Advanced Search (OLGA)

Gene: Myoc (myocilin) Chinchilla lanigera

Subscribe to Updates

Analyze

Symbol:

Myoc

Name:

myocilin

RGD ID:

8776781

Description:

ENCODES a protein that exhibits fibronectin binding (ortholog); frizzled binding (ortholog); myosin light chain binding (ortholog); INVOLVED IN bone development (ortholog); cellular response to nerve growth factor stimulus (ortholog); clustering of voltage-gated sodium channels (ortholog); ASSOCIATED WITH 1q24 Deletion Syndrome (ortholog); autoimmune lymphoproliferative syndrome (ortholog); Brain Injuries (ortholog); FOUND IN collagen-containing extracellular matrix (ortholog); cytoplasmic vesicle (ortholog); endoplasmic reticulum (ortholog)

Type:

protein-coding

RefSeq Status:

MODEL

Previously known as:

myocilin, trabecular meshwork inducible glucocorticoid response

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	MYOC (myocilin)	NCBI	Ortholog
Mus musculus (house mouse):	Myoc (myocilin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus norvegicus (Norway rat):	Myoc (myocilin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	MYOC (myocilin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	MYOC (myocilin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Myoc (myocilin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	MYOC (myocilin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	MYOC (myocilin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Myoc (myocilin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline

Latest Assembly:

ChiLan1.0 - Chinchilla ChiLan1.0 Assembly

Position:

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955406	12,182,046 - 12,199,669 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955406	12,182,115 - 12,194,683 (-)	NCBI	ChiLan1.0	ChiLan1.0

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Myoc	Chinchilla	Brain Injuries		ISO	Myoc (Rattus norvegicus)	9068941	mRNA:increased expression:cerebral cortex (rat)	RGD	PMID:12799138 and REF_RGD_ID:7401267
Myoc	Chinchilla	juvenile glaucoma	susceptibility	ISO	MYOC (Homo sapiens)	9068941	DNA:nonsense mutation more ...	RGD	PMID:17893664 and REF_RGD_ID:7401192
Myoc	Chinchilla	low tension glaucoma	susceptibility	ISO	MYOC (Homo sapiens)	9068941	DNA:Haplotype: :	RGD	PMID:16148883 and REF_RGD_ID:7771548
Myoc	Chinchilla	membranoproliferative glomerulonephritis		ISO	Myoc (Rattus norvegicus)	9068941	protein:increased expression:renal glomerulus (rat)	RGD	PMID:15610237 and REF_RGD_ID:7401266
Myoc	Chinchilla	ocular hypertension		ISO	MYOC (Homo sapiens)	9068941	associated with Glaucoma more ...	RGD	PMID:20107173 and REF_RGD_ID:7394831
Myoc	Chinchilla	ocular hypertension		ISO	Myoc (Rattus norvegicus)	9068941	mRNA:increased expression:retina (rat)	RGD	PMID:17102796 and REF_RGD_ID:1601004
Myoc	Chinchilla	ocular hypertension	treatment	ISO	Myoc (Mus musculus)	9068941		RGD	PMID:23322580 and REF_RGD_ID:7394804
Myoc	Chinchilla	ocular hypertension		ISO	Myoc (Mus musculus)	9068941	mRNA:decreased expression:eye and trabecular mesh (mouse)	RGD	PMID:23322580 and REF_RGD_ID:7394804
Myoc	Chinchilla	primary open angle glaucoma	severity	ISO	MYOC (Homo sapiens)	9068941	DNA:snp:cds:pT377M (human)	RGD	PMID:16431959 and REF_RGD_ID:7401245
Myoc	Chinchilla	primary open angle glaucoma	no_association	ISO	MYOC (Homo sapiens)	9068941	DNA:snp:promoter:g.-1000C>G (human)	RGD	PMID:12215093 and REF_RGD_ID:7401240
Myoc	Chinchilla	primary open angle glaucoma	susceptibility	ISO	MYOC (Homo sapiens)	9068941	DNA:snp:cds:p.G367R (human)	RGD	PMID:21655360 and REF_RGD_ID:7401170
Myoc	Chinchilla	primary open angle glaucoma	susceptibility	ISO	MYOC (Homo sapiens)	9068941	DNA:snps:cds:multiple (human)	RGD	PMID:12189160 and REF_RGD_ID:7401189
Myoc	Chinchilla	primary open angle glaucoma	susceptibility	ISO	MYOC (Homo sapiens)	9068941	DNA:snps more ...	RGD	PMID:22879734 and REF_RGD_ID:7401168
Myoc	Chinchilla	primary open angle glaucoma	severity	ISO	MYOC (Homo sapiens)	9068941	DNA:snp:promoter:g.-1000C>G (human)	RGD	PMID:11595024 and REF_RGD_ID:1600842
Myoc	Chinchilla	primary open angle glaucoma	susceptibility	ISO	MYOC (Homo sapiens)	9068941	DNA:snps:cds:p.G12R more ...	RGD	PMID:19145250 and REF_RGD_ID:7401163

