression	EXP		6480464	Cephaloridine results in decreased expression of CDKL1 mRNA	CTD	PMID:18500788
Cdkl1	Rat	cisplatin	increases expression	ISO	CDKL1 (Homo sapiens)	6480464	Cisplatin results in increased expression of CDKL1 mRNA	CTD	PMID:27392435
Cdkl1	Rat	copper(II) sulfate	decreases expression	ISO	CDKL1 (Homo sapiens)	6480464	Copper Sulfate results in decreased expression of CDKL1 mRNA	CTD	PMID:19549813
Cdkl1	Rat	decabromodiphenyl ether	multiple interactions	EXP		6480464	[Flame Retardants co-treated with pentabromodiphenyl ether co-treated with decabromobiphenyl ether co-treated with hexabromocyclododecane] results in decreased expression of CDKL1 mRNA	CTD	PMID:32207525
Cdkl1	Rat	dimethylarsinic acid	multiple interactions	ISO	Cdkl1 (Mus musculus)	6480464	[sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in increased expression of CDKL1 mRNA	CTD	PMID:34876320
Cdkl1	Rat	dioxygen	increases expression	ISO	Cdkl1 (Mus musculus)	6480464	Oxygen deficiency results in increased expression of CDKL1 mRNA	CTD	PMID:22629407
Cdkl1	Rat	dioxygen	multiple interactions	ISO	Cdkl1 (Mus musculus)	6480464	Oxygen inhibits the reaction [Oxygen deficiency results in increased expression of CDKL1 mRNA]	CTD	PMID:22629407
Cdkl1	Rat	dorsomorphin	multiple interactions	ISO	CDKL1 (Homo sapiens)	6480464	[NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of CDKL1 mRNA	CTD	PMID:27188386
Cdkl1	Rat	ethylparaben	decreases expression	ISO	CDKL1 (Homo sapiens)	6480464	ethyl-p-hydroxybenzoate results in decreased expression of CDKL1 mRNA	CTD	PMID:37690743
Cdkl1	Rat	FR900359	increases phosphorylation	ISO	CDKL1 (Homo sapiens)	6480464	FR900359 results in increased phosphorylation of CDKL1 protein	CTD	PMID:37730182
Cdkl1	Rat	furan	increases methylation	EXP		6480464	furan results in increased methylation of CDKL1 gene	CTD	PMID:22079235
Cdkl1	Rat	furan	increases expression	EXP		6480464	furan results in increased expression of CDKL1 mRNA	CTD	PMID:25539665
Cdkl1	Rat	mercury dichloride	decreases expression	EXP		6480464	Mercuric Chloride results in decreased expression of CDKL1 mRNA	CTD	PMID:16507785
Cdkl1	Rat	methimazole	decreases expression	EXP		6480464	Methimazole results in decreased expression of CDKL1 mRNA	CTD	PMID:30047161
Cdkl1	Rat	methylarsonic acid	multiple interactions	ISO	Cdkl1 (Mus musculus)	6480464	[sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in increased expression of CDKL1 mRNA	CTD	PMID:34876320
Cdkl1	Rat	methylseleninic acid	decreases expression	ISO	CDKL1 (Homo sapiens)	6480464	methylselenic acid results in decreased expression of CDKL1 mRNA	CTD	PMID:11830524
Cdkl1	Rat	N-acetyl-beta-D-glucosamine	decreases expression	ISO	CDKL1 (Homo sapiens)	6480464	Acetylglucosamine results in decreased expression of CDKL1 mRNA	CTD	PMID:18047607
