Symbol:
SHBG
Name:
sex hormone binding globulin
RGD ID:
736172
HGNC Page
HGNC:10839
Description:
Predicted to enable steroid binding activity. Located in extracellular exosome. Implicated in endometrial cancer and type 2 diabetes mellitus. Biomarker of diabetes mellitus.
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
ABP; androgen binding protein; MGC126834; MGC138391; SBP; sex hormone-binding globulin; sex steroid-binding protein; TEBG; testis-specific androgen-binding protein; testosterone-binding beta-globulin; testosterone-estradiol-binding globulin; testosterone-estrogen-binding globulin
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Mus musculus (house mouse):
Shbg (sex hormone binding globulin) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Shbg (sex hormone binding globulin) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Chinchilla lanigera (long-tailed chinchilla):
Shbg (sex hormone binding globulin) NCBI
Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):
SHBG (sex hormone binding globulin) NCBI
Ortholog
Canis lupus familiaris (dog):
SHBG (sex hormone binding globulin) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Shbg (sex hormone binding globulin) NCBI
Ortholog
Sus scrofa (pig):
SHBG (sex hormone binding globulin) HGNC
NCBI
Chlorocebus sabaeus (green monkey):
SHBG (sex hormone binding globulin) NCBI
Ortholog
Heterocephalus glaber (naked mole-rat):
Shbg (sex hormone binding globulin) NCBI
Ortholog
Other homologs 2
Rattus norvegicus (Norway rat):
Siglec8 (sialic acid binding Ig-like lectin 8) HGNC
OMA
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Shbg (sex hormone binding globulin)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Shbg (sex hormone binding globulin)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
shbg (sex hormone-binding globulin)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Allele / Splice:
See ClinVar data
Latest Assembly:
GRCh38 - Human Genome Assembly GRCh38
Position:
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 7,614,064 - 7,633,372 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 7,613,946 - 7,633,382 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 7,517,382 - 7,536,690 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 7,474,216 - 7,477,395 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 17 7,474,215 - 7,477,395 NCBI Celera 17 7,543,810 - 7,563,117 (+) NCBI Celera Cytogenetic Map 17 p13.1 NCBI HuRef 17 7,411,426 - 7,430,707 (+) NCBI HuRef CHM1_1 17 7,526,291 - 7,545,881 (+) NCBI CHM1_1 T2T-CHM13v2.0 17 7,518,285 - 7,537,563 (+) NCBI T2T-CHM13v2.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
SHBG Human (S)-naringenin affects binding EXP 6480464 naringenin binds to SHBG protein CTD PMID:25349334 SHBG Human 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane multiple interactions EXP 6480464 o,p'-DDT inhibits the reaction [Dihydrotestosterone binds to SHBG protein] CTD PMID:9171990 SHBG Human 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane affects binding EXP 6480464 o,p'-DDT binds to SHBG protein CTD PMID:25349334 SHBG Human 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane multiple interactions ISO RGD:3671 6480464 o,p'-DDT inhibits the reaction [Dihydrotestosterone binds to SHBG protein] CTD PMID:9171990 SHBG Human 17alpha-ethynylestradiol multiple interactions EXP 6480464 [Ethinyl Estradiol co-treated with drospirenone] results in increased expression of SHBG protein; [Ethinyl Estradiol co-treated more ... CTD PMID:10899481|PMID:11245553|PMID:12586319|PMID:14981370|PMID:16982228|PMID:17519148 SHBG Human 17alpha-ethynylestradiol affects binding EXP 6480464 Ethinyl Estradiol binds to SHBG protein CTD PMID:25349334 SHBG Human 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of SHBG protein CTD PMID:11907703|PMID:17374706 SHBG Human 17beta-estradiol multiple interactions EXP 6480464 Copper promotes the reaction [Estradiol results in increased expression of SHBG mRNA]; ESR1 protein promotes more ... CTD PMID:16551731|PMID:19685012 SHBG Human 17beta-estradiol decreases expression ISO RGD:11289 6480464 Estradiol results in decreased expression of SHBG mRNA CTD PMID:39298647 SHBG Human 17beta-estradiol affects binding EXP 6480464 Estradiol binds to SHBG protein CTD PMID:25349334 SHBG Human 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of SHBG mRNA; Estradiol results in increased expression of SHBG more ... CTD PMID:16551731|PMID:17484513|PMID:19685012|PMID:21632903 SHBG Human 17beta-hydroxy-5alpha-androstan-3-one multiple interactions EXP 6480464 delta-hexachlorocyclohexane inhibits the reaction [Dihydrotestosterone binds to SHBG protein]; Hexachlorocyclohexane inhibits the reaction [Dihydrotestosterone binds more ... CTD PMID:9171990 SHBG Human 17beta-hydroxy-5alpha-androstan-3-one affects binding EXP 6480464 Dihydrotestosterone binds to SHBG protein CTD PMID:25349334 SHBG Human 17beta-hydroxy-5alpha-androstan-3-one multiple interactions ISO RGD:3671 6480464 Atrazine inhibits the reaction [Dihydrotestosterone binds to SHBG protein]; DDT analog inhibits the reaction [Dihydrotestosterone more ... CTD PMID:9171990 SHBG Human 2,2',4,4'-Tetrabromodiphenyl ether decreases expression EXP 6480464 2,2',4,4'-tetrabromodiphenyl ether results in decreased expression of SHBG protein CTD PMID:31675489 SHBG Human 2,2'-Dihydroxy-4-methoxybenzophenone affects binding EXP 6480464 dioxybenzone binds to SHBG protein CTD PMID:25349334 SHBG Human 2,3,4,5-Tetrachloro-4'-biphenylol affects binding EXP 6480464 4-hydroxy-2',3',4'-5'-tetrachlorobiphenyl binds to SHBG protein CTD PMID:25349334 SHBG Human 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:3671 6480464 Tetrachlorodibenzodioxin results in increased expression of SHBG mRNA CTD PMID:33387578 SHBG Human 2,4,6-tribromophenol increases expression EXP 6480464 2,4,6-tribromophenol results in increased expression of SHBG mRNA CTD PMID:31675489 SHBG Human 2,4,6-trinitrobenzenesulfonic acid increases expression ISO RGD:11289 6480464 Trinitrobenzenesulfonic Acid results in increased expression of SHBG mRNA CTD PMID:17982090 SHBG Human 2,4-diaminotoluene increases expression ISO RGD:3671 6480464 2,4-diaminotoluene results in increased expression of SHBG protein CTD PMID:3199457 SHBG Human 2,4-Dihydroxybenzophenone affects binding EXP 6480464 2,4-dihydroxybenzophenone binds to SHBG protein CTD PMID:25349334 SHBG Human 2-hydroxy-17beta-estradiol increases expression EXP 6480464 2-hydroxyestradiol results in increased expression of SHBG mRNA; 2-hydroxyestradiol results in increased expression of SHBG more ... CTD PMID:21793624 SHBG Human 2-sec-butylphenol affects binding EXP 6480464 2-sec-butylphenol binds to SHBG protein CTD PMID:25349334 SHBG Human 3'-hydroxyflavanone affects binding EXP 6480464 3-hydroxyflavanone binds to SHBG protein CTD PMID:25349334 