Advanced Search (OLGA)

Gene: Cop1 (COP1, E3 ubiquitin ligase) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Cop1

Name:

COP1, E3 ubiquitin ligase

RGD ID:

1304773

Description:

Predicted to enable ubiquitin protein ligase activity. Predicted to be involved in positive regulation of proteasomal ubiquitin-dependent protein catabolic process; proteasome-mediated ubiquitin-dependent protein catabolic process; and response to ionizing radiation. Located in Golgi membrane. Orthologous to human COP1 (COP1 E3 ubiquitin ligase); PARTICIPATES IN p53 signaling pathway; ubiquitin/proteasome degradation pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; amphetamine; bisphenol A.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

E3 ubiquitin-protein ligase COP1; E3 ubiquitin-protein ligase RFWD2; LOC100360800; LOC360860; MGC109175; Rfwd2; RGD1304773; ring finger and WD repeat domain 2; ring finger and WD repeat domain 2, E3 ubiquitin protein ligase; similar to constitutive photomorphogenic protein 1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	COP1 (COP1 E3 ubiquitin ligase)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB
Mus musculus (house mouse):	Cop1 (COP1, E3 ubiquitin ligase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Cop1 (COP1 E3 ubiquitin ligase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	COP1 (COP1 E3 ubiquitin ligase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	COP1 (COP1 E3 ubiquitin ligase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Cop1 (COP1 E3 ubiquitin ligase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	COP1 (COP1 E3 ubiquitin ligase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	COP1 (COP1 E3 ubiquitin ligase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Cop1 (COP1 E3 ubiquitin ligase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	ARL8A (ARF like GTPase 8A)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	COP1 (COP1 E3 ubiquitin ligase)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Cop1 (COP1, E3 ubiquitin ligase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	cop1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	cop1	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Allele / Splice:

Rfwd2^em1Mcwi

Genetic Models:

SS-Rfwd2^em1Mcwi

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	73,954,058 - 74,095,283 (+)	NCBI		GRCr8
mRatBN7.2	13	71,467,164 - 71,561,826 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	71,429,961 - 71,538,890 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	13	74,044,221 - 74,138,940 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	75,344,334 - 75,439,013 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	72,603,700 - 72,698,383 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	76,942,883 - 77,076,015 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	76,942,928 - 77,075,723 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	13	81,853,391 - 81,986,197 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	13	74,552,876 - 74,590,608 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	13	74,979,314 - 74,981,857 (-)	NCBI
Celera	13	71,277,941 - 71,371,841 (+)	NCBI		Celera
Cytogenetic Map	13	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cop1	Rat	1q24 Deletion Syndrome		ISO	COP1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: 1q24q25 microdeletion syndrome	ClinVar	PMID:21548129 more ...
Cop1	Rat	antithrombin III deficiency		ISO	COP1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Hereditary antithrombin deficiency	ClinVar
Cop1	Rat	gastrointestinal stromal tumor		ISO	COP1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Gastrointestinal stromal tumor	ClinVar	PMID:28492532
Cop1	Rat	parathyroid carcinoma		ISO	COP1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Parathyroid carcinoma	ClinVar	PMID:28492532

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cop1	Rat	autistic disorder		ISO	COP1 (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:19404257