Cdkl1	Rat	N-acetyl-D-glucosamine	decreases expression	ISO	CDKL1 (Homo sapiens)	6480464	Acetylglucosamine results in decreased expression of CDKL1 mRNA	CTD	PMID:18047607
Cdkl1	Rat	paracetamol	increases expression	EXP		6480464	Acetaminophen results in increased expression of CDKL1 mRNA	CTD	PMID:33387578
Cdkl1	Rat	phenylmercury acetate	decreases expression	ISO	CDKL1 (Homo sapiens)	6480464	Phenylmercuric Acetate results in decreased expression of CDKL1 mRNA	CTD	PMID:26272509
Cdkl1	Rat	phenylmercury acetate	multiple interactions	ISO	CDKL1 (Homo sapiens)	6480464	[NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of CDKL1 mRNA	CTD	PMID:27188386
Cdkl1	Rat	pioglitazone	multiple interactions	ISO	Cdkl1 (Mus musculus)	6480464	[N-nitroso-tris-chloroethylurea co-treated with pioglitazone] results in decreased expression of CDKL1 mRNA	CTD	PMID:27935865
Cdkl1	Rat	progesterone	decreases expression	ISO	Cdkl1 (Mus musculus)	6480464	Progesterone results in decreased expression of CDKL1 mRNA	CTD	PMID:17556502
Cdkl1	Rat	progesterone	multiple interactions	ISO	Cdkl1 (Mus musculus)	6480464	NCOA2 protein affects the reaction [Progesterone results in decreased expression of CDKL1 mRNA]	CTD	PMID:17556502
Cdkl1	Rat	SB 431542	multiple interactions	ISO	CDKL1 (Homo sapiens)	6480464	[NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of CDKL1 mRNA	CTD	PMID:27188386
Cdkl1	Rat	sodium arsenate	multiple interactions	ISO	Cdkl1 (Mus musculus)	6480464	[sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in increased expression of CDKL1 mRNA	CTD	PMID:34876320
Cdkl1	Rat	sodium arsenite	decreases expression	ISO	CDKL1 (Homo sapiens)	6480464	sodium arsenite results in decreased expression of CDKL1 mRNA	CTD	PMID:38568856
Cdkl1	Rat	sodium arsenite	multiple interactions	ISO	Cdkl1 (Mus musculus)	6480464	[sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in increased expression of CDKL1 mRNA	CTD	PMID:34876320
Cdkl1	Rat	sulfadimethoxine	decreases expression	EXP		6480464	Sulfadimethoxine results in decreased expression of CDKL1 mRNA	CTD	PMID:30047161
Cdkl1	Rat	sunitinib	decreases expression	ISO	CDKL1 (Homo sapiens)	6480464	Sunitinib results in decreased expression of CDKL1 mRNA	CTD	PMID:31533062
Cdkl1	Rat	titanium dioxide	decreases expression	ISO	Cdkl1 (Mus musculus)	6480464	titanium dioxide results in decreased expression of CDKL1 mRNA	CTD	PMID:23557971 and PMID:29264374
Cdkl1	Rat	triphenyl phosphate	affects expression	ISO	CDKL1 (Homo sapiens)	6480464	triphenyl phosphate affects the expression of CDKL1 mRNA	CTD	PMID:37042841
Cdkl1	Rat	urethane	decreases expression	ISO	CDKL1 (Homo sapiens)	6480464	Urethane results in decreased expression of CDKL1 mRNA	CTD	PMID:28818685
Cdkl1	Rat	vancomycin	increases expression	ISO	Cdkl1 (Mus musculus)	6480464	Vancomycin results in increased expression of CDKL1 mRNA	CTD	PMID:18930951