SHBG Human 3-Deoxyestrone affects binding EXP 6480464 3-deoxyestrone binds to SHBG protein CTD PMID:25349334 SHBG Human 4'-hydroxychalcone affects binding EXP 6480464 4'-hydroxychalcone binds to SHBG protein CTD PMID:25349334 SHBG Human 4'-hydroxyflavanone affects binding EXP 6480464 4'-hydroxyflavanone binds to SHBG protein CTD PMID:25349334 SHBG Human 4,4'-sulfonyldiphenol decreases expression ISO RGD:11289 6480464 bisphenol S results in decreased expression of SHBG mRNA CTD PMID:39298647 SHBG Human 4,4'-sulfonyldiphenol affects methylation ISO RGD:11289 6480464 bisphenol S affects the methylation of SHBG gene CTD PMID:31683443 SHBG Human 4-hydroxy-17beta-estradiol increases expression EXP 6480464 4-hydroxyestradiol results in increased expression of SHBG mRNA; 4-hydroxyestradiol results in increased expression of SHBG more ... CTD PMID:21793624 SHBG Human 4-hydroxychalcone affects binding EXP 6480464 4-hydroxychalcone binds to SHBG protein CTD PMID:25349334 SHBG Human 4-nonylphenol affects binding EXP 6480464 4-nonylphenol binds to SHBG protein CTD PMID:25349334 SHBG Human 4-octylphenol affects binding EXP 6480464 4-octylphenol binds to SHBG protein CTD PMID:25349334 SHBG Human 6-propyl-2-thiouracil affects expression ISO RGD:3671 6480464 Propylthiouracil affects the expression of SHBG mRNA CTD PMID:7819453 SHBG Human 6-propyl-2-thiouracil decreases expression ISO RGD:3671 6480464 Propylthiouracil results in decreased expression of SHBG mRNA CTD PMID:24780913 SHBG Human 7-hydroxyflavanone affects binding EXP 6480464 7-hydroxyflavanone binds to SHBG protein CTD PMID:25349334 SHBG Human acetamide affects expression ISO RGD:3671 6480464 acetamide affects the expression of SHBG mRNA CTD PMID:31881176 SHBG Human afimoxifene affects binding EXP 6480464 afimoxifene binds to SHBG protein CTD PMID:25349334 SHBG Human aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of SHBG mRNA CTD PMID:21632981 SHBG Human aflatoxin B1 decreases expression EXP 6480464 Aflatoxin B1 results in decreased expression of SHBG mRNA CTD PMID:32234424 SHBG Human aflatoxin B1 decreases methylation EXP 6480464 Aflatoxin B1 results in decreased methylation of SHBG gene CTD PMID:27153756 SHBG Human alcohol increases expression EXP 6480464 Alcohols results in increased expression of SHBG protein CTD PMID:8590623 SHBG Human aldehydo-D-glucose multiple interactions EXP 6480464 Cerulenin inhibits the reaction [Glucose results in decreased expression of SHBG protein]; Glucose affects the more ... CTD PMID:17992261 SHBG Human aldehydo-D-glucose decreases expression EXP 6480464 Glucose results in decreased expression of SHBG protein CTD PMID:17992261 SHBG Human all-trans-retinoic acid increases expression ISO RGD:11289 6480464 Tretinoin results in increased expression of SHBG mRNA CTD PMID:36189433 SHBG Human all-trans-retinoic acid multiple interactions ISO RGD:11289 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of SHBG mRNA CTD PMID:36189433 SHBG Human alpha-Zearalanol affects binding EXP 6480464 Zeranol binds to SHBG protein CTD PMID:25349334 SHBG Human ammonium chloride affects expression ISO RGD:3671 6480464 Ammonium Chloride affects the expression of SHBG mRNA CTD PMID:16483693 SHBG Human apigenin affects binding EXP 6480464 Apigenin binds to SHBG protein CTD PMID:25349334 SHBG Human aristolochic acid A increases expression EXP 6480464 aristolochic acid I results in increased expression of SHBG mRNA CTD PMID:33212167 SHBG Human atrazine multiple interactions ISO RGD:3671 6480464 Atrazine inhibits the reaction [Dihydrotestosterone binds to SHBG protein]; Quercetin inhibits the reaction [Atrazine results more ... CTD PMID:22372587|PMID:9171990 SHBG Human atrazine increases expression ISO RGD:3671 6480464 Atrazine results in increased expression of SHBG mRNA CTD PMID:22372587 SHBG Human Aurin affects binding EXP 6480464 aurin binds to SHBG protein CTD PMID:25349334 SHBG Human benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of SHBG mRNA CTD PMID:21632981 SHBG Human benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of SHBG mRNA CTD PMID:32234424 SHBG Human benzo[a]pyrene decreases methylation EXP 6480464 Benzo(a)pyrene results in decreased methylation of SHBG promoter CTD PMID:27901495 SHBG Human Benzyl parahydroxybenzoate affects binding EXP 6480464 benzylparaben binds to SHBG protein CTD PMID:25349334 SHBG Human beta-Zearalanol affects binding EXP 6480464 taleranol binds to SHBG protein CTD PMID:25349334 SHBG Human bifenthrin affects binding EXP 6480464 bifenthrin binds to SHBG protein CTD PMID:32278787 SHBG Human bis(2-ethylhexyl) phthalate decreases expression ISO RGD:11289 6480464 Diethylhexyl Phthalate results in decreased expression of SHBG mRNA CTD PMID:32619501 SHBG Human bis(2-ethylhexyl) phthalate decreases expression ISO RGD:3671 6480464 Diethylhexyl Phthalate results in decreased expression of SHBG mRNA CTD PMID:26316063 SHBG Human bisphenol A affects binding EXP 6480464 bisphenol A binds to SHBG protein CTD PMID:25349334 SHBG Human bisphenol A decreases expression ISO RGD:11289 6480464 bisphenol A results in decreased expression of SHBG mRNA CTD PMID:32156529 SHBG Human bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of SHBG mRNA; bisphenol A results in decreased expression more ... CTD PMID:31675489|PMID:33670352 SHBG Human bisphenol A multiple interactions EXP 6480464 [FLG gene mutant form affects the susceptibility to bisphenol A] which results in increased secretion more ... CTD PMID:30245359 SHBG Human bisphenol A decreases secretion EXP 6480464 bisphenol A results in decreased secretion of SHBG protein CTD PMID:24945889|PMID:30245359 SHBG Human bisphenol A multiple interactions ISO RGD:3671 6480464 [bisphenol A co-treated with tributyltin] results in decreased secretion of SHBG protein CTD PMID:31129395 SHBG Human bisphenol A decreases secretion ISO RGD:3671 6480464 bisphenol A results in decreased secretion of SHBG protein CTD PMID:31129395 SHBG Human bisphenol A decreases expression ISO RGD:3671 6480464 bisphenol A results in decreased expression of SHBG mRNA CTD PMID:30816183|PMID:32528016|PMID:34947998 SHBG Human bisphenol A increases expression ISO RGD:3671 6480464 bisphenol A results in increased expression of SHBG mRNA CTD PMID:25181051 SHBG Human Bisphenol B affects binding EXP 6480464 bisphenol B binds to SHBG protein CTD PMID:25349334 SHBG Human Butylbenzyl phthalate affects binding EXP 6480464 butylbenzyl phthalate binds to SHBG protein CTD PMID:25349334 SHBG Human Butylparaben decreases secretion EXP 6480464 butylparaben results in decreased secretion of SHBG protein CTD PMID:30940137 SHBG Human cadmium atom increases expression ISO RGD:3671 6480464 Cadmium results in increased expression of SHBG protein CTD PMID:23193971 SHBG Human cadmium atom multiple interactions ISO RGD:3671 6480464 Pectins inhibits the