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cop1	Rat	(-)-epigallocatechin 3-gallate	multiple interactions	ISO	COP1 (Homo sapiens)	6480464	[potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of COP1 mRNA	CTD	PMID:22079256
Cop1	Rat	1,2-dimethylhydrazine	decreases expression	ISO	Cop1 (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in decreased expression of RFWD2 mRNA	CTD	PMID:22206623
Cop1	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Cop1 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of COP1 mRNA	CTD	PMID:21570461 and PMID:24680724
Cop1	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of COP1 mRNA	CTD	PMID:34747641
Cop1	Rat	all-trans-retinoic acid	increases expression	ISO	COP1 (Homo sapiens)	6480464	Tretinoin results in increased expression of RFWD2 mRNA	CTD	PMID:33167477
Cop1	Rat	amphetamine	increases expression	EXP		6480464	Amphetamine results in increased expression of RFWD2 mRNA	CTD	PMID:30779732
Cop1	Rat	aristolochic acid A	decreases expression	ISO	COP1 (Homo sapiens)	6480464	aristolochic acid I results in decreased expression of COP1 mRNA	CTD	PMID:33212167
Cop1	Rat	atrazine	decreases expression	ISO	COP1 (Homo sapiens)	6480464	Atrazine results in decreased expression of COP1 mRNA	CTD	PMID:22378314
Cop1	Rat	benzo[a]pyrene	decreases expression	ISO	COP1 (Homo sapiens)	6480464	Benzo(a)pyrene results in decreased expression of COP1 mRNA	CTD	PMID:20064835 more ...
Cop1	Rat	benzo[a]pyrene	affects methylation	ISO	COP1 (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of RFWD2 promoter	CTD	PMID:27901495
Cop1	Rat	benzo[a]pyrene	increases expression	ISO	Cop1 (Mus musculus)	6480464	Benzo(a)pyrene results in increased expression of COP1 mRNA	CTD	PMID:22228805
Cop1	Rat	beta-lapachone	increases expression	ISO	COP1 (Homo sapiens)	6480464	beta-lapachone results in increased expression of COP1 mRNA	CTD	PMID:38218311
Cop1	Rat	bis(2-ethylhexyl) phthalate	decreases expression	ISO	Cop1 (Mus musculus)	6480464	Diethylhexyl Phthalate results in decreased expression of COP1 mRNA	CTD	PMID:33754040
Cop1	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of COP1 mRNA	CTD	PMID:25181051
Cop1	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of COP1 mRNA	CTD	PMID:34947998
Cop1	Rat	cadmium atom	multiple interactions	ISO	COP1 (Homo sapiens)	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of COP1 mRNA	CTD	PMID:35301059
Cop1	Rat	cadmium dichloride	decreases expression	ISO	COP1 (Homo sapiens)	6480464	Cadmium Chloride results in decreased expression of COP1 mRNA	CTD	PMID:38568856
Cop1	Rat	cadmium dichloride	multiple interactions	ISO	COP1 (Homo sapiens)	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of COP1 mRNA	CTD	PMID:35301059
Cop1	Rat	carbon nanotube	decreases expression	ISO	Cop1 (Mus musculus)	6480464	Nanotubes and Carbon analog results in decreased expression of COP1 mRNA	CTD	PMID:25554681
Cop1	Rat	CGP 52608	multiple interactions	ISO	COP1 (Homo sapiens)	6480464	CGP 52608 promotes the reaction [RORA protein binds to COP1 gene] and CGP 52608 promotes the reaction [RORA protein binds to RFWD2 gene]	CTD	PMID:28238834
Cop1	Rat	chlordecone	multiple interactions	ISO	Cop1 (Mus musculus)	6480464	Chlordecone promotes the reaction [Biomarkers metabolite binds to RFWD2 gene]	CTD	PMID:31084621
Cop1	Rat	chlorpyrifos	decreases expression	ISO	Cop1 (Mus musculus)	6480464	Chlorpyrifos results in decreased expression of COP1 mRNA	CTD	PMID:37019170
Cop1	Rat	cisplatin	increases expression	ISO	Cop1 (Mus musculus)	6480464	Cisplatin results in increased expression of COP1 mRNA	CTD	PMID:21151649
Cop1	Rat	copper atom	multiple interactions	ISO	COP1 (Homo sapiens)	6480464	[Chelating Agents binds to Copper] which results in increased expression of RFWD2 mRNA	CTD	PMID:30911355
Cop1	Rat	copper(0)	multiple interactions	ISO	COP1 (Homo sapiens)	6480464	[Chelating Agents binds to Copper] which results in increased expression of RFWD2 mRNA	CTD	PMID:30911355
Cop1	Rat	crocidolite asbestos	decreases expression	ISO	Cop1 (Mus musculus)	6480464	Asbestos and Crocidolite results in decreased expression of COP1 mRNA	CTD	PMID:29279043
Cop1	Rat	ethanol	affects splicing	ISO	Cop1 (Mus musculus)	6480464	Ethanol affects the splicing of RFWD2 mRNA	CTD	PMID:30319688
Cop1	Rat	fenvalerate	increases expression	EXP		6480464	fenvalerate results in increased expression of COP1 mRNA	CTD	PMID:30307764
Cop1	Rat	ketoconazole	decreases expression	ISO	COP1 (Homo sapiens)	6480464	Ketoconazole results in decreased expression of COP1 mRNA	CTD	PMID:36621641
Cop1	Rat	paracetamol	decreases expression	ISO	COP1 (Homo sapiens)	6480464	Acetaminophen results in decreased expression of COP1 mRNA	CTD	PMID:21420995
Cop1	Rat	potassium chromate	multiple interactions	ISO	COP1 (Homo sapiens)	6480464	[potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of COP1 mRNA	CTD	PMID:22079256
Cop1	Rat	potassium chromate	decreases expression	ISO	COP1 (Homo sapiens)	6480464	potassium chromate(VI) results in decreased expression of COP1 mRNA	CTD	PMID:22079256
Cop1	Rat	sodium arsenite	increases expression	ISO	COP1 (Homo sapiens)	6480464	sodium arsenite results in increased expression of COP1 mRNA	CTD	PMID:38568856
Cop1	Rat	sunitinib	increases expression	ISO	COP1 (Homo sapiens)	6480464	Sunitinib results in increased expression of COP1 mRNA	CTD	PMID:31533062
Cop1	Rat	titanium dioxide	decreases methylation	ISO	Cop1 (Mus musculus)	6480464	titanium dioxide results in decreased methylation of RFWD2 promoter	CTD	PMID:35295148
Cop1	Rat	trichloroethene	increases expression	ISO	Cop1 (Mus musculus)	6480464	Trichloroethylene results in increased expression of COP1 mRNA	CTD	PMID:19448997
Cop1	Rat	triphenyl phosphate	affects expression	ISO	COP1 (Homo sapiens)	6480464	triphenyl phosphate affects the expression of COP1 mRNA	CTD	PMID:37042841
Cop1	Rat	tunicamycin	increases expression	ISO	Cop1 (Mus musculus)	6480464	Tunicamycin results in increased expression of COP1 mRNA	CTD	PMID:17127020
Cop1	Rat	valproic acid	decreases methylation	ISO	COP1 (Homo sapiens)	6480464	Valproic Acid results in decreased methylation of COP1 gene	CTD	PMID:29154799

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cop1	Rat	positive regulation of proteasomal ubiquitin-dependent protein catabolic process	involved_in	ISO	COP1 (Homo sapiens)	1624291	PMID:19805145	RGD	PMID:19805145
Cop1	Rat	proteasome-mediated ubiquitin-dependent protein catabolic process	involved_in	ISO	COP1 (Homo sapiens)	1624291	PMID:14739464	RGD	PMID:14739464
Cop1	Rat	proteasome-mediated ubiquitin-dependent protein catabolic process	involved_in	IBA	PANTHER:PTN002542978 and UniProtKB:Q8NHY2	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Cop1	Rat	response to ionizing radiation	involved_in	ISO	COP1 (Homo sapiens)	1624291	PMID:19805145	RGD	PMID:19805145

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cop1	Rat	Cul4A-RING E3 ubiquitin ligase complex	part_of	ISO	COP1 (Homo sapiens)	1624291	PMID:14739464	RGD	PMID:14739464
Cop1	Rat	Golgi membrane		IDA		2306211		RGD

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cop1	Rat	protein binding	enables	ISO	COP1 (Homo sapiens)	1624291	UniProtKB:P14921-1 more ...	RGD	PMID:14739464 more ...
Cop1	Rat	protein binding	enables	ISO	Cop1 (Mus musculus)	1624291	UniProtKB:Q3U182 more ...	RGD	PMID:16794074 and PMID:17805301
Cop1	Rat	protein binding	enables	ISO	COP1 (Homo sapiens) and UniProtKB:Q8NHY2-1	1624291	UniProtKB:P50549-1 and PMID:21572435	RGD	PMID:21572435
Cop1	Rat	ubiquitin protein ligase activity	enables	ISO	COP1 (Homo sapiens)	1624291	PMID:19805145	RGD	PMID:19805145
Cop1	Rat	ubiquitin protein ligase activity	enables	IBA	PANTHER:PTN002542978 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Cop1	Rat	zinc ion binding	enables	IEA	UniProtKB-KW:KW-0863	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Imported Annotations - KEGG (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cop1	Rat	p53 signaling pathway		IEA		6907045		KEGG	rno:04115
Cop1	Rat	ubiquitin/proteasome degradation pathway		IEA		6907045		KEGG	rno:04120

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cop1	Rat	abnormal circadian regulation of systemic arterial blood pressure		IMP		12792227		RGD
Cop1	Rat	salt-sensitive hypertension		IMP		12792227		RGD

#	Reference Title	Reference Citation
1.	Cytosol-derived proteins are sufficient for Arp2/3 recruitment and ARF/coatomer-dependent actin polymerization on Golgi membranes.	Chen JL, etal., FEBS Lett. 2004 May 21;566(1-3):281-6.
2.	Characterization of biological pathways associated with a 1.37 Mbp genomic region protective of hypertension in Dahl S rats.	Cowley AW, etal., Physiol Genomics. 2014 Jun 1;46(11):398-410. doi: 10.1152/physiolgenomics.00179.2013. Epub 2014 Apr 8.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
5.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:12477932	PMID:14739464	PMID:18815134	PMID:19805145	PMID:27658392	PMID:38909848

Cop1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	73,954,058 - 74,095,283 (+)	NCBI		GRCr8
mRatBN7.2	13	71,467,164 - 71,561,826 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	71,429,961 - 71,538,890 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	13	74,044,221 - 74,138,940 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	75,344,334 - 75,439,013 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	72,603,700 - 72,698,383 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	76,942,883 - 77,076,015 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	76,942,928 - 77,075,723 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	13	81,853,391 - 81,986,197 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	13	74,552,876 - 74,590,608 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	13	74,979,314 - 74,981,857 (-)	NCBI
Celera	13	71,277,941 - 71,371,841 (+)	NCBI		Celera
Cytogenetic Map	13	q22	NCBI

COP1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	175,944,831 - 176,207,286 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	175,944,831 - 176,207,286 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	175,913,967 - 176,176,422 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	174,180,590 - 174,442,993 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	172,645,624 - 172,908,027	NCBI
Celera	1	149,024,694 - 149,287,018 (-)	NCBI		Celera
Cytogenetic Map	1	q25.1-q25.2	NCBI
HuRef	1	147,140,664 - 147,403,100 (-)	NCBI		HuRef
CHM1_1	1	177,337,538 - 177,600,480 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	175,300,159 - 175,562,553 (-)	NCBI		T2T-CHM13v2.0

Cop1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	159,059,734 - 159,182,442 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	159,059,890 - 159,175,210 (+)	Ensembl		GRCm39 Ensembl
GRCm38	1	159,232,156 - 159,354,872 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	159,232,320 - 159,347,640 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	1	161,162,457 - 161,277,711 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	1	161,069,003 - 161,184,257 (+)	NCBI		MGSCv36	mm8
Celera	1	161,631,243 - 161,748,921 (+)	NCBI		Celera
Cytogenetic Map	1	H1	NCBI
cM Map	1	69.03	NCBI

Cop1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955406	15,662,546 - 15,859,306 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955406	15,662,546 - 15,859,306 (-)	NCBI	ChiLan1.0	ChiLan1.0

COP1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	73,506,205 - 73,784,010 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	73,186,486 - 73,457,341 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	151,459,354 - 151,727,131 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	155,155,860 - 155,425,664 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	155,156,185 - 155,425,156 (-)	Ensembl	panpan1.1		panPan2

COP1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	7	23,320,483 - 23,565,093 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	7	23,277,209 - 23,563,397 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	7	22,845,782 - 23,088,376 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	7	23,068,997 - 23,312,240 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	7	23,069,323 - 23,326,866 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	7	22,980,843 - 23,224,152 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	7	23,074,250 - 23,317,391 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	7	23,217,346 - 23,460,833 (+)	NCBI		UU_Cfam_GSD_1.0

Cop1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	94,415,666 - 94,590,738 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936481	12,262,409 - 12,437,571 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936481	12,262,415 - 12,437,627 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

COP1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	9	117,915,443 - 118,114,259 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	9	117,913,504 - 118,114,268 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	9	129,664,173 - 129,764,054 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

COP1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	25	53,057,479 - 53,316,662 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	25	53,057,784 - 53,314,398 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666055	54,611,740 - 54,870,873 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cop1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624771	5,922,067 - 6,133,597 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624771	5,922,086 - 6,132,537 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Cop1
863 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	317
Count of miRNA genes:	203
Interacting mature miRNAs:	228
Transcripts:	ENSRNOT00000040505
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1298066	Bp159	Blood pressure QTL 159		0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	46088046	91088046	Rat
10755495	Bp387	Blood pressure QTL 387	3.78		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	34663461	87525369	Rat
1354655	Bp241	Blood pressure QTL 241	3.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	56056920	101056920	Rat
8655951	Rf63	Renal function QTL 63	12.2		blood urea nitrogen amount (VT:0005265)	plasma urea nitrogen level (CMO:0000586)	13	69060519	77046890	Rat
70220	Bp55	Blood pressure QTL 55	5.75		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	13	37374509	82374509	Rat
8655945	Rf61	Renal function QTL 61	3.6		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	13	69060519	86800898	Rat
71119	Thym2	Thymus enlargement QTL 2	3.8		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	13	46197976	84753113	Rat
4889861	Pur29	Proteinuria QTL 29	13.8	0.005	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	13	37415584	80753406	Rat
1331783	Bp221	Blood pressure QTL 221	3.72886		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	69060519	86800898	Rat
12879441	Bp396	Blood pressure QTL 396			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	45699983	90699983	Rat
2293687	Bss26	Bone structure and strength QTL 26	4.6	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	13	65103704	106807694	Rat
1300166	Kidm6	Kidney mass QTL 6	3.93		kidney mass (VT:0002707)	single kidney wet weight to body weight ratio (CMO:0000622)	13	69060519	86800898	Rat
619615	Bp80	Blood pressure QTL 80		0.0354	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	39754544	84754544	Rat
2303028	Bp329	Blood pressure QTL 329			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	58497872	73485113	Rat
1581570	Eae17	Experimental allergic encephalomyelitis QTL 17	4.1		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	13	8897350	101631289	Rat
61340	Bp25	Blood pressure QTL 25	4.2	0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	34535218	79535218	Rat
1581573	Uae36	Urinary albumin excretion QTL 36			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	5994833	77046787	Rat
1549897	Stresp12	Stress response QTL 12	3.35		stress-related behavior trait (VT:0010451)	number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960)	13	38433408	83433408	Rat
724564	Uae11	Urinary albumin excretion QTL 11	5.7		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	13	59492522	77046890	Rat
7207885	Glom27	Glomerulus QTL 27	3.9		kidney glomerulus integrity trait (VT:0010546)	kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139)	13	20605871	101339738	Rat
7387280	Uae43	Urinary albumin excretion QTL 43	5.69	0.4174	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	66451204	106807694	Rat
738026	Lnnr5	Liver neoplastic nodule remodeling QTL 5	3.29		liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number (CMO:0001461)	13	59874408	85581182	Rat
70181	BpQTLcluster11	Blood pressure QTL cluster 11	6.922		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	13	31241331	93395974	Rat
2293702	Bss34	Bone structure and strength QTL 34	4.61	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	13	65103704	106807694	Rat
61349	Bp31	Blood pressure QTL 31	5.75		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	13	37374509	82374509	Rat
2303563	Bw89	Body weight QTL 89	6		body mass (VT:0001259)	body weight (CMO:0000012)	13	32284471	77284471	Rat
1354621	Rf47	Renal function QTL 47	3.7		kidney renin amount (VT:0010559)	kidney renin level (CMO:0002166)	13	30395351	101056920	Rat
1581554	Pur11	Proteinuria QTL 11			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	5994833	77046787	Rat
12879477	Bp401	Blood pressure QTL 401			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	37262092	82262092	Rat
1331750	Bp220	Blood pressure QTL 220	2.98		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	13	37415584	82415584	Rat
1641901	Alcrsp6	Alcohol response QTL 6			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	13	52362171	97362171	Rat
12879475	Bp400	Blood pressure QTL 400			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	61825626	106807694	Rat
1354666	Bp244	Blood pressure QTL 244	4.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	1	101056920	Rat

D13Rat42

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	13	71,437,071 - 71,437,240 (+)	MAPPER	mRatBN7.2
Rnor_6.0	13	76,950,525 - 76,950,693	NCBI	Rnor6.0
Rnor_5.0	13	81,860,983 - 81,861,151	UniSTS	Rnor5.0
RGSC_v3.4	13	74,560,206 - 74,560,623	RGD	RGSC3.4
RGSC_v3.4	13	74,560,243 - 74,560,411	UniSTS	RGSC3.4
RGSC_v3.1	13	74,574,431 - 74,574,599	RGD
Celera	13	71,247,857 - 71,248,025	UniSTS
RH 3.4 Map	13	448.0	RGD
RH 3.4 Map	13	448.0	UniSTS
RH 2.0 Map	13	539.4	RGD
FHH x ACI Map	13	30.36	RGD
Cytogenetic Map	13	q22	UniSTS

RH142379

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	13	71,561,260 - 71,561,427 (+)	MAPPER	mRatBN7.2
Rnor_6.0	13	77,075,152 - 77,075,318	NCBI	Rnor6.0
Rnor_5.0	13	81,985,632 - 81,985,798	UniSTS	Rnor5.0
RGSC_v3.4	13	74,965,519 - 74,965,685	UniSTS	RGSC3.4
Celera	13	71,371,276 - 71,371,442	UniSTS
Cytogenetic Map	13	q22	UniSTS

RH134650

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	13	71,561,521 - 71,561,733 (+)	MAPPER	mRatBN7.2
Rnor_6.0	13	77,075,413 - 77,075,624	NCBI	Rnor6.0
Rnor_5.0	13	81,985,893 - 81,986,104	UniSTS	Rnor5.0
RGSC_v3.4	13	74,965,213 - 74,965,424	UniSTS	RGSC3.4
Celera	13	71,371,537 - 71,371,748	UniSTS
Cytogenetic Map	13	q22	UniSTS

This gene Cop1 is modified in the following models/strains:

SS-Rfwd2^em1Mcwi

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001025126	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001428839	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001428840	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001428841	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006250113	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006250114	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063272480	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063272481	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063272482	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063272483	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063272484	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC091284	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473958	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000013	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000040505 ⟹ ENSRNOP00000048511

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	13	71,429,961 - 71,538,890 (+)	Ensembl
Rnor_6.0 Ensembl	13	76,942,928 - 77,075,723 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000076581 ⟹ ENSRNOP00000068073

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	13	76,962,504 - 77,075,685 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000076851

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	13	76,980,611 - 77,075,723 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000076892

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	13	76,994,533 - 77,004,167 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000076908 ⟹ ENSRNOP00000068019

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	13	76,943,633 - 76,979,449 (+)	Ensembl

RefSeq Acc Id:

NM_001025126 ⟹ NP_001020297

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	74,000,599 - 74,095,277 (+)	NCBI
mRatBN7.2	13	71,467,164 - 71,561,826 (+)	NCBI
Rnor_6.0	13	76,980,611 - 77,075,717 (+)	NCBI
Rnor_5.0	13	81,853,391 - 81,986,197 (+)	NCBI
Celera	13	71,277,941 - 71,371,841 (+)	RGD

Sequence:

show sequence

TTTTTGATTTCAGATTAACTTTACTTTTGTACTCTATGAAAGGTATTTTTGAGAAGTTTGAAGACAAAAGGGGACTAATAAAAAGCTGAGGCTAGAACAGACTATAATGCTGTACGCTTGCTTGATTT
ATACATCCTCTGTTTGGACTGTGTAGAGTAACTCATATACTTACAATTTCAGGAGATGAGTGGCTTGTACTCCCCCGTCAGTGAAGATAGCACGGTGCCTCAATTTGAAGCTCCTTCTCCATCGCACA
GTAGCATTATTGACTCTACAGAATACAGCCAACCTCCAGGCTTCAGTGGGCCGTCTCAGACAAAGAAACAGCCTTGGTATAACAGCACATTAGCATCAAGACGAAAGCGACTCACTGCTCATTTTGAA
GACTTAGAGCAGTGTTATTTTTCTACAAGGATGTCTCGTATCTCAGATGACAGTAGAACTGCAAGCCAGTTAGATGAATTTCAAGAATGCTTGTCCAAATTTACTCGATATAACTCTGTAAGACCGTT
GGCCACATTGTCTTATGCTAGTGATCTGTATAATGGTTCCAGCATAGTTTCTAGTATTGAATTTGACCGGGATTGTGACTACTTTGCAATTGCTGGAGTTACAAAGAAGATTAAAGTCTATGAATATG
GCACAGTCATCCAGGATGCAGTGGATATTCATTACCCTGAGAATGAAATGACCTGCAATTCCAAAATCAGCTGTATCAGTTGGAGTAGTTACCATAAGAACCTGCTAGCCAGCAGTGATTATGAAGGC
ACCGTTATACTATGGGATGGATTCACAGGACAGAGGTCAAAGGTCTATCAGGAGCATGAAAAGAGGTGTTGGAGTGTCGACTTTAATTTGATGGATCCCAAACTTCTGGCTTCAGGTTCTGATGATGC
AAAAGTGAAGCTTTGGTCCACCAATTTAGACAATTCTGTGGCAAGCATCGAGGCAAAAGCTAATGTGTGTTGTGTGAAGTTCAGCCCCTCCTCCAGGTACCATCTGGCTTTTGGCTGTGCAGATCACT
GTGTCCACTACTACGATCTTCGTAACACTAAACAGCCAATAATGGTGTTCAAGGGGCACCGAAAAGCAGTGTCTTATGCCAAGTTTGTGAGTGGTGAAGAAATTGTCTCTGCCTCAACAGACAGCCAA
CTAAAACTGTGGAATGTGGGGAAACCATACTGTCTACGTTCCTTCAAGGGTCATATTAATGAAAAAAACTTTGTAGGCCTTGCTTCCAATGGAGATTATATAGCTTGTGGAAGTGAGAACAACTCCCT
CTACCTGTACTATAAAGGACTTTCTAAGACTTTGCTAACTTTTAAGTTTGATACAGTTAAGAGTGTATTAGATAAAGACCGGAAAGAAGATGACACCAATGAATTTGTCAGTGCTGTGTGTTGGCGGG
CACTATCAGATGGGGAGTCCAATGTGCTGATTGCTGCTAACAGCCAGGGTACAATTAAGGTGCTAGAATTGGTATAAAGAATTTCCTGAAGTCAAATTGTGTTTGATCCCCCCAAAAGCCGTCTGCAG
CTGATGATGAGAAGAGAAAGAAATGGCATGTGATGTCTCTCCCAACGTCGTTTGGATGTGTTCTGAGTACCTTTTCCCTCCTTTTTGCCTTTGGGACATTGGGAATATCCAGAGAATTCTCCGCCGTC
AGTGTAACTATGAACTTTGCTGTTGGCAGTGTGGCTATCTAATTTTTGTGATAGGGAAACAAATTCTTTTAAATAAAAATAAATAACAAAAAAAAAAAGTTTATCGAGCCACAGCTGAGCTGGAAACA
CCTTTGTCAGGTGGAGTGAGAGTCTTTCGAAGAAGTAGCACTTGTGGGCTGTACAGAATGTTCTGGCTGGGGCTGGAAAGAGGCTCGGTGAATAAGAGCACTGGCTGCTCCTACAGAGGATCTGGGTT
CAGTCCCCAGAGTCCCCAGCACCTACGTAGCAGCTCACTGCCACTTATGATTCCAGTAGATCTGACCTCCTCTTCTGGCCTCCTTGAGCACCAGGTATGCATGTGGTGCACATACAAACATCCGGACA
AAACGCTCACACATAAAAATGAAAATAAATCTTATTTTAAAACAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_063272480 ⟹ XP_063128550

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	73,954,058 - 74,095,283 (+)	NCBI

RefSeq Acc Id:

XM_063272481 ⟹ XP_063128551

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	73,954,058 - 74,095,283 (+)	NCBI

RefSeq Acc Id:

XM_063272482 ⟹ XP_063128552

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	73,954,058 - 74,095,283 (+)	NCBI

RefSeq Acc Id:

XM_063272483 ⟹ XP_063128553

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	73,954,058 - 74,095,283 (+)	NCBI

RefSeq Acc Id:

XM_063272484 ⟹ XP_063128554

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	73,991,323 - 74,095,283 (+)	NCBI


Protein RefSeqs	NP_001020297	(Get FASTA)	NCBI Sequence Viewer
	NP_001415768	(Get FASTA)	NCBI Sequence Viewer
	NP_001415769	(Get FASTA)	NCBI Sequence Viewer
	NP_001415770	(Get FASTA)	NCBI Sequence Viewer
	XP_063128550	(Get FASTA)	NCBI Sequence Viewer
	XP_063128551	(Get FASTA)	NCBI Sequence Viewer
	XP_063128552	(Get FASTA)	NCBI Sequence Viewer
	XP_063128553	(Get FASTA)	NCBI Sequence Viewer
	XP_063128554	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH91284	(Get FASTA)	NCBI Sequence Viewer
	EDM09450	(Get FASTA)	NCBI Sequence Viewer
	EDM09451	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000048511.6

RefSeq Acc Id:

NP_001020297 ⟸ NM_001025126

- Sequence:

show sequence

MSGLYSPVSEDSTVPQFEAPSPSHSSIIDSTEYSQPPGFSGPSQTKKQPWYNSTLASRRKRLTAHFEDLEQCYFSTRMSRISDDSRTASQLDEFQECLSKFTRYNSVRPLATLSYASDLYNGSSIVSS
IEFDRDCDYFAIAGVTKKIKVYEYGTVIQDAVDIHYPENEMTCNSKISCISWSSYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHEKRCWSVDFNLMDPKLLASGSDDAKVKLWSTNLDNSVASIEA
KANVCCVKFSPSSRYHLAFGCADHCVHYYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPYCLRSFKGHINEKNFVGLASNGDYIACGSENNSLYLYYKGLSKTLLTFKFDT
VKSVLDKDRKEDDTNEFVSAVCWRALSDGESNVLIAANSQGTIKVLELV

hide sequence

Ensembl Acc Id:

ENSRNOP00000068019 ⟸ ENSRNOT00000076908

Ensembl Acc Id:

ENSRNOP00000068073 ⟸ ENSRNOT00000076581

Ensembl Acc Id:

ENSRNOP00000048511 ⟸ ENSRNOT00000040505

RefSeq Acc Id:	XP_063128550 ⟸ XM_063272480
- Peptide Label:	isoform X1

Protein Domains

RING-type

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-A0A096UWG1-F1-model_v2	AlphaFold	A0A096UWG1	1-733	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13698923

Promoter ID:

EPDNEW_R9448

Type:

initiation region

Name:

Rfwd2_1

Description:

ring finger and WD repeat domain 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	13	76,943,284 - 76,943,344	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-17773	BioCyc
Ensembl Genes	ENSRNOG00000042492	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000040505.7	UniProtKB/TrEMBL
Gene3D-CATH	2.130.10.10	UniProtKB/TrEMBL
	3.30.40.10	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7304516	IMAGE-MGC_LOAD
InterPro	COP1	UniProtKB/TrEMBL
	G-protein_beta_WD-40_rep	UniProtKB/TrEMBL
	WD40/YVTN_repeat-like_dom	UniProtKB/TrEMBL
	WD40_repeat	UniProtKB/TrEMBL
	WD40_repeat_CS	UniProtKB/TrEMBL
	WD40_repeat_dom_sf	UniProtKB/TrEMBL
	Znf_RING	UniProtKB/TrEMBL
	Znf_RING/FYVE/PHD	UniProtKB/TrEMBL
	Znf_RING_CS	UniProtKB/TrEMBL
KEGG Report	rno:360860	UniProtKB/TrEMBL
MGC_CLONE	MGC:109175	IMAGE-MGC_LOAD
NCBI Gene	360860	ENTREZGENE
PANTHER	E3 UBIQUITIN-PROTEIN LIGASE COP1	UniProtKB/TrEMBL
	PTHR44080	UniProtKB/TrEMBL
Pfam	WD40	UniProtKB/TrEMBL
	zf-C3HC4_2	UniProtKB/TrEMBL
PhenoGen	Cop1	PhenoGen
PRINTS	GPROTEINBRPT	UniProtKB/TrEMBL
PROSITE	WD_REPEATS_1	UniProtKB/TrEMBL
	WD_REPEATS_2	UniProtKB/TrEMBL
	ZF_RING_1	UniProtKB/TrEMBL
	ZF_RING_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000042492	RatGTEx
SMART	RING	UniProtKB/TrEMBL
	WD40	UniProtKB/TrEMBL
Superfamily-SCOP	RING/U-box	UniProtKB/TrEMBL
	WD40_like	UniProtKB/TrEMBL
UniProt	A0A096UWG1	ENTREZGENE, UniProtKB/TrEMBL
	A6ID47	ENTREZGENE, UniProtKB/TrEMBL
	F1LUP6	ENTREZGENE
	Q5BJY0	ENTREZGENE, UniProtKB/TrEMBL
UniProt Secondary	F1LUP6	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-05-12	Rfwd2	ring finger and WD repeat domain 2	Rfwd2	ring finger and WD repeat domain 2, E3 ubiquitin protein ligase	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2013-08-14	Rfwd2	ring finger and WD repeat domain 2, E3 ubiquitin protein ligase	Rfwd2	ring finger and WD repeat domain 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-08-09	Rfwd2	ring finger and WD repeat domain 2	LOC100360800	ring finger and WD repeat domain 2	Data merged from RGD:2321358	737654	APPROVED
2010-05-05	LOC100360800	ring finger and WD repeat domain 2			Symbol and Name status set to provisional	70820	PROVISIONAL
2009-01-22	Rfwd2	ring finger and WD repeat domain 2	RGD1304773	similar to constitutive photomorphogenic protein 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	RGD1304773	similar to constitutive photomorphogenic protein 1	RGD1304773_predicted	similar to constitutive photomorphogenic protein 1 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-20	RGD1304773_predicted	similar to constitutive photomorphogenic protein 1 (predicted)	LOC360860_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC360860_predicted	similar to constitutive photomorphogenic protein 1 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)

Mammalian Phenotype

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)

Mammalian Phenotype