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cdkl1	Rat	heart development		IEP		2316160		RGD
Cdkl1	Rat	regulation of cell cycle	involved_in	IEA	GO:0004693	1600115	GO_REF:0000108	GOC	GO_REF:0000108
Cdkl1	Rat	regulation of cilium assembly	involved_in	ISS	UniProtKB:Q9U2H1	1600115	GO_REF:0000024	UniProt	GO_REF:0000024

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cdkl1	Rat	ciliary transition zone	located_in	ISS	UniProtKB:Q9U2H1	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Cdkl1	Rat	cytoplasm	located_in	IEA	UniProtKB-SubCell:SL-0086	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Cdkl1	Rat	intracellular membrane-bounded organelle	located_in	ISO	CDKL1 (Homo sapiens)	1624291		RGD	GO_REF:0000052
Cdkl1	Rat	nucleoplasm	located_in	ISO	CDKL1 (Homo sapiens)	1624291		RGD	GO_REF:0000052
Cdkl1	Rat	nucleoplasm	located_in	IEA	UniProtKB:Q00532 and ensembl:ENSP00000379176	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cdkl1	Rat	nucleus	is_active_in	IBA	FB:FBgn0015618 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cdkl1	Rat	ATP binding	enables	IEA	UniProtKB-KW:KW-0067	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Cdkl1	Rat	ATP binding	enables	IEA	InterPro:IPR000719	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Cdkl1	Rat	ATP binding	enables	IEA	UniRule:UR001503341	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Cdkl1	Rat	cyclin-dependent protein serine/threonine kinase activity	enables	IEA	EC:2.7.11.22	1600115	GO_REF:0000003	UniProt	GO_REF:0000003
Cdkl1	Rat	protein serine kinase activity	enables	IEA	RHEA:17989	1600115	GO_REF:0000116	RHEA	GO_REF:0000116
Cdkl1	Rat	protein serine/threonine kinase activity	enables	IEA	UniProtKB-KW:KW-0723	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Cdkl1	Rat	protein serine/threonine kinase activity	enables	IBA	CGD:CAL0000183529 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Expression of second messenger- and cyclin-dependent protein kinases during postnatal development of rat heart.	Kim SO, etal., J Cell Biochem. 1998 Jun 15;69(4):506-21.
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	GOA pipeline	RGD automated data pipeline
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Comprehensive gene review and curation	RGD comprehensive gene curation

PMID:12477932	PMID:15489334	PMID:18570454

Cdkl1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	93,960,157 - 94,005,207 (-)	NCBI		GRCr8
mRatBN7.2	6	88,224,154 - 88,273,434 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	88,224,143 - 88,270,276 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	88,623,989 - 88,667,896 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	88,923,441 - 88,967,352 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	88,363,180 - 88,407,097 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	92,076,247 - 92,123,108 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	92,077,416 - 92,121,351 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	101,525,767 - 101,572,007 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	6	91,800,976 - 91,869,815 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	6	3,426,823 - 3,447,743 (-)	NCBI
Celera	6	86,720,262 - 86,764,060 (-)	NCBI		Celera
Cytogenetic Map	6	q24	NCBI

CDKL1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	14	50,326,265 - 50,397,298 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	14	50,326,265 - 50,416,461 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	14	50,792,983 - 50,864,016 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	14	49,866,470 - 49,932,367 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	14	49,866,469 - 49,932,367	NCBI
Celera	14	30,663,847 - 30,729,727 (-)	NCBI		Celera
Cytogenetic Map	14	q21.3	NCBI
HuRef	14	30,921,968 - 30,987,930 (-)	NCBI		HuRef
CHM1_1	14	50,735,355 - 50,801,213 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	14	44,532,486 - 44,603,508 (-)	NCBI		T2T-CHM13v2.0

Cdkl1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	12	69,791,944 - 69,838,057 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	12	69,793,622 - 69,838,041 (-)	Ensembl		GRCm39 Ensembl
GRCm38	12	69,745,167 - 69,791,196 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	12	69,746,848 - 69,791,267 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	12	70,847,835 - 70,891,694 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	12	70,665,453 - 70,709,312 (-)	NCBI		MGSCv36	mm8
Celera	12	70,842,757 - 70,886,848 (-)	NCBI		Celera
Cytogenetic Map	12	C2	NCBI
cM Map	12	28.94	NCBI

Cdkl1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955409	12,419,556 - 12,472,215 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955409	12,419,556 - 12,472,215 (+)	NCBI	ChiLan1.0	ChiLan1.0

CDKL1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	15	51,467,099 - 51,535,020 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	14	50,683,602 - 50,752,380 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	14	30,917,602 - 30,987,992 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	14	49,213,925 - 49,291,192 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	14	49,223,146 - 49,291,192 (-)	Ensembl	panpan1.1		panPan2

CDKL1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	8	26,771,498 - 26,828,287 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	8	26,773,636 - 26,828,270 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	8	26,525,498 - 26,581,908 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	8	26,949,620 - 27,006,081 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	8	26,949,620 - 27,006,517 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	8	26,604,557 - 26,661,001 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	8	26,676,990 - 26,733,441 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	8	26,995,836 - 27,052,284 (-)	NCBI		UU_Cfam_GSD_1.0