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Myoc	Chinchilla	1q24 Deletion Syndrome		ISO	MYOC (Homo sapiens)	8554872	ClinVar Annotator: match by term: 1q24q25 microdeletion syndrome	ClinVar	PMID:25741868
Myoc	Chinchilla	autoimmune lymphoproliferative syndrome		ISO	MYOC (Homo sapiens)	8554872	ClinVar Annotator: match by term: AUTOIMMUNE LYMPHOPROLIFERATIVE SYNDROME more ...	ClinVar	PMID:22857792 more ...
Myoc	Chinchilla	buphthalmos		ISO	MYOC (Homo sapiens)	8554872	ClinVar Annotator: match by term: GLAUCOMA 3 more ...	ClinVar	PMID:12447164 more ...
Myoc	Chinchilla	gastrointestinal stromal tumor		ISO	MYOC (Homo sapiens)	8554872	ClinVar Annotator: match by term: Gastrointestinal stromal tumor	ClinVar	PMID:28492532
Myoc	Chinchilla	genetic disease		ISO	MYOC (Homo sapiens)	8554872	ClinVar Annotator: match by term: Inborn genetic diseases	ClinVar	PMID:25741868 and PMID:28492532
Myoc	Chinchilla	glaucoma		ISO	MYOC (Homo sapiens)	8554872	ClinVar Annotator: match by term: Glaucoma	ClinVar	PMID:10196380 more ...
Myoc	Chinchilla	Glaucoma 1, Open Angle, E		ISO	MYOC (Homo sapiens)	8554872	ClinVar Annotator: match by term: Glaucoma 1 more ...	ClinVar	PMID:10545602 more ...
Myoc	Chinchilla	juvenile glaucoma		ISO	MYOC (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:10196380 more ...
Myoc	Chinchilla	open-angle glaucoma		ISO	MYOC (Homo sapiens)	8554872	ClinVar Annotator: match by term: Open-angle glaucoma	ClinVar	PMID:10196380 more ...
Myoc	Chinchilla	parathyroid carcinoma		ISO	MYOC (Homo sapiens)	8554872	ClinVar Annotator: match by term: Parathyroid carcinoma	ClinVar	PMID:28492532
Myoc	Chinchilla	primary open angle glaucoma		ISO	MYOC (Homo sapiens)	8554872	ClinVar Annotator: match by term: Primary open angle glaucoma	ClinVar	PMID:10815160 more ...
Myoc	Chinchilla	severe combined immunodeficiency		ISO	MYOC (Homo sapiens)	8554872	ClinVar Annotator: match by term: Severe combined immunodeficiency disease	ClinVar	PMID:10815160 more ...