reaction [Cadmium results in increased expression of SHBG protein] CTD PMID:23193971 SHBG Human carbamazepine increases expression EXP 6480464 Carbamazepine results in increased expression of SHBG protein CTD PMID:11148232 SHBG Human cerulenin multiple interactions EXP 6480464 Cerulenin inhibits the reaction [Fructose results in decreased expression of SHBG protein]; Cerulenin inhibits the more ... CTD PMID:17992261 SHBG Human chalcone affects binding EXP 6480464 Chalcone binds to SHBG protein CTD PMID:25349334 SHBG Human chromium(6+) decreases expression EXP 6480464 chromium hexavalent ion results in decreased expression of SHBG protein CTD PMID:28596144 SHBG Human chromium(6+) decreases expression ISO RGD:3671 6480464 chromium hexavalent ion results in decreased expression of SHBG mRNA; chromium hexavalent ion results in more ... CTD PMID:32679048 SHBG Human chrysin affects binding EXP 6480464 chrysin binds to SHBG protein CTD PMID:25349334 SHBG Human clomiphene affects binding EXP 6480464 Clomiphene binds to SHBG protein CTD PMID:25349334 SHBG Human copper atom multiple interactions EXP 6480464 Copper promotes the reaction [Estradiol results in increased expression of SHBG mRNA]; Estradiol promotes the more ... CTD PMID:19685012 SHBG Human copper atom decreases expression EXP 6480464 Copper results in decreased expression of SHBG mRNA CTD PMID:19685012 SHBG Human copper(0) multiple interactions EXP 6480464 Copper promotes the reaction [Estradiol results in increased expression of SHBG mRNA]; Estradiol promotes the more ... CTD PMID:19685012 SHBG Human copper(0) decreases expression EXP 6480464 Copper results in decreased expression of SHBG mRNA CTD PMID:19685012 SHBG Human corticosterone affects binding EXP 6480464 Corticosterone binds to SHBG protein CTD PMID:25349334 SHBG Human coumestrol affects binding EXP 6480464 Coumestrol binds to SHBG protein CTD PMID:25349334 SHBG Human cyclosporin A decreases expression EXP 6480464 Cyclosporine results in decreased expression of SHBG mRNA CTD PMID:25562108 SHBG Human cypermethrin increases expression ISO RGD:11289 6480464 cypermethrin results in increased expression of SHBG protein CTD PMID:30974244 SHBG Human cypermethrin affects binding EXP 6480464 cypermethrin binds to SHBG protein CTD PMID:32278787 SHBG Human D-glucose multiple interactions EXP 6480464 Cerulenin inhibits the reaction [Glucose results in decreased expression of SHBG protein]; Glucose affects the more ... CTD PMID:17992261 SHBG Human D-glucose decreases expression EXP 6480464 Glucose results in decreased expression of SHBG protein CTD PMID:17992261 SHBG Human DDE multiple interactions ISO RGD:3671 6480464 Dichlorodiphenyl Dichloroethylene analog inhibits the reaction [Dihydrotestosterone binds to SHBG protein] CTD PMID:9171990 SHBG Human DDE decreases expression EXP 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of SHBG mRNA CTD PMID:38568856 SHBG Human DDE increases expression ISO RGD:3671 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of SHBG mRNA CTD PMID:16380112 SHBG Human DDT multiple interactions ISO RGD:3671 6480464 DDT analog inhibits the reaction [Dihydrotestosterone binds to SHBG protein]; DDT inhibits the reaction [Dihydrotestosterone more ... CTD PMID:9171990 SHBG Human decabromodiphenyl ether increases expression ISO RGD:3671 6480464 decabromobiphenyl ether results in increased expression of SHBG mRNA CTD PMID:23640034 SHBG Human delta-hexachlorocyclohexane multiple interactions EXP 6480464 delta-hexachlorocyclohexane inhibits the reaction [Dihydrotestosterone binds to SHBG protein] CTD PMID:9171990 SHBG Human delta-hexachlorocyclohexane multiple interactions ISO RGD:3671 6480464 delta-hexachlorocyclohexane inhibits the reaction [Dihydrotestosterone binds to SHBG protein] CTD PMID:9171990 SHBG Human Di-n-octyl phthalate affects binding EXP 6480464 di-n-octyl phthalate binds to SHBG protein CTD PMID:25349334 SHBG Human dibutyl phthalate affects binding EXP 6480464 Dibutyl Phthalate binds to SHBG protein CTD PMID:25349334 SHBG Human dibutyl phthalate multiple interactions EXP 6480464 [Phthalic Acids results in increased abundance of Dibutyl Phthalate] which results in increased expression of more ... CTD PMID:28637469 SHBG Human dieldrin multiple interactions ISO RGD:3671 6480464 Dieldrin inhibits the reaction [Dihydrotestosterone binds to SHBG protein] CTD PMID:9171990 SHBG Human dienestrol affects binding EXP 6480464 Dienestrol binds to SHBG protein CTD PMID:25349334 SHBG Human diethyl phthalate affects binding EXP 6480464 diethyl phthalate binds to SHBG protein CTD PMID:25349334 SHBG Human diethylstilbestrol affects binding EXP 6480464 Diethylstilbestrol binds to SHBG protein CTD PMID:25349334 SHBG Human Dimethylstilbestrol affects binding EXP 6480464 dimethylstilbestrol binds to SHBG protein CTD PMID:25349334 SHBG Human Droloxifene affects binding EXP 6480464 droloxifene binds to SHBG protein CTD PMID:25349334 SHBG Human drospirenone multiple interactions EXP 6480464 [Ethinyl Estradiol co-treated with drospirenone] results in increased expression of SHBG protein CTD PMID:11245553 SHBG Human elcometrine multiple interactions EXP 6480464 [Ethinyl Estradiol co-treated with ST 1435] results in increased expression of SHBG protein CTD PMID:17519148 SHBG Human equol affects binding EXP 6480464 Equol binds to SHBG protein CTD PMID:25349334 SHBG Human estra-1,3,5(10)-trien-3-ol affects binding EXP 6480464 17-desoxyestradiol binds to SHBG protein CTD PMID:25349334 SHBG Human estriol affects binding EXP 6480464 Estriol binds to SHBG protein CTD PMID:25349334 SHBG Human estrone affects binding EXP 6480464 Estrone binds to SHBG protein CTD PMID:25349334 SHBG Human ethylparaben affects binding EXP 6480464 ethyl-p-hydroxybenzoate binds to SHBG protein CTD PMID:25349334 SHBG Human fenvalerate affects binding EXP 6480464 fenvalerate binds to SHBG protein CTD PMID:32278787 SHBG Human flavanone affects binding EXP 6480464 flavanone binds to SHBG protein CTD PMID:25349334 SHBG Human fructose multiple interactions EXP 6480464 Cerulenin inhibits the reaction [Fructose results in decreased expression of SHBG protein]; Fructose affects the more ... CTD PMID:17992261 SHBG Human fructose decreases expression EXP 6480464 Fructose results in decreased expression of SHBG protein CTD PMID:17992261 SHBG Human gamma-hexachlorocyclohexane multiple interactions EXP 6480464 Hexachlorocyclohexane inhibits the reaction [Dihydrotestosterone binds to SHBG protein] CTD PMID:9171990 SHBG Human gamma-hexachlorocyclohexane decreases expression ISO RGD:3671 6480464 Hexachlorocyclohexane results in decreased expression of SHBG protein CTD PMID:18248869 SHBG Human gamma-hexachlorocyclohexane multiple interactions ISO RGD:3671 6480464 Hexachlorocyclohexane inhibits the reaction [Dihydrotestosterone binds to SHBG protein] CTD