Cdkl1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	58,966,730 - 59,018,050 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936495	15,173,643 - 15,228,490 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936495	15,173,672 - 15,225,044 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CDKL1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	180,078,659 - 180,145,054 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	180,081,385 - 180,145,851 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	200,424,327 - 200,440,560 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CDKL1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	24	27,401,003 - 27,468,961 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	24	27,396,911 - 27,469,284 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666053	15,723,170 - 15,789,575 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cdkl1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624731	18,490,755 - 18,543,211 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624731	18,490,780 - 18,543,364 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Cdkl1
228 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	227
Count of miRNA genes:	156
Interacting mature miRNAs:	175
Transcripts:	ENSRNOT00000006374
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331799	Bp211	Blood pressure QTL 211	3.66407		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	6	72202632	130919985	Rat
634330	Pia16	Pristane induced arthritis QTL 16	3.9		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	6	45790088	104200226	Rat
1331789	Rf37	Renal function QTL 37	3.224		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	6	72202632	115200186	Rat
4145119	Mcs25	Mammary carcinoma susceptibility QTL 25		0.0001	mammary gland integrity trait (VT:0010552)	ratio of deaths to total study population during a period of time (CMO:0001023)	6	10894415	110548006	Rat
70176	Mcsm1	Mammary carcinoma susceptibility modifier QTL 1			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	6	58632962	103632962	Rat
1581563	Uae33	Urinary albumin excretion QTL 33			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	72227641	130729205	Rat
10054138	Gmadr3	Adrenal mass QTL 3	3.68	0.00045	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	6	85140138	130140138	Rat
1558641	Cm47	Cardiac mass QTL 47	2.9	0.001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	6	57730540	104085867	Rat
724524	Uae2	Urinary albumin excretion QTL 2	2.7	0.0005	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	73463459	109394713	Rat
737827	Hcar11	Hepatocarcinoma resistance QTL 11	4.4		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	6	82523650	110548006	Rat
1641904	Alcrsp4	Alcohol response QTL 4			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	6	67262953	112262953	Rat
724513	Uae14	Urinary albumin excretion QTL 14	6.5		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	85311061	133478515	Rat
2303624	Vencon5	Ventilatory control QTL 5	4.45		respiration trait (VT:0001943)	minute ventilation (CMO:0000132)	6	88047916	133047916	Rat
1576309	Emca7	Estrogen-induced mammary cancer QTL 7	4		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	6	15107216	107351382	Rat
731173	Uae22	Urinary albumin excretion QTL 22	10.1		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	65531555	140994061	Rat
2293837	Kiddil1	Kidney dilation QTL 1	3.7		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	6	81132889	104393926	Rat
2293842	Kiddil3	Kidney dilation QTL 3	4.3		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	6	81132889	104393926	Rat
4889848	Pur25	Proteinuria QTL 25	14	0.003	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	6	56728562	90198260	Rat
10054123	Srcrt6	Stress Responsive Cort QTL 6	2.5	0.0043	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	6	85140138	130140138	Rat
724536	Uae7	Urinary albumin excretion QTL 7	3.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	6	72202632	130729475	Rat
70196	BpQTLcluster7	Blood pressure QTL cluster 7	6.82		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	6	72202632	117202632	Rat
1581550	Pur8	Proteinuria QTL 8			urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	6	72227641	130729205	Rat
1576302	Schws4	Schwannoma susceptibility QTL 4		0.0078	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	6	83190345	106747639	Rat
1300075	Glom7	Glomerulus QTL 7	5.6	0.0000002	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	6	71201409	116201409	Rat
738034	Anxrr5	Anxiety related response QTL 5	5.9		exploratory behavior trait (VT:0010471)	percentage of entries into a discrete space in an experimental apparatus (CMO:0000961)	6	84130881	129130881	Rat
2290393	Uae37	Urinary albumin excretion QTL 37		0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	65531555	140994061	Rat
12801471	Schws9	Schwannoma susceptibility QTL 9			nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	6	61747639	106747639	Rat
6893332	Cm74	Cardiac mass QTL 74	0.4	0.64	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	6	57730540	104085867	Rat
1300076	Glom8	Glomerulus QTL 8	7	9e-09	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli directly contacting the kidney surface (CMO:0001001)	6	86894788	131894788	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001025121	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006240172	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006240173	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039112253	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039112254	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039112255	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC081896	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473947	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000006	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000006374 ⟹ ENSRNOP00000006374