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Myoc	Chinchilla	congestive heart failure		ISO	MYOC (Homo sapiens)	9068941	CTD Direct Evidence: marker/mechanism	CTD	PMID:36071497
Myoc	Chinchilla	Experimental Liver Cirrhosis		ISO	MYOC (Homo sapiens)	9068941	CTD Direct Evidence: marker/mechanism	CTD	PMID:25380136

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Myoc	Chinchilla	juvenile glaucoma		ISO	MYOC (Homo sapiens)	7240710		OMIM

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Myoc	Chinchilla	bone development	involved_in	ISO	Myoc (Mus musculus)	9068941	PMID:23629661	UniProt	PMID:23629661
Myoc	Chinchilla	cellular response to nerve growth factor stimulus		ISO	Myoc (Rattus norvegicus)	9068941		RGD	PMID:17663725 and REF_RGD_ID:7401258
Myoc	Chinchilla	clustering of voltage-gated sodium channels	involved_in	ISO	Myoc (Mus musculus)	9068941	PMID:23897819	UniProt	PMID:23897819
Myoc	Chinchilla	ERBB2-ERBB3 signaling pathway	involved_in	ISO	Myoc (Mus musculus)	9068941	PMID:23897819	UniProt	PMID:23897819
Myoc	Chinchilla	myelination in peripheral nervous system	involved_in	ISO	Myoc (Mus musculus)	9068941	PMID:23897819	UniProt	PMID:23897819
Myoc	Chinchilla	negative regulation of cell-matrix adhesion	involved_in	ISO	MYOC (Homo sapiens)	9068941	PMID:17984096	UniProt	PMID:17984096
Myoc	Chinchilla	negative regulation of Rho protein signal transduction	involved_in	ISO	MYOC (Homo sapiens)	9068941	PMID:17984096	UniProt	PMID:17984096
Myoc	Chinchilla	negative regulation of stress fiber assembly	involved_in	ISO	MYOC (Homo sapiens)	9068941	PMID:17984096	UniProt	PMID:17984096
Myoc	Chinchilla	nerve development		ISO	Myoc (Rattus norvegicus)	9068941		RGD	PMID:12838505 and REF_RGD_ID:1600847
Myoc	Chinchilla	neuron projection development	involved_in	ISO	MYOC (Homo sapiens)	9068941	PMID:19959812	UniProt	PMID:19959812
Myoc	Chinchilla	non-canonical Wnt signaling pathway	involved_in	ISO	MYOC (Homo sapiens)	9068941	PMID:19188438	UniProt	PMID:19188438
Myoc	Chinchilla	osteoblast differentiation	involved_in	ISO	Myoc (Mus musculus)	9068941	PMID:23629661	UniProt	PMID:23629661
Myoc	Chinchilla	osteoblast differentiation	involved_in	ISO	MYOC (Homo sapiens)	9068941	PMID:23629661	UniProt	PMID:23629661
Myoc	Chinchilla	positive regulation of cell migration	involved_in	ISO	MYOC (Homo sapiens)	9068941	PMID:21656515	UniProt	PMID:21656515
Myoc	Chinchilla	positive regulation of focal adhesion assembly	involved_in	ISO	MYOC (Homo sapiens)	9068941	PMID:18855004	UniProt	PMID:18855004
Myoc	Chinchilla	positive regulation of JNK cascade	involved_in	ISO	MYOC (Homo sapiens)	9068941	PMID:19188438	UniProt	PMID:19188438
Myoc	Chinchilla	positive regulation of mitochondrial depolarization	involved_in	ISO	MYOC (Homo sapiens)	9068941	PMID:17516541	UniProt	PMID:17516541
Myoc	Chinchilla	positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	involved_in	ISO	MYOC (Homo sapiens)	9068941	PMID:21656515	UniProt	PMID:21656515
Myoc	Chinchilla	positive regulation of stress fiber assembly	involved_in	ISO	MYOC (Homo sapiens)	9068941	PMID:19188438	UniProt	PMID:19188438
Myoc	Chinchilla	positive regulation of substrate adhesion-dependent cell spreading	involved_in	ISO	MYOC (Homo sapiens)	9068941	PMID:18855004	UniProt	PMID:18855004
Myoc	Chinchilla	regulation of MAPK cascade	involved_in	ISO	MYOC (Homo sapiens)	9068941	PMID:23629661	UniProt	PMID:23629661
Myoc	Chinchilla	skeletal muscle hypertrophy	involved_in	ISO	Myoc (Mus musculus)	9068941	PMID:22371502	UniProt	PMID:22371502

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Myoc	Chinchilla	collagen-containing extracellular matrix	located_in	ISO	MYOC (Homo sapiens)	9068941	PMID:11773026	UniProt	PMID:11773026
Myoc	Chinchilla	cytoplasmic vesicle	located_in	ISO	MYOC (Homo sapiens)	9068941	PMID:11431441	UniProt	PMID:11431441
Myoc	Chinchilla	endoplasmic reticulum	located_in	ISO	Myoc (Mus musculus)	9068941	PMID:23629661	UniProt	PMID:23629661
Myoc	Chinchilla	extracellular space	located_in	ISO	MYOC (Homo sapiens)	9068941	PMID:17317787	MGI	PMID:17317787
Myoc	Chinchilla	extracellular space	located_in	ISO	Myoc (Mus musculus)	9068941	PMID:12019210 and PMID:16392033	UniProt	PMID:12019210 and PMID:16392033
Myoc	Chinchilla	Golgi apparatus	located_in	ISO	MYOC (Homo sapiens)	9068941	PMID:11053284	UniProt	PMID:11053284
Myoc	Chinchilla	Golgi apparatus	located_in	ISO	Myoc (Mus musculus)	9068941	PMID:23629661	UniProt	PMID:23629661
Myoc	Chinchilla	mesaxon		ISO	Myoc (Rattus norvegicus)	9068941		RGD	PMID:12838505 and REF_RGD_ID:1600847
Myoc	Chinchilla	mitochondrial inner membrane	located_in	ISO	MYOC (Homo sapiens)	9068941	PMID:17516541	UniProt	PMID:17516541
Myoc	Chinchilla	mitochondrial intermembrane space	located_in	ISO	MYOC (Homo sapiens)	9068941	PMID:17516541	UniProt	PMID:17516541
Myoc	Chinchilla	mitochondrial outer membrane	located_in	ISO	MYOC (Homo sapiens)	9068941	PMID:17516541	UniProt	PMID:17516541
Myoc	Chinchilla	myelin sheath abaxonal region		ISO	Myoc (Rattus norvegicus)	9068941		RGD	PMID:12838505 and REF_RGD_ID:1600847
Myoc	Chinchilla	node of Ranvier	located_in	ISO	Myoc (Mus musculus)	9068941	PMID:23897819	UniProt	PMID:23897819
Myoc	Chinchilla	Schmidt-Lanterman incisure		ISO	Myoc (Rattus norvegicus)	9068941		RGD	PMID:12838505 and REF_RGD_ID:1600847

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Myoc	Chinchilla	fibronectin binding	enables	ISO	UniProtKB:P02751	9068941	PMID:11773026	UniProt	PMID:11773026
Myoc	Chinchilla	frizzled binding	enables	ISO	UniProtKB:O75084 more ...	9068941	PMID:19188438	UniProt	PMID:19188438
Myoc	Chinchilla	myosin light chain binding	enables	ISO	UniProtKB:P10916	9068941	PMID:11773029	UniProt	PMID:11773029
Myoc	Chinchilla	protein binding	enables	ISO	UniProtKB:Q61234	9068941	PMID:22371502	UniProt	PMID:22371502
Myoc	Chinchilla	protein binding	enables	ISO	UniProtKB:P97401 and UniProtKB:Q8C4U3	9068941	PMID:19188438	UniProt	PMID:19188438
Myoc	Chinchilla	protein binding	enables	ISO	UniProtKB:P63056	9068941	PMID:12019210	UniProt	PMID:12019210
Myoc	Chinchilla	protein binding	enables	ISO	PR:P63056	9068941	PMID:12019210	MGI	PMID:12019210
Myoc	Chinchilla	protein binding	enables	ISO	UniProtKB:Q9Z0F7	9068941	PMID:16392033	UniProt	PMID:16392033
Myoc	Chinchilla	protein binding	enables	ISO	UniProtKB:Q810U3 more ...	9068941	PMID:23897819	UniProt	PMID:23897819
Myoc	Chinchilla	protein binding	enables	ISO	UniProtKB:P09486 and UniProtKB:Q14515	9068941	PMID:20926826	IntAct	PMID:20926826
Myoc	Chinchilla	protein binding	enables	ISO	UniProtKB:D9ZGF6 and UniProtKB:Q9Y5W5	9068941	PMID:19188438	UniProt	PMID:19188438
Myoc	Chinchilla	protein binding	enables	ISO	UniProtKB:O94856 more ...	9068941	PMID:23897819	UniProt	PMID:23897819
Myoc	Chinchilla	protein binding	enables	ISO	UniProtKB:O43765	9068941	PMID:32296183	IntAct	PMID:32296183
Myoc	Chinchilla	protein binding	enables	ISO	UniProtKB:Q96PB7	9068941	PMID:12019210	UniProt	PMID:12019210
Myoc	Chinchilla	protein binding	enables	ISO	UniProtKB:P10916	9068941	PMID:11773029	IntAct	PMID:11773029
Myoc	Chinchilla	receptor tyrosine kinase binding	enables	ISO	UniProtKB:P70424 and UniProtKB:Q61526	9068941	PMID:23897819	UniProt	PMID:23897819