PMID:9171990 SHBG Human genistein increases expression EXP 6480464 Genistein results in increased expression of SHBG mRNA CTD PMID:18847459 SHBG Human genistein affects binding EXP 6480464 Genistein binds to SHBG protein CTD PMID:25349334 SHBG Human gestodene multiple interactions EXP 6480464 [Ethinyl Estradiol co-treated with Gestodene] results in increased expression of SHBG protein CTD PMID:10899481 SHBG Human glucose multiple interactions EXP 6480464 Cerulenin inhibits the reaction [Glucose results in decreased expression of SHBG protein]; Glucose affects the more ... CTD PMID:17992261 SHBG Human glucose decreases expression EXP 6480464 Glucose results in decreased expression of SHBG protein CTD PMID:17992261 SHBG Human glyphosate decreases expression ISO RGD:11289 6480464 Glyphosate results in decreased expression of SHBG mRNA CTD PMID:24273285 SHBG Human hesperetin affects binding EXP 6480464 hesperetin binds to SHBG protein CTD PMID:25349334 SHBG Human letrozole multiple interactions ISO RGD:3671 6480464 Spironolactone inhibits the reaction [Letrozole results in decreased secretion of SHBG protein] CTD PMID:37328115 SHBG Human letrozole decreases secretion ISO RGD:3671 6480464 Letrozole results in decreased secretion of SHBG protein CTD PMID:37328115 SHBG Human levonorgestrel affects binding EXP 6480464 Levonorgestrel binds to SHBG protein CTD PMID:12586319 SHBG Human levonorgestrel multiple interactions EXP 6480464 [Ethinyl Estradiol co-treated with Levonorgestrel] results in increased expression of SHBG protein CTD PMID:12586319|PMID:14981370|PMID:17519148 SHBG Human Licochalcone B increases expression EXP 6480464 licochalcone B results in increased expression of SHBG mRNA CTD PMID:33647349 SHBG Human linuron decreases expression ISO RGD:3671 6480464 Linuron results in decreased expression of SHBG mRNA CTD PMID:28705778 SHBG Human lipopolysaccharide multiple interactions ISO RGD:11289 6480464 Cryptoxanthins inhibits the reaction [Lipopolysaccharides results in decreased expression of SHBG mRNA] CTD PMID:26686910 SHBG Human lipopolysaccharide decreases expression ISO RGD:11289 6480464 Lipopolysaccharides results in decreased expression of SHBG mRNA CTD PMID:26686910 SHBG Human manganese(II) chloride decreases expression ISO RGD:3671 6480464 manganese chloride results in decreased expression of SHBG mRNA CTD PMID:28801915 SHBG Human masoprocol affects binding EXP 6480464 Masoprocol binds to SHBG protein CTD PMID:25349334 SHBG Human methoxyacetic acid increases expression ISO RGD:3671 6480464 methoxyacetic acid results in increased expression of SHBG mRNA CTD PMID:12606434 SHBG Human methoxyacetic acid increases expression ISO RGD:11289 6480464 methoxyacetic acid results in increased expression of SHBG mRNA; methoxyacetic acid results in increased expression more ... CTD PMID:12606434|PMID:18486176 SHBG Human methoxychlor multiple interactions ISO RGD:3671 6480464 Methoxychlor inhibits the reaction [Dihydrotestosterone binds to SHBG protein] CTD PMID:9171990 SHBG Human methylparaben affects binding EXP 6480464 methylparaben binds to SHBG protein CTD PMID:25349334 SHBG Human methylparaben decreases secretion EXP 6480464 methylparaben results in decreased secretion of SHBG protein CTD PMID:30940137 SHBG Human Mitotane multiple interactions EXP 6480464 ESR1 protein promotes the reaction [Mitotane results in increased expression of SHBG protein] CTD PMID:16551731 SHBG Human Mitotane affects binding EXP 6480464 Mitotane binds to SHBG protein CTD PMID:25349334 SHBG Human Mitotane increases expression EXP 6480464 Mitotane results in increased expression of SHBG protein CTD PMID:16551731 SHBG Human mono(2-ethyl-5-hydroxyhexyl) phthalate decreases secretion EXP 6480464 mono(2-ethyl-5-hydroxyhexyl) phthalate results in decreased secretion of SHBG protein CTD PMID:24945889 SHBG Human mono(2-ethyl-5-oxohexyl) phthalate decreases secretion EXP 6480464 mono(2-ethyl-5-oxohexyl)phthalate results in decreased secretion of SHBG protein CTD PMID:24945889 SHBG Human mono(2-ethylhexyl) phthalate decreases secretion EXP 6480464 mono-(2-ethylhexyl)phthalate results in decreased secretion of SHBG protein CTD PMID:24945889 SHBG Human mono(2-ethylhexyl) phthalate multiple interactions ISO RGD:11289 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of SHBG mRNA CTD PMID:36189433 SHBG Human mono(2-ethylhexyl) phthalate increases expression ISO RGD:11289 6480464 mono-(2-ethylhexyl)phthalate results in increased expression of SHBG mRNA CTD PMID:36189433 SHBG Human monobenzyl phthalate multiple interactions EXP 6480464 [Phthalic Acids results in increased abundance of mono-benzyl phthalate] which results in increased expression of more ... CTD PMID:28637469 SHBG Human monobenzyl phthalate decreases secretion EXP 6480464 mono-benzyl phthalate results in decreased secretion of SHBG protein CTD PMID:24945889 SHBG Human Monobutylphthalate decreases secretion EXP 6480464 monobutyl phthalate results in decreased secretion of SHBG protein CTD PMID:24945889 SHBG Human Moxestrol affects binding EXP 6480464 moxestrol binds to SHBG protein CTD PMID:25349334 SHBG Human Nonylphenol multiple interactions EXP 6480464 nonylphenol inhibits the reaction [Dihydrotestosterone binds to SHBG protein] CTD PMID:9171990 SHBG Human Nonylphenol increases expression ISO RGD:3671 6480464 nonylphenol results in increased expression of SHBG mRNA CTD PMID:27832966 SHBG Human Nonylphenol multiple interactions ISO RGD:3671 6480464 wortmannin inhibits the reaction [nonylphenol results in increased expression of SHBG mRNA] CTD PMID:27832966 SHBG Human Nonylphenol decreases expression ISO RGD:3671 6480464 nonylphenol results in decreased expression of SHBG protein CTD PMID:27832966 SHBG Human Norethynodrel affects binding EXP 6480464 Norethynodrel binds to SHBG protein CTD PMID:25349334 SHBG Human norgestimate multiple interactions EXP 6480464 [Ethinyl Estradiol co-treated with norgestimate] results in increased expression of SHBG protein CTD PMID:12586319|PMID:16982228 SHBG Human okadaic acid decreases expression EXP 6480464 Okadaic Acid results in decreased expression of SHBG mRNA CTD PMID:38832940 SHBG Human olanzapine decreases expression EXP 6480464 olanzapine results in decreased expression of SHBG protein CTD PMID:19512971 SHBG Human oxandrolone decreases expression EXP 6480464 Oxandrolone results in decreased expression of SHBG protein CTD PMID:17961146 SHBG Human oxcarbazepine increases expression EXP 6480464 oxcarbazepine results in increased expression of SHBG protein CTD PMID:11148232 SHBG Human palmitoyl-CoA decreases expression EXP 6480464 Palmitoyl Coenzyme A results in decreased expression of SHBG mRNA; Palmitoyl Coenzyme A results in more ... CTD PMID:17992261 SHBG Human paracetamol increases expression ISO RGD:3671 6480464 Acetaminophen results in increased expression of SHBG mRNA CTD PMID:33387578 SHBG Human pentachlorophenol multiple interactions EXP 6480464 Pentachlorophenol inhibits the reaction [Dihydrotestosterone binds to SHBG protein] CTD PMID:9171990 SHBG Human pentachlorophenol multiple interactions ISO RGD:3671 6480464 Pentachlorophenol inhibits the reaction [Dihydrotestosterone binds to SHBG protein] CTD PMID:9171990 SHBG Human perfluorononanoic acid increases expression ISO RGD:3671 6480464 perfluoro-n-nonanoic acid results in increased expression of SHBG mRNA CTD PMID:20580666 SHBG Human phenolphthalein affects binding EXP 6480464 Phenolphthalein binds to SHBG protein CTD PMID:25349334 SHBG Human phloretin affects binding EXP 6480464 Phloretin binds to SHBG protein CTD PMID:25349334 SHBG Human progesterone affects binding EXP 6480464 Progesterone binds to SHBG protein CTD PMID:25349334 SHBG Human propylparaben affects binding EXP 6480464 propylparaben binds to SHBG protein CTD PMID:25349334 SHBG Human propylparaben decreases secretion EXP 6480464 propylparaben results in decreased secretion of SHBG protein CTD PMID:30940137 SHBG Human quercetin increases expression EXP 6480464 Quercetin results in increased expression of SHBG mRNA CTD PMID:21632981 SHBG Human quercetin affects binding EXP 6480464 Quercetin binds to SHBG protein CTD PMID:25349334 SHBG Human quercetin multiple interactions ISO RGD:3671 6480464 Quercetin inhibits the reaction [Atrazine results in increased expression of SHBG mRNA] CTD PMID:22372587 SHBG Human quinoxyfen affects binding EXP 6480464 quinoxyfen binds to SHBG protein CTD PMID:32278787 SHBG Human raloxifene increases expression EXP 6480464 Raloxifene Hydrochloride results in increased expression of SHBG protein CTD PMID:16775175|PMID:16912660 SHBG Human sodium arsenite increases expression ISO RGD:11289 6480464 sodium arsenite results in increased expression of SHBG mRNA CTD PMID:17451858 SHBG Human sodium arsenite decreases expression ISO RGD:11289 6480464 sodium arsenite results in decreased expression of SHBG mRNA CTD PMID:30189373 SHBG Human sodium arsenite multiple interactions ISO RGD:11289 6480464 [Sulfur Dioxide co-treated with sodium arsenite] results in decreased expression of SHBG mRNA CTD PMID:30195209 SHBG Human sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of SHBG mRNA CTD PMID:29301061|PMID:38568856 SHBG Human Soman decreases expression ISO RGD:3671 6480464 Soman results in decreased expression of SHBG mRNA CTD PMID:19281266 SHBG Human spironolactone multiple interactions ISO RGD:3671 6480464 Spironolactone inhibits the reaction [Letrozole results in decreased secretion of SHBG protein] CTD PMID:37328115 SHBG Human stilbene-4,4'-diol affects binding EXP 6480464 4,4'-dihydroxystilbene binds to SHBG protein CTD PMID:25349334 SHBG Human sulfur dioxide multiple interactions ISO RGD:11289 6480464 [Sulfur Dioxide co-treated with sodium arsenite] results in decreased expression of SHBG mRNA CTD PMID:30195209 SHBG Human tamoxifen increases expression EXP 6480464 Tamoxifen results in increased expression of SHBG protein CTD PMID:14692654|PMID:20332317|PMID:3207604 SHBG Human tamoxifen affects binding EXP 6480464 Tamoxifen binds to SHBG protein CTD PMID:25349334 SHBG Human testosterone increases expression EXP 6480464 Testosterone results in increased expression of SHBG mRNA CTD PMID:21632903|PMID:33359661 SHBG Human testosterone affects binding EXP 6480464 Testosterone binds to SHBG protein CTD PMID:25349334 SHBG Human tetramethrin affects binding EXP 6480464 tetramethrin binds to SHBG protein CTD PMID:32278787 SHBG Human thioacetamide decreases expression ISO RGD:3671 6480464 Thioacetamide results in decreased expression of SHBG mRNA CTD PMID:34492290 SHBG Human toremifene increases expression EXP 6480464 Toremifene results in increased expression of SHBG protein CTD PMID:14692654 SHBG Human toremifene affects binding EXP 6480464 Toremifene binds to SHBG protein CTD PMID:25349334 SHBG Human trans-chalcone affects binding EXP 6480464 Chalcone binds to SHBG protein CTD PMID:25349334 SHBG Human trans-stilbene-4,4'-diol affects binding EXP 6480464 4,4'-dihydroxystilbene binds to SHBG protein CTD PMID:25349334 SHBG Human tributylstannane multiple interactions ISO RGD:3671 6480464 [bisphenol A co-treated with tributyltin] results in decreased secretion of SHBG protein CTD PMID:31129395 SHBG Human tributylstannane decreases secretion ISO RGD:3671 6480464 tributyltin results in decreased secretion of SHBG protein CTD PMID:31129395 SHBG Human trichloroethene increases methylation ISO RGD:3671 6480464 Trichloroethylene results in increased methylation of SHBG gene CTD PMID:27618143 SHBG Human trichloroethene increases expression ISO RGD:3671 6480464 Trichloroethylene results in increased expression of SHBG mRNA CTD PMID:33387578 SHBG Human triclocarban decreases secretion EXP 6480464 triclocarban results in decreased secretion of SHBG protein CTD PMID:30940137 SHBG Human Triphenylethylene affects binding EXP 6480464 triphenylethylene binds to SHBG protein CTD PMID:25349334 SHBG Human triptonide increases expression ISO RGD:11289 6480464 triptonide results in increased expression of SHBG mRNA CTD PMID:33045310 SHBG Human wortmannin multiple interactions ISO RGD:3671 6480464 wortmannin inhibits the reaction [nonylphenol results in increased expression of SHBG mRNA] CTD PMID:27832966 SHBG Human zinc atom affects binding EXP 6480464 SHBG protein binds to Zinc CTD PMID:23896426 SHBG Human zinc(0) affects binding EXP 6480464 SHBG protein binds to Zinc CTD PMID:23896426
(S)-naringenin (EXP) 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (EXP,ISO) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (EXP,ISO) 17beta-hydroxy-5alpha-androstan-3-one (EXP,ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,2'-Dihydroxy-4-methoxybenzophenone (EXP) 2,3,4,5-Tetrachloro-4'-biphenylol (EXP) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4,6-tribromophenol (EXP) 2,4,6-trinitrobenzenesulfonic acid (ISO) 2,4-diaminotoluene (ISO) 2,4-Dihydroxybenzophenone (EXP) 2-hydroxy-17beta-estradiol (EXP) 2-sec-butylphenol (EXP) 3'-hydroxyflavanone (EXP) 3-Deoxyestrone (EXP) 4'-hydroxychalcone (EXP) 4'-hydroxyflavanone (EXP) 4,4'-sulfonyldiphenol (ISO) 4-hydroxy-17beta-estradiol (EXP) 4-hydroxychalcone (EXP) 4-nonylphenol (EXP) 4-octylphenol (EXP) 6-propyl-2-thiouracil (ISO) 7-hydroxyflavanone (EXP) acetamide (ISO) afimoxifene (EXP) aflatoxin B1 (EXP) alcohol (EXP) aldehydo-D-glucose (EXP) all-trans-retinoic acid (ISO) alpha-Zearalanol (EXP) ammonium chloride (ISO) apigenin (EXP) aristolochic acid A (EXP) atrazine (ISO) Aurin (EXP) benzo[a]pyrene (EXP) Benzyl parahydroxybenzoate (EXP) beta-Zearalanol (EXP) bifenthrin (EXP) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) Bisphenol B (EXP) Butylbenzyl phthalate (EXP) Butylparaben (EXP) cadmium atom (ISO) carbamazepine (EXP) cerulenin (EXP) chalcone (EXP) chromium(6+) (EXP,ISO) chrysin (EXP) clomiphene (EXP) copper atom (EXP) copper(0) (EXP) corticosterone (EXP) coumestrol (EXP) cyclosporin A (EXP) cypermethrin (EXP,ISO) D-glucose (EXP) DDE (EXP,ISO) DDT (ISO) decabromodiphenyl ether (ISO) delta-hexachlorocyclohexane (EXP,ISO) Di-n-octyl phthalate (EXP) dibutyl phthalate (EXP) dieldrin (ISO) dienestrol (EXP) diethyl phthalate (EXP) diethylstilbestrol (EXP) Dimethylstilbestrol (EXP) Droloxifene (EXP) drospirenone (EXP) elcometrine (EXP) equol (EXP) estra-1,3,5(10)-trien-3-ol (EXP) estriol (EXP) estrone (EXP) ethylparaben (EXP) fenvalerate (EXP) flavanone (EXP) fructose (EXP) gamma-hexachlorocyclohexane (EXP,ISO) genistein (EXP) gestodene (EXP) glucose (EXP) glyphosate (ISO) hesperetin (EXP) letrozole (ISO) levonorgestrel (EXP) Licochalcone B (EXP) linuron (ISO) lipopolysaccharide (ISO) manganese(II) chloride (ISO) masoprocol (EXP) methoxyacetic acid (ISO) methoxychlor (ISO) methylparaben (EXP) Mitotane (EXP) mono(2-ethyl-5-hydroxyhexyl) phthalate (EXP) mono(2-ethyl-5-oxohexyl) phthalate (EXP) mono(2-ethylhexyl) phthalate (EXP,ISO) monobenzyl phthalate (EXP) Monobutylphthalate (EXP) Moxestrol (EXP) Nonylphenol (EXP,ISO) Norethynodrel (EXP) norgestimate (EXP) okadaic acid (EXP) olanzapine (EXP) oxandrolone (EXP) oxcarbazepine (EXP) palmitoyl-CoA (EXP) paracetamol (ISO) pentachlorophenol (EXP,ISO) perfluorononanoic acid (ISO) phenolphthalein (EXP) phloretin (EXP) progesterone (EXP) propylparaben (EXP) quercetin (EXP,ISO) quinoxyfen (EXP) raloxifene (EXP) sodium arsenite (EXP,ISO) Soman (ISO) spironolactone (ISO) stilbene-4,4'-diol (EXP) sulfur dioxide (ISO) tamoxifen (EXP) testosterone (EXP) tetramethrin (EXP) thioacetamide (ISO) toremifene (EXP) trans-chalcone (EXP) trans-stilbene-4,4'-diol (EXP) tributylstannane (ISO) trichloroethene (ISO) triclocarban (EXP) Triphenylethylene (EXP) triptonide (ISO) wortmannin (ISO) zinc atom (EXP) zinc(0) (EXP)
1.
Lower sex hormone-binding globulin is more strongly associated with metabolic syndrome than lower total testosterone in older men: the Health in Men Study.
Chubb SA, etal., Eur J Endocrinol. 2008 Jun;158(6):785-92.
2.
Sex hormone-binding globulin and testosterone in individuals with childhood diabetes.
Danielson KK, etal., Diabetes Care. 2008 Jun;31(6):1207-13. Epub 2008 Mar 17.
3.
Sex hormone-binding globulin and risk of type 2 diabetes in women and men.
Ding EL, etal., N Engl J Med. 2009 Sep 17;361(12):1152-63. Epub 2009 Aug 5.
4.
GOAs Human GO annotations
GOA_HUMAN data from the GO Consortium
5.
Association of endometrial cancer risk with a functional polymorphism (Asp(327)Asn) in the sex hormone-binding globulin gene.
Kataoka N, etal., Cancer. 2007 Apr 1;109(7):1296-302.
6.
Suppression of SOCS3 expression in the pancreatic beta-cell leads to resistance to type 1 diabetes.
Mori H, etal., Biochem Biophys Res Commun. 2007 Aug 10;359(4):952-8. Epub 2007 Jun 4.
7.
Serum sex hormone-binding globulin, a determinant of cardiometabolic disorders independent of abdominal obesity and insulin resistance in elderly men and women.
Onat A, etal., Metabolism. 2007 Oct;56(10):1356-62.
8.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
SHBG Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 7,614,064 - 7,633,372 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 7,613,946 - 7,633,382 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 7,517,382 - 7,536,690 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 7,474,216 - 7,477,395 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 17 7,474,215 - 7,477,395 NCBI Celera 17 7,543,810 - 7,563,117 (+) NCBI Celera Cytogenetic Map 17 p13.1 NCBI HuRef 17 7,411,426 - 7,430,707 (+) NCBI HuRef CHM1_1 17 7,526,291 - 7,545,881 (+) NCBI CHM1_1 T2T-CHM13v2.0 17 7,518,285 - 7,537,563 (+) NCBI T2T-CHM13v2.0
Shbg Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 69,501,108 - 69,508,852 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 69,505,630 - 69,508,731 (-) Ensembl GRCm39 Ensembl GRCm38 11 69,610,282 - 69,618,026 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 69,614,804 - 69,617,905 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 69,428,318 - 69,431,407 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 70,198,988 - 70,201,975 (-) NCBI MGSCv36 mm8 MGSCv36 11 69,431,011 - 69,434,063 (-) NCBI MGSCv36 mm8 Cytogenetic Map 11 B3 NCBI cM Map 11 42.86 NCBI
Shbg Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 54,831,716 - 54,849,162 (-) NCBI GRCr8 mRatBN7.2 10 54,332,939 - 54,350,409 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 54,332,941 - 54,351,057 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 58,995,368 - 58,998,537 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 58,483,914 - 58,487,083 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 53,991,608 - 53,994,780 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 56,219,861 - 56,237,354 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 56,219,858 - 56,223,245 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 55,965,499 - 55,983,036 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 56,432,474 - 56,435,654 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 56,446,096 - 56,449,277 (-) NCBI Celera 10 53,487,385 - 53,490,565 (-) NCBI Celera Cytogenetic Map 10 q24 NCBI
Shbg Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955467 9,301,173 - 9,305,010 (-) NCBI ChiLan1.0 ChiLan1.0
SHBG Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 19 15,221,821 - 15,235,544 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 17 17,187,912 - 17,193,499 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 17 7,658,831 - 7,664,631 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 17 7,645,188 - 7,650,552 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 17 7,645,187 - 7,650,552 (+) Ensembl panpan1.1 panPan2
SHBG Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 32,535,738 - 32,540,627 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 5 32,537,138 - 32,540,624 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 32,674,555 - 32,679,801 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 32,640,395 - 32,645,639 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 32,642,122 - 32,645,637 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 5 32,608,086 - 32,613,336 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 32,564,351 - 32,569,590 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 32,743,466 - 32,748,710 (+) NCBI UU_Cfam_GSD_1.0
Shbg
SHBG
SHBG Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 16 7,002,380 - 7,012,170 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 16 7,008,682 - 7,012,764 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666059 14,395,808 - 14,399,825 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Shbg
.
Predicted Target Of
Count of predictions: 4672 Count of miRNA genes: 806 Interacting mature miRNAs: 960 Transcripts: ENST00000340624, ENST00000380450, ENST00000416273, ENST00000441599, ENST00000570353, ENST00000570527, ENST00000570547, ENST00000571153, ENST00000572182, ENST00000572262, ENST00000574539, ENST00000575314, ENST00000575618, ENST00000575729, ENST00000575903, ENST00000576152, ENST00000576478, ENST00000576728, ENST00000576747, ENST00000576830 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
597095573 GWAS1191647_H sex hormone-binding globulin measurement QTL GWAS1191647 (human) 3e-2579 sex hormone-binding globulin measurement 17 7628647 7628648 Human 407110720 GWAS759696_H waist-hip ratio QTL GWAS759696 (human) 5e-18 waist-hip ratio waist to hip ratio (WHR) (CMO:0000020) 17 7628647 7628648 Human 597036177 GWAS1132251_H heel bone mineral density QTL GWAS1132251 (human) 1e-14 heel bone mineral density bone mineral density (CMO:0001226) 17 7631360 7631361 Human 406938696 GWAS587672_H blood protein measurement QTL GWAS587672 (human) 1e-111 blood protein amount (VT:0005416) blood protein measurement (CMO:0000028) 17 7628647 7628648 Human 597278611 GWAS1374685_H sex hormone-binding globulin measurement QTL GWAS1374685 (human) 1e-300 sex hormone-binding globulin measurement 17 7618597 7618598 Human 406959951 GWAS608927_H pulse pressure measurement QTL GWAS608927 (human) 0.0000002 pulse pressure measurement pulse pressure (CMO:0000292) 17 7624628 7624629 Human 407389784 GWAS1038760_H obsolete_red blood cell distribution width QTL GWAS1038760 (human) 7e-09 obsolete_red blood cell distribution width 17 7629707 7629708 Human 597337994 GWAS1434068_H positive regulation of ovulation QTL GWAS1434068 (human) 0.000009 positive regulation of ovulation 17 7630105 7630106 Human 597106823 GWAS1202897_H testosterone measurement QTL GWAS1202897 (human) 7e-286 testosterone measurement serum testosterone level (CMO:0000568) 17 7631360 7631361 Human 597409674 GWAS1505748_H metabolite measurement QTL GWAS1505748 (human) 7e-33 metabolite measurement 17 7626584 7626585 Human 597245579 GWAS1341653_H low density lipoprotein cholesterol measurement QTL GWAS1341653 (human) 4e-10 low density lipoprotein cholesterol measurement blood low density lipoprotein cholesterol level (CMO:0000053) 17 7633142 7633143 Human 597171340 GWAS1267414_H osteoarthritis, hip QTL GWAS1267414 (human) 8e-09 osteoarthritis, hip 17 7629697 7629698 Human 597095810 GWAS1191884_H testosterone measurement QTL GWAS1191884 (human) 9e-742 testosterone measurement serum testosterone level (CMO:0000568) 17 7630105 7630106 Human 597095811 GWAS1191885_H testosterone measurement QTL GWAS1191885 (human) 6e-347 testosterone measurement serum testosterone level (CMO:0000568) 17 7631360 7631361 Human 597501323 GWAS1597397_H N6-acetyllysine measurement QTL GWAS1597397 (human) 2e-84 N6-acetyllysine measurement 17 7626584 7626585 Human 597027465 GWAS1123539_H blood protein measurement QTL GWAS1123539 (human) 4e-16 blood protein amount (VT:0005416) blood protein measurement (CMO:0000028) 17 7628647 7628648 Human 597120139 GWAS1216213_H sex hormone-binding globulin measurement QTL GWAS1216213 (human) 6e-26 sex hormone-binding globulin measurement 17 7630105 7630106 Human 597120138 GWAS1216212_H sex hormone-binding globulin measurement QTL GWAS1216212 (human) 4e-30 sex hormone-binding globulin measurement 17 7630105 7630106 Human 597430146 GWAS1526220_H protein measurement QTL GWAS1526220 (human) 2e-11 protein measurement 17 7625306 7625307 Human 597120137 GWAS1216211_H sex hormone-binding globulin measurement QTL GWAS1216211 (human) 2e-24 sex hormone-binding globulin measurement 17 7628647 7628648 Human 597598593 GWAS1655453_H HbA1c measurement QTL GWAS1655453 (human) 1e-13 HbA1c measurement blood hemoglobin A1c level (CMO:0002786) 17 7628647 7628648 Human 407052131 GWAS701107_H testosterone measurement QTL GWAS701107 (human) 1e-41 testosterone measurement serum testosterone level (CMO:0000568) 17 7618597 7618598 Human 597098166 GWAS1194240_H comparative body size at age 10, self-reported QTL GWAS1194240 (human) 4e-09 comparative body size at age 10, self-reported 17 7621186 7621187 Human 597280696 GWAS1376770_H sex hormone-binding globulin measurement QTL GWAS1376770 (human) 2e-289 sex hormone-binding globulin measurement 17 7628647 7628648 Human 407052132 GWAS701108_H testosterone measurement QTL GWAS701108 (human) 2e-22 testosterone measurement serum testosterone level (CMO:0000568) 17 7631360 7631361 Human 597523381 GWAS1619455_H N6-acetyllysine measurement QTL GWAS1619455 (human) 4e-107 N6-acetyllysine measurement 17 7626584 7626585 Human 597598902 GWAS1655762_H HbA1c measurement QTL GWAS1655762 (human) 2e-13 HbA1c measurement blood hemoglobin A1c level (CMO:0002786) 17 7628647 7628648 Human 597245873 GWAS1341947_H sex hormone-binding globulin measurement QTL GWAS1341947 (human) 3e-511 sex hormone-binding globulin measurement 17 7633142 7633143 Human 597078716 GWAS1174790_H blood protein measurement QTL GWAS1174790 (human) 2e-18 blood protein amount (VT:0005416) blood protein measurement (CMO:0000028) 17 7628647 7628648 Human 597523382 GWAS1619456_H N6-acetyllysine measurement QTL GWAS1619456 (human) 2e-15 N6-acetyllysine measurement 17 7626829 7626830 Human 597031609 GWAS1127683_H blood protein measurement QTL GWAS1127683 (human) 6e-11 blood protein amount (VT:0005416) blood protein measurement (CMO:0000028) 17 7628647 7628648 Human 597100729 GWAS1196803_H sex hormone-binding globulin measurement QTL GWAS1196803 (human) 1e-1823 sex hormone-binding globulin measurement 17 7631360 7631361 Human 597100728 GWAS1196802_H sex hormone-binding globulin measurement QTL GWAS1196802 (human) 9e-2048 sex hormone-binding globulin measurement 17 7630105 7630106 Human 597095587 GWAS1191661_H testosterone measurement QTL GWAS1191661 (human) 1e-23 testosterone measurement serum testosterone level (CMO:0000568) 17 7629697 7629698 Human 597089697 GWAS1185771_H type 2 diabetes mellitus QTL GWAS1185771 (human) 2e-08 type 2 diabetes mellitus 17 7628647 7628648 Human 597348811 GWAS1444885_H body fat percentage QTL GWAS1444885 (human) 2e-17 body fat mass (VT:0010482) body fat percentage (CMO:0000302) 17 7630143 7630144 Human 597158595 GWAS1254669_H testosterone measurement QTL GWAS1254669 (human) 0.0000006 testosterone measurement serum testosterone level (CMO:0000568) 17 7629697 7629698 Human 597097409 GWAS1193483_H protein measurement QTL GWAS1193483 (human) 4e-11 protein measurement 17 7630143 7630144 Human 597384642 GWAS1480716_H serum metabolite measurement QTL GWAS1480716 (human) 1e-38 serum metabolite measurement 17 7626584 7626585 Human 406945560 GWAS594536_H heel bone mineral density QTL GWAS594536 (human) 3e-20 heel bone mineral density bone mineral density (CMO:0001226) 17 7631360 7631361 Human 597191108 GWAS1287182_H testosterone measurement QTL GWAS1287182 (human) 3e-13 testosterone measurement serum testosterone level (CMO:0000568) 17 7629697 7629698 Human 597157832 GWAS1253906_H testosterone measurement QTL GWAS1253906 (human) 4e-12 testosterone measurement serum testosterone level (CMO:0000568) 17 7629697 7629698 Human 597119487 GWAS1215561_H sex hormone-binding globulin measurement QTL GWAS1215561 (human) 8e-378 sex hormone-binding globulin measurement 17 7633206 7633207 Human 597119486 GWAS1215560_H sex hormone-binding globulin measurement QTL GWAS1215560 (human) 5e-12 sex hormone-binding globulin measurement 17 7631691 7631692 Human 597119485 GWAS1215559_H sex hormone-binding globulin measurement QTL GWAS1215559 (human) 2e-3373 sex hormone-binding globulin measurement 17 7631360 7631361 Human 597119484 GWAS1215558_H sex hormone-binding globulin measurement QTL GWAS1215558 (human) 6e-10 sex hormone-binding globulin measurement 17 7630783 7630784 Human 597110521 GWAS1206595_H Calcium channel blocker use measurement QTL GWAS1206595 (human) 5e-09 Calcium channel blocker use measurement 17 7622228 7622229 Human 597404916 GWAS1500990_H N6-acetyllysine measurement QTL GWAS1500990 (human) 2e-46 N6-acetyllysine measurement 17 7626584 7626585 Human 597299189 GWAS1395263_H type 2 diabetes mellitus QTL GWAS1395263 (human) 2e-09 type 2 diabetes mellitus 17 7629707 7629708 Human 407121460 GWAS770436_H sex hormone-binding globulin measurement QTL GWAS770436 (human) 6e-30 sex hormone-binding globulin measurement 17 7618597 7618598 Human 597242345 GWAS1338419_H sex hormone-binding globulin measurement QTL GWAS1338419 (human) 1e-16 sex hormone-binding globulin measurement 17 7627770 7627771 Human 597242088 GWAS1338162_H HbA1c measurement QTL GWAS1338162 (human) 7e-13 HbA1c measurement blood hemoglobin A1c level (CMO:0002786) 17 7633142 7633143 Human 407121463 GWAS770439_H sex hormone-binding globulin measurement QTL GWAS770439 (human) 2e-106 sex hormone-binding globulin measurement 17 7618597 7618598 Human 597313004 GWAS1409078_H N6-acetyllysine measurement QTL GWAS1409078 (human) 2e-22 N6-acetyllysine measurement 17 7630583 7630584 Human 407121459 GWAS770435_H sex hormone-binding globulin measurement QTL GWAS770435 (human) 4e-80 sex hormone-binding globulin measurement 17 7618597 7618598 Human 407121724 GWAS770700_H sex hormone-binding globulin measurement QTL GWAS770700 (human) 2e-55 sex hormone-binding globulin measurement 17 7618597 7618598 Human 597096687 GWAS1192761_H sex hormone-binding globulin measurement QTL GWAS1192761 (human) 2e-3229 sex hormone-binding globulin measurement 17 7628647 7628648 Human 407121725 GWAS770701_H sex hormone-binding globulin measurement QTL GWAS770701 (human) 3e-46 sex hormone-binding globulin measurement 17 7631360 7631361 Human 597244901 GWAS1340975_H testosterone measurement QTL GWAS1340975 (human) 3e-70 testosterone measurement serum testosterone level (CMO:0000568) 17 7633142 7633143 Human 597099498 GWAS1195572_H sex hormone-binding globulin measurement QTL GWAS1195572 (human) 5e-1586 sex hormone-binding globulin measurement 17 7631360 7631361 Human 597099497 GWAS1195571_H sex hormone-binding globulin measurement QTL GWAS1195571 (human) 4e-1795 sex hormone-binding globulin measurement 17 7630105 7630106 Human 597219615 GWAS1315689_H total cholesterol measurement QTL GWAS1315689 (human) 8e-14 total cholesterol measurement blood total cholesterol level (CMO:0000051) 17 7633142 7633143 Human 597172236 GWAS1268310_H diamine acetyltransferase 2 measurement QTL GWAS1268310 (human) 3e-282 diamine acetyltransferase 2 measurement 17 7623569 7623570 Human 597348366 GWAS1444440_H body fat percentage QTL GWAS1444440 (human) 1e-29 body fat mass (VT:0010482) body fat percentage (CMO:0000302) 17 7630424 7630425 Human 597348365 GWAS1444439_H body fat percentage QTL GWAS1444439 (human) 9e-20 body fat mass (VT:0010482) body fat percentage (CMO:0000302) 17 7630143 7630144 Human 597119488 GWAS1215562_H sex hormone-binding globulin measurement QTL GWAS1215562 (human) 1e-40 sex hormone-binding globulin measurement 17 7633269 7633270 Human 597189634 GWAS1285708_H testosterone measurement QTL GWAS1285708 (human) 1e-758 testosterone measurement serum testosterone level (CMO:0000568) 17 7630105 7630106 Human 597507584 GWAS1603658_H N6-acetyllysine measurement QTL GWAS1603658 (human) 4e-43 N6-acetyllysine measurement 17 7626584 7626585 Human 597096244 GWAS1192318_H sex hormone-binding globulin measurement QTL GWAS1192318 (human) 4e-1146 sex hormone-binding globulin measurement 17 7628647 7628648 Human 597340734 GWAS1436808_H bone fracture QTL GWAS1436808 (human) 0.0000005 bone fracture 17 7629697 7629698 Human 597348146 GWAS1444220_H body fat percentage QTL GWAS1444220 (human) 8e-201 body fat mass (VT:0010482) body fat percentage (CMO:0000302) 17 7628647 7628648 Human 597348147 GWAS1444221_H body fat percentage QTL GWAS1444221 (human) 6e-27 body fat mass (VT:0010482) body fat percentage (CMO:0000302) 17 7629797 7629798 Human 597348144 GWAS1444218_H body fat percentage QTL GWAS1444218 (human) 3e-19 body fat mass (VT:0010482) body fat percentage (CMO:0000302) 17 7627926 7627927 Human 597348145 GWAS1444219_H body fat percentage QTL GWAS1444219 (human) 2e-08 body fat mass (VT:0010482) body fat percentage (CMO:0000302) 17 7628516 7628517 Human 597348148 GWAS1444222_H body fat percentage QTL GWAS1444222 (human) 3e-19 body fat mass (VT:0010482) body fat percentage (CMO:0000302) 17 7630049 7630050 Human 597156646 GWAS1252720_H testosterone measurement QTL GWAS1252720 (human) 0.0000002 testosterone measurement serum testosterone level (CMO:0000568) 17 7629697 7629698 Human 597348143 GWAS1444217_H body fat percentage QTL GWAS1444217 (human) 1e-08 body fat mass (VT:0010482) body fat percentage (CMO:0000302) 17 7622999 7623000 Human 597107243 GWAS1203317_H testosterone measurement QTL GWAS1203317 (human) 8e-23 testosterone measurement serum testosterone level (CMO:0000568) 17 7630105 7630106 Human 597190694 GWAS1286768_H testosterone measurement