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	88,225,329 - 88,270,276 (-)	Ensembl
Rnor_6.0 Ensembl	6	92,077,416 - 92,121,351 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000103862 ⟹ ENSRNOP00000092011

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	88,224,143 - 88,269,200 (-)	Ensembl

RefSeq Acc Id:

NM_001025121 ⟹ NP_001020292

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	93,961,289 - 94,005,194 (-)	NCBI
mRatBN7.2	6	88,225,291 - 88,269,200 (-)	NCBI
Rnor_6.0	6	92,077,379 - 92,121,351 (-)	NCBI
Rnor_5.0	6	101,525,767 - 101,572,007 (-)	NCBI
RGSC_v3.4	6	91,800,976 - 91,869,815 (-)	RGD
Celera	6	86,720,262 - 86,764,060 (-)	RGD

Sequence:

show sequence

GCATTTAGTTGATGAGGCTCGAGAGCGATCGGTTCTCGTATTTCATAAGCGACCTTTAAAAACTATATGAAAATCCGTTCTCAAGAAGACGTGCTCCTCTGTAATGGAAAAATACGAAAAAATTGGAA
AGATTGGAGAAGGTTCCTATGGGGTAGTGTTCAAGTGCAGAAACAGAGACACGGGTCAGATCGTGGCCATCAAGAGGTTTCTGGAAACCGAAGATGACCCTGTCATAAAGAAAATCGCCCTTCGAGAA
ATCCGCATGCTCAAGCAACTCAAGCATCCCAACCTCGTCAGCCTCCTGGAAGTCTTCCGCAGGAAGCGGCGGCTTCACCTGGTGTTCGAGTACTGCCACCACACGGTGCTTCACGAGCTGGACAGATA
TCAGAGGGGGGTACCAGAGCCTCTCGTGAAGAACATAACTTGGCAGACACTGCAGGCTGTGAATTTCTGCCATAAACACAACTGCATACACAGAGATGTGAAGCCGGAAAACATTCTCATCACCAAAC
ACTCAGTCATTAAGCTCTGTGACTTTGGGTTTGCACGGCTTCTCACTGGACCTGGTGACTACTACACTGACTACGTGGCCACCAGGTGGTACCGCTCACCTGAGCTGCTAGTGGGAGACACACAGTAT
GGCCCCCCAGTAGATGTCTGGGCAATTGGGTGTGTGTTTGCTGAGTTGCTGTCCGGAGTGCCTCTGTGGCCAGGAAAATCCGATGTGGACCAGCTCTATCTGATAAGGAAAACCCTGGGGGACCTCAT
TCCCAGGCACCAGCAAGTATTTAGCATGAATCAGTACTTCAGTGGGGTGAAAATTCCAGACCCTGAAGACATGGAAACACTTGAGTTGAAGTTTCCAAACATCTCCTACTCTGCTCTGGGCTTCTTAA
AGGGCTGCCTCCACATGGACCCTGCTGAGAGGCTGACATGTGAACAGCTATTGCAGCATCCGTATTTTGACAGCATTCGAGACGTTGGGGAATTGGCAAGACCACATGACAAACCAACAAGGAAGACC
CTGAGACAGAGTAGAAAGCACTTGACTGGGTTGCAGCACCTGCCTCAGCTAACCAGCAGCAGCGTCCTCCCCGCTCTGGACAGGAAGAAGTACCACTGTGGTACCAGGAACTTTAACTACCACTTTCC
AAATATTTAAGGAGCTGGCAGAGTAATGAAGAATTGATCAATAATTTGCAGAAATGTATACATTTGACTCCTGTCTTGACCACACATCAGGAGAAAACACGAACAGGAAGCTGGAGGTTATTTGCCAG
GATATGAGGGAAATTCCGGATCCAGACTTCCATGCTTGGTGGAGATGTCCAGAGAAGAGAGCAGGAGCTTGGGACATCTCTGCATCTTCCTTTTCTAAGCAGCAGAGCTTATGGACAGAATATAAACT
GTACCTAAGCCCGCAGCTGCAACATTAGATAATGTCAGAAGACCTGGGCTGCAGTTTGCTCTCTGCCACACGCAGAGAGTACATCAAGAAATGTCCTGGGTTGGGGATTTAGCTCAGTGGTAGAGCGC
TTGCCTAGGAAGCGCAAGGCCCTGGGTTCGGTCCCCAGCTCCCAAAAAAAGAACCAAAAAAAGAGAAATGTCCTGGGGTTGGGGATTTAGCTCAGTGGTAGAGCGCTTGCCTAGGAAGCACAAGGCCC
TGGGTTCAGTCCCCAGCTCCAGGAAAAAAAAAGAAAAAAAAAAAGAAAAAAAGAAATGTCCAGGGTTGGGGATTTGGCTCAGTGGTAGAGCGCTTACCTAGCAAGCACAAGGCCCTGGGTTCAATCCC
CAGCTCCGGAAAAAAAAAAAAAAAAAGAAAGAAAGAAAGAAAGAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_006240173 ⟹ XP_006240235

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	93,961,407 - 93,975,026 (-)	NCBI
mRatBN7.2	6	88,225,530 - 88,237,844 (-)	NCBI
Rnor_6.0	6	92,077,641 - 92,089,793 (-)	NCBI
Rnor_5.0	6	101,525,767 - 101,572,007 (-)	NCBI

Sequence:

show sequence

AGCTCGGATAGAATTCCCAAAGGGGTCGGGGGCAGCACATTCTTGTTTCTGAGTCCATCTGCCCATATGTCATCATGATATTCATGGAAGGACCTATTTATAGCAAAATGTAAAATAACTGGGGAAAG
ACTTCAGCCCCAAGAGCCATCGATCACTGAGAACCAGATAGGTAGGCTGTAAGGTAATGTATCCACCCCCGCCTCCAGTTTTTCCAGAATAAAAATGCTGGTGGGAAACACTAATGTTGCCCTCTCAC
CCTAAAAGTCCCTTGGAGTGGGAGCTGCTGCGCCCACGAAGAACCTCTGTCCTCTTTCCGGATTCTAGAGTCAAGGATAACCTCAAGGGTTGCGGGCTTCAGGCCAACAGTCAATTGGGCGGCAGAAA
GACCCAGCATTTCCCAGCAGAGAGGAAAACCCTTGGGAGAAGGGAGGGATCACGAGGAACTCAGAGTAATATTTTGTCCCAACTCAATTTTTAATGTAATTGTTAACTAAAAGTTGTTGACCTAAGAG
ATATGTTTATGGGGAAAGGGGGAACAAAAAAAGGAGAGTTACTTGTCAAAGGCATTGTCATTTAATAAGAAAGTCCTGTGAAAGTTCTCGAGCGGTCCTCTTGGTAGTGGCTTCCCCCTGTTAAAGAA
TGCAGCTTGATACCAGTTGGTGAGTCCGGATGCAGGAGCTGCCTGCTGAGGTCTGCTGGCTGTGCAGTGGGACAGAGCTGACATCTAGCGACGACATCGCACCCCAGAGGGTGAGGCTGCAGCCAGCT
CTTGTTTATCTTGTCAGGACAAATGTCAGAGCTGGAAGATCTTTTGGCAAGCGCTCAAGCTTCCCGCCCTCTCTTCCCCAGCTTATCTCAGCAGGCCCAGGGCTTGTCCTGTTTACCAAGCAGGCCGC
CTTCCAGTGAACCCAGCTTCTGCTCCAATCTGTTGTTCCTGCCACAGGCTGCAGCCTCAAAGCCTCTCATCCCTTCCCCTTCACGCCGGCAGTGCATACACAGAGATGTGAAGCCGGAAAACATTCTC
ATCACCAAACACTCAGTCATTAAGCTCTGTGACTTTGGGTTTGCACGGCTTCTCACTGGACCTGGTGACTACTACACTGACTACGTGGCCACCAGGTGGTACCGCTCACCTGAGCTGCTAGTGGGAGA
CACACAGTATGGCCCCCCAGTAGATGTCTGGGCAATTGGGTGTGTGTTTGCTGAGTTGCTGTCCGGAGTGCCTCTGTGGCCAGGAAAATCCGATGTGGACCAGCTCTATCTGATAAGGAAAACCCTGG
GGGACCTCATTCCCAGGCACCAGCAAGTATTTAGCATGAATCAGTACTTCAGTGGGGTGAAAATTCCAGACCCTGAAGACATGGAAACACTTGAGTTGAAGTTTCCAAACATCTCCTACTCTGCTCTG
GGCTTCTTAAAGGGCTGCCTCCACATGGACCCTGCTGAGAGGCTGACATGTGAACAGCTATTGCAGCATCCGTATTTTGACAGCATTCGAGACGTTGGGGAATTGGCAAGACCACATGACAAACCAAC
AAGGAAGACCCTGAGACAGAGTAGAAAGCACTTGACTGGGTTGCAGCACCTGCCTCAGCTAACCAGCAGCAGCGTCCTCCCCGCTCTGGACAGGAAGAAGTACCACTGTGGTACCAGGAACTTTAACT
ACCACTTTCCAAATATTTAAGGAGCTGGCAGAGTAATGAAGAATTGATCAATAATTTGCAGAAATGTATACATTTGACTCCTGTCTTGACCACACATCAGGAGAAAACACGAACAGGAAGCTGGAGGT
TATTTGCCAGGATATGAGGGAAATTCCGGATCCAGACTTCCATGCTTGGTGGAGATGTCCAGAGAAGAGAGCAGGAGCTTGGGACATCTCTGCATCTTCCTTTTCTAAGCAGCAGAGCTTATGGACAG
AATATAAACTGTACCTAAGCCCGCAGCTGCAACATTAGATAATGTCAGAAGACCTGGGCTGCAGTTTGCTCTCTGCCACACGCAGAGAGTACATCAAGAAATGTCCTGGGTTGGGGATTTAGCTCAGT
GGTAGAGCGCTTGCCTAGGAAGCGCAAGGCCCTGGGTTCGGTCCCCAGCT

hide sequence

RefSeq Acc Id:

XM_039112253 ⟹ XP_038968181

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	93,960,157 - 94,005,207 (-)	NCBI
mRatBN7.2	6	88,224,154 - 88,273,428 (-)	NCBI

RefSeq Acc Id:

XM_039112254 ⟹ XP_038968182

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	93,960,157 - 94,005,207 (-)	NCBI
mRatBN7.2	6	88,224,154 - 88,273,428 (-)	NCBI

RefSeq Acc Id:

XM_039112255 ⟹ XP_038968183

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	93,964,121 - 94,005,207 (-)	NCBI
mRatBN7.2	6	88,228,124 - 88,273,434 (-)	NCBI


Protein RefSeqs	NP_001020292	(Get FASTA)	NCBI Sequence Viewer
	XP_006240235	(Get FASTA)	NCBI Sequence Viewer
	XP_038968181	(Get FASTA)	NCBI Sequence Viewer
	XP_038968182	(Get FASTA)	NCBI Sequence Viewer
	XP_038968183	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH81896	(Get FASTA)	NCBI Sequence Viewer
	EDM03530	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000006374.6
	ENSRNOP00000092011.1
GenBank Protein	Q66HE7	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001020292 ⟸ NM_001025121

- UniProtKB:

Q66HE7 (UniProtKB/Swiss-Prot), A0A8L2UHZ3 (UniProtKB/TrEMBL), A6HBX5 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MEKYEKIGKIGEGSYGVVFKCRNRDTGQIVAIKRFLETEDDPVIKKIALREIRMLKQLKHPNLVSLLEVFRRKRRLHLVFEYCHHTVLHELDRYQRGVPEPLVKNITWQTLQAVNFCHKHNCIHRDVK
PENILITKHSVIKLCDFGFARLLTGPGDYYTDYVATRWYRSPELLVGDTQYGPPVDVWAIGCVFAELLSGVPLWPGKSDVDQLYLIRKTLGDLIPRHQQVFSMNQYFSGVKIPDPEDMETLELKFPNI
SYSALGFLKGCLHMDPAERLTCEQLLQHPYFDSIRDVGELARPHDKPTRKTLRQSRKHLTGLQHLPQLTSSSVLPALDRKKYHCGTRNFNYHFPNI

hide sequence

RefSeq Acc Id:

XP_006240235 ⟸ XM_006240173

- Peptide Label:

isoform X3

- Sequence:

show sequence

MSELEDLLASAQASRPLFPSLSQQAQGLSCLPSRPPSSEPSFCSNLLFLPQAAASKPLIPSPSRRQCIHRDVKPENILITKHSVIKLCDFGFARLLTGPGDYYTDYVATRWYRSPELLVGDTQYGPPV
DVWAIGCVFAELLSGVPLWPGKSDVDQLYLIRKTLGDLIPRHQQVFSMNQYFSGVKIPDPEDMETLELKFPNISYSALGFLKGCLHMDPAERLTCEQLLQHPYFDSIRDVGELARPHDKPTRKTLRQS
RKHLTGLQHLPQLTSSSVLPALDRKKYHCGTRNFNYHFPNI

hide sequence

Ensembl Acc Id:

ENSRNOP00000006374 ⟸ ENSRNOT00000006374

RefSeq Acc Id:	XP_038968182 ⟸ XM_039112254
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_038968181 ⟸ XM_039112253
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I6GJE5 (UniProtKB/TrEMBL)

Protein Domains

Protein kinase

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q66HE7-F1-model_v2	AlphaFold	Q66HE7	1-352	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13694640

Promoter ID:

EPDNEW_R5163

Type:

single initiation site

Name:

Cdkl1_1

Description:

cyclin dependent kinase like 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	6	92,121,366 - 92,121,426	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-37225	BioCyc
Ensembl Genes	ENSRNOG00000038720	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000006374.6	UniProtKB/TrEMBL
	ENSRNOT00000103862.1	UniProtKB/TrEMBL
Gene3D-CATH	Phosphorylase Kinase, domain 1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Transferase(Phosphotransferase) domain 1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7110321	IMAGE-MGC_LOAD
InterPro	CDK	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Kinase-like_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Prot_kinase_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Protein_kinase_ATP_BS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ser/Thr_kinase_AS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:314198	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:93810	IMAGE-MGC_LOAD
NCBI Gene	Cdkl1	ENTREZGENE
PANTHER	CELL DIVISION PROTEIN KINASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	CYCLIN-DEPENDENT KINASE-LIKE 1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Pkinase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PharmGKB	CDKL1	RGD
PhenoGen	Cdkl1	PhenoGen
PROSITE	PROTEIN_KINASE_ATP	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PROTEIN_KINASE_DOM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PROTEIN_KINASE_ST	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000038720	RatGTEx
SMART	S_TKc	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF56112	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I6GJE5	ENTREZGENE, UniProtKB/TrEMBL
	A0A8L2UHZ3	ENTREZGENE, UniProtKB/TrEMBL
	A6HBX5	ENTREZGENE, UniProtKB/TrEMBL
	CDKL1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-01-13	Cdkl1	cyclin dependent kinase like 1	Cdkl1	cyclin-dependent kinase-like 1 (CDC2-related kinase)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Cdkl1	cyclin-dependent kinase-like 1 (CDC2-related kinase)	Cdkl1_predicted	cyclin-dependent kinase-like 1 (CDC2-related kinase) (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Cdkl1_predicted	cyclin-dependent kinase-like 1 (CDC2-related kinase) (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar