Symbol:
Hey2
Name:
hes related family bHLH transcription factor with YRPW motif 2
RGD ID:
8947327
Description:
ENCODES a protein that exhibits cis-regulatory region sequence-specific DNA binding (ortholog); DNA binding (ortholog); DNA-binding transcription factor activity (ortholog); INVOLVED IN anterior/posterior axis specification (ortholog); aortic valve morphogenesis (ortholog); arterial endothelial cell differentiation (ortholog); PARTICIPATES IN Notch signaling pathway; Notch signaling pathway; ASSOCIATED WITH aortic valve disease (ortholog); Breast Neoplasms (ortholog); Brugada syndrome (ortholog); FOUND IN cytoplasm (ortholog); nucleus (ortholog); transcription repressor complex (ortholog)
Type:
protein-coding
RefSeq Status:
MODEL
Previously known as:
hairy/enhancer-of-split related with YRPW motif 2; hairy/enhancer-of-split related with YRPW motif protein 2; hes-related family bHLH transcription factor with YRPW motif 2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
ChiLan1.0 - Chinchilla ChiLan1.0 Assembly
NCBI Annotation Information:
Annotation category: partial on reference assembly
Position:
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955436 7,060,930 - 7,070,030 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955436 7,060,930 - 7,070,610 (+) NCBI ChiLan1.0 ChiLan1.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Hey2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955436 7,060,930 - 7,070,030 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955436 7,060,930 - 7,070,610 (+) NCBI ChiLan1.0 ChiLan1.0
HEY2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 125,749,632 - 125,761,269 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 125,747,664 - 125,761,269 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 126,070,778 - 126,082,415 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 126,112,425 - 126,124,108 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 6 126,112,565 - 126,124,110 NCBI Celera 6 126,813,087 - 126,824,769 (+) NCBI Celera Cytogenetic Map 6 q22.31 NCBI HuRef 6 123,645,968 - 123,657,653 (+) NCBI HuRef CHM1_1 6 126,334,804 - 126,346,479 (+) NCBI CHM1_1 T2T-CHM13v2.0 6 126,938,147 - 126,949,784 (+) NCBI T2T-CHM13v2.0
Hey2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 10 30,708,355 - 30,718,779 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 10 30,708,355 - 30,718,797 (-) Ensembl GRCm39 Ensembl GRCm38 10 30,832,359 - 30,842,783 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 10 30,832,359 - 30,842,801 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 10 30,552,165 - 30,562,589 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 10 30,521,775 - 30,532,199 (-) NCBI MGSCv36 mm8 Celera 10 31,757,027 - 31,767,443 (-) NCBI Celera Cytogenetic Map 10 A4 NCBI cM Map 10 17.19 NCBI
Hey2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 28,641,100 - 28,651,187 (+) NCBI GRCr8 mRatBN7.2 1 26,822,131 - 26,832,218 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 26,822,131 - 26,832,218 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 26,573,165 - 26,583,262 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 32,572,976 - 32,583,073 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 26,773,752 - 26,783,849 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 29,191,170 - 29,201,257 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 29,191,192 - 29,201,531 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 30,633,675 - 30,643,762 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 27,505,117 - 27,515,204 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 27,516,255 - 27,516,788 (+) NCBI Celera 1 25,500,527 - 25,510,614 (+) NCBI Celera Cytogenetic Map 1 p11 NCBI
HEY2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 5 145,733,083 - 145,744,698 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 6 143,638,233 - 143,649,847 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 6 123,527,180 - 123,538,794 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 6 127,647,547 - 127,659,056 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 6 127,647,547 - 127,659,056 (+) Ensembl panpan1.1 panPan2
HEY2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 1 64,630,656 - 64,646,546 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 1 65,440,361 - 65,450,303 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 1 64,840,402 - 64,850,338 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 1 64,839,247 - 64,850,338 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 1 64,769,017 - 64,778,950 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 1 64,556,353 - 64,566,279 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 1 65,207,272 - 65,217,212 (+) NCBI UU_Cfam_GSD_1.0
Hey2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404946 114,704,470 - 114,715,205 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936639 3,703,447 - 3,716,820 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936639 3,705,225 - 3,714,696 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
HEY2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 37,219,883 - 37,231,385 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 37,219,887 - 37,231,321 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 40,989,466 - 41,000,901 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
HEY2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 13 47,965,808 - 47,977,435 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 13 47,964,847 - 47,977,346 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666040 20,275,597 - 20,288,250 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Hey2
.
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSCLAT00000017360 ⟹ ENSCLAP00000017191
Type:
CODING
Position:
Chinchilla Assembly Chr Position (strand) Source ChiLan1.0 Ensembl NW_004955436 7,060,930 - 7,070,030 (+) Ensembl
RefSeq Acc Id:
XM_013516704 ⟹ XP_013372158
Type:
CODING
Position:
Chinchilla Assembly Chr Position (strand) Source ChiLan1.0 NW_004955436 7,060,930 - 7,070,610 (+) NCBI
Sequence:
AGCGACTGGAATTTAAAGCCTCCTGACACCTCGTCCTGAATCCTGTGCTTGCCTGATCTAGTCCTTCCCACCACCGGAACAGACAACGCCAGCCGGCGGACCTCGTGGGGCGTCCCCAATCGCAGCCC
hide sequence
RefSeq Acc Id:
XP_013372158 ⟸ XM_013516704
- Sequence:
MKRPCEETTSESDMDETIDVGSENNYSGQSASSVTRPNSPTTTSQIMARKKRRGIIEKRRRDRINNSLSELRRLVPTAFEKQGSAKLEKAEILQMTVDHLKMLQATGGKGYFDAHALAMDFMSLGFRE
hide sequence
Ensembl Acc Id:
ENSCLAP00000017191 ⟸ ENSCLAT00000017360
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-08-03
Hey2
hes related family bHLH transcription factor with YRPW motif 2
hes-related family bHLH transcription factor with YRPW motif 2
Symbol and/or name change
5135510 APPROVED
2015-08-25
Hey2
hes-related family bHLH transcription factor with YRPW motif 2
hairy/enhancer-of-split related with YRPW motif 2
Symbol and/or name change
5135510 APPROVED