#	Reference Title	Reference Citation
1.	Transitive Annotation Pipeline	Automated assignment of GO, PW and RDO ISO annotations across species
2.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline

PMID:30032202

Myoc
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955406	12,182,046 - 12,199,669 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955406	12,182,115 - 12,194,683 (-)	NCBI	ChiLan1.0	ChiLan1.0

MYOC
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	171,635,417 - 171,652,688 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	171,635,417 - 171,652,688 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	171,604,557 - 171,621,828 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	169,871,180 - 169,888,396 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	168,336,215 - 168,353,430	NCBI
Celera	1	144,713,951 - 144,731,166 (-)	NCBI		Celera
Cytogenetic Map	1	q24.3	NCBI
HuRef	1	142,827,834 - 142,845,046 (-)	NCBI		HuRef
CHM1_1	1	173,026,640 - 173,043,840 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	170,991,882 - 171,009,153 (-)	NCBI		T2T-CHM13v2.0

Myoc
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	162,466,719 - 162,477,263 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	162,466,724 - 162,477,262 (+)	Ensembl		GRCm39 Ensembl
GRCm38	1	162,639,150 - 162,649,694 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	162,639,155 - 162,649,693 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	1	164,569,281 - 164,579,825 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	1	164,475,844 - 164,486,368 (+)	NCBI		MGSCv36	mm8
Celera	1	165,085,895 - 165,096,434 (+)	NCBI		Celera
Cytogenetic Map	1	H2.1	NCBI
cM Map	1	70.29	NCBI

Myoc
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	77,509,963 - 77,520,361 (+)	NCBI		GRCr8
mRatBN7.2	13	74,976,730 - 74,987,128 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	74,976,730 - 74,987,127 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	13	77,554,373 - 77,564,765 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	78,858,850 - 78,869,297 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	76,118,721 - 76,129,168 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	80,517,531 - 80,527,928 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	80,517,536 - 80,527,928 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	13	85,409,611 - 85,420,008 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	13	78,303,830 - 78,314,228 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	13	78,318,017 - 78,328,415 (+)	NCBI
Celera	13	74,726,592 - 74,736,986 (+)	NCBI		Celera
Cytogenetic Map	13	q22	NCBI

MYOC
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	78,104,233 - 78,121,545 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	77,778,772 - 77,797,111 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	147,128,541 - 147,146,227 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	150,841,630 - 150,858,628 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	150,841,630 - 150,858,628 (-)	Ensembl	panpan1.1		panPan2

MYOC
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	7	27,335,314 - 27,346,821 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	7	27,335,314 - 27,346,820 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	7	26,857,046 - 26,868,545 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	7	27,136,587 - 27,148,065 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	7	27,136,391 - 27,148,079 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	7	26,988,106 - 26,999,596 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	7	27,022,462 - 27,033,986 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	7	27,264,790 - 27,276,291 (+)	NCBI		UU_Cfam_GSD_1.0

Myoc
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	97,697,971 - 97,710,064 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936481	15,544,660 - 15,556,857 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936481	15,544,733 - 15,556,813 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MYOC
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	9	114,087,378 - 114,098,745 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	9	114,087,370 - 114,098,765 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	9	125,551,261 - 125,562,662 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

MYOC
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	25	57,458,615 - 57,475,329 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	25	57,459,374 - 57,475,322 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666055	59,088,230 - 59,104,345 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Myoc
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624771	10,065,788 - 10,080,680 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624771	10,066,170 - 10,080,257 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.


RefSeq Transcripts	XM_005374847	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AGCD01005911	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AGCD01005912	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	GBBH01011840	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSCLAT00000017581 ⟹ ENSCLAP00000017411

Type:

CODING

Position:

Chinchilla Assembly	Chr	Position (strand)	Source
ChiLan1.0 Ensembl	NW_004955406	12,182,046 - 12,199,669 (-)	Ensembl

RefSeq Acc Id:

XM_005374847 ⟹ XP_005374904

Type:

CODING

Position:

Chinchilla Assembly	Chr	Position (strand)	Source
ChiLan1.0	NW_004955406	12,182,115 - 12,194,683 (-)	NCBI

Sequence:

show sequence

CCTCCCTCGGGCTCAGGCAAGAGCCAGGAGGCCCACCCGTCCAGACACCCGTGGGGCAGCAGAGCTTTGCCGAGGAAGCCTCCCTCAGCCTCTGTACTGAGGCTCTTCCTTGTCCTTGCTCCAGCTGC
AGGCCCAAGATGCCAGCTGTCCAGCTGCTGCTGCTGGCCTGCCTGGTGTGGGGAGCAGGGGCCAGGGCAGCCCAGCTCCGCAAGGCCAATGATCGGAGTGGCCGGTGCCAGTACACCTTCAGTGTGGC
CAGCCCCAATGAATCCAGCTGCCCCGAGCAGGGCCAGGCCATGGCGGCCATCCAAGACCTACAGAGAGACAGCAGCACCCAGCATGCAGAGCTGGAGTCCACCAAAGCCCGGCTCAGCTCCCTGGAGA
GCCTCCTCCACCGGCTGAACTTGGACCAGGTTGCTGGGCCCCAGGAGACCCAGGAAGGGCCACAGAGGCAGGTAGATGCCCTGAGGAGGGACCGGGACCGGCTGGAGACCCAAGCCAGGGAGCTGGAG
GTGGCCTATAGCAACCTCCTTCGGGACAAATCAGCACTGGAGGAAGAGAAGAGGCGACTGGGGCAGGAGAACGAGGAGCTGGCCAGGAGGCTGGAAAGCAGCCTCCAGGAGGCGGCGAGGCTGAGACG
GGGCCAGTGCCTCCAGGCCCGGGTCCCCTCTCAGGACATTCTGCCAGGCGCCAGGGAAGTTTCTCAGTGGAATCTGGACAGTTTGGCCTTCCAAGAATTGAAGTCAGAGTTGACTGAAGTTCCTGCTT
CCGGAATCTTGAAGGAGAGCCCGTCTGACCGTCCCAGGACTGAGGAGGGAAACAATGGATGTGGACAACTAGTTTGGGTGGGAGAGCCTGTCACTCTGAGGACTGCTGAGACGATCACTGGCAAGTAT
GGAGTGTGGATGAGGGACCCCAAACCCACGTACCCCTACACCCGGGAGACCACATGGAGAATTGACACGGTTGGCGTAGACATCCGCCAGGTCTTTGAATACAACCGCATCAGCGACTTCGTGCAGGG
CTATCCTTCAAAGGTCCATGTGCTGCCCCGGCCGCTAGAAAGCACAGGCGCCGTGGTGTATGCGGGGAGCCTCTATTTCCAGGGCGCTGAGTCTAGAAGCGTGATCAGGTACGAGCTGAATACTGAGG
CAGTGAAGGCTAAGAAGGAAATCCCTGGAGCTGGCTACCATGGACAGTTCCCATATTCTTGGGGCGGCTACACAGACATTGACTTGGCTGTAGATGAGAGCGGCCTATGGGTCATTTACAGCACCGAA
GAGGCCAAAGGCGCCATTGTCCTCTCCCAGCTGAACCCAGAGAATCTGGAACTTGAACGAACCTGGGAGACTAACATCCGTAAGCAGTCAGTCGCCAACGCCTTTGTCATCTGTGGCACCTTGTACAC
CATCAGCAGCTACTCCTCAAACGACGCCACTGTCAACTTCGCTTATGACACAGCCACAGGGAGCAGCAAGAGCCTGACCATCCCGTTCAAGAACCGCTACAAATACACCAGCATGATTGACTACAACC
CCTCAGAGAGGAAGCTATTTGCCTGGGACAACTTCAACATGGTCACCTACGACATCAAGCTCTCCAAGATGTGAGAAGTTCCAGGCCTCACCAGCACAGGCAAAAGATCATGACATCCAGGGCCCTGA
AGGGGATCAGAGTGAAGGAGAGCCAGCCAGCCAGGCCCACGTTTCTCTCTGCTTTCCAGCTTTCACTAACCTAGGAGACTGTGTGTGCTCACCATCGACCACACAAGGACAGCAGTCTGCAGGCTTAG
ACAGCTTCATGCTATGACAGGTATTCTTTTCTTCTATCAGCTTGGGAAGGACTGTTTATCCAAAAGAGTCGAAGTTTTCTGGCAATTTAGGGAAAGAGATACAAGGCCTAGTAATTTCTTTATGAAAT
CCTTGCTCTTGCAATTTGCATGGTTCCCATAGGCCATGCTCAAAAGCAGCCCTTCTAAAGGAAGAGGGAAAGCCAGGATTGAACGTATATGTAAGGTGTGTTTGATATGATTAGCTGCATGATTCAGA
TACAACTCAGCTGGGCATTATATAACCCGTTGCCCTGTGAAATAAAGGCATCTCACCACA

hide sequence


Protein RefSeqs	XP_005374904	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSCLAP00000017411
	ENSCLAP00000017411.1

RefSeq Acc Id:

XP_005374904 ⟸ XM_005374847

- UniProtKB:

A0A8C2VNS9 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MPAVQLLLLACLVWGAGARAAQLRKANDRSGRCQYTFSVASPNESSCPEQGQAMAAIQDLQRDSSTQHAELESTKARLSSLESLLHRLNLDQVAGPQETQEGPQRQVDALRRDRDRLETQARELEVAY
SNLLRDKSALEEEKRRLGQENEELARRLESSLQEAARLRRGQCLQARVPSQDILPGAREVSQWNLDSLAFQELKSELTEVPASGILKESPSDRPRTEEGNNGCGQLVWVGEPVTLRTAETITGKYGVW
MRDPKPTYPYTRETTWRIDTVGVDIRQVFEYNRISDFVQGYPSKVHVLPRPLESTGAVVYAGSLYFQGAESRSVIRYELNTEAVKAKKEIPGAGYHGQFPYSWGGYTDIDLAVDESGLWVIYSTEEAK
GAIVLSQLNPENLELERTWETNIRKQSVANAFVICGTLYTISSYSSNDATVNFAYDTATGSSKSLTIPFKNRYKYTSMIDYNPSERKLFAWDNFNMVTYDIKLSKM

hide sequence

Ensembl Acc Id:

ENSCLAP00000017411 ⟸ ENSCLAT00000017581

Protein Domains

Olfactomedin-like

Database	Acc Id	Source(s)
Ensembl Genes	ENSCLAG00000011961	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSCLAT00000017581	ENTREZGENE
	ENSCLAT00000017581.1	UniProtKB/TrEMBL
InterPro	Olfac-like_dom	UniProtKB/TrEMBL
	Olfactomedin-like_domain	UniProtKB/TrEMBL
NCBI Gene	Myoc	ENTREZGENE
PANTHER	OLFACTOMEDIN-RELATED	UniProtKB/TrEMBL
	PTHR23192:SF33	UniProtKB/TrEMBL
Pfam	OLF	UniProtKB/TrEMBL
PROSITE	OLF	UniProtKB/TrEMBL
SMART	OLF	UniProtKB/TrEMBL
UniProt	A0A8C2VNS9	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-08-03	Myoc	myocilin		myocilin, trabecular meshwork inducible glucocorticoid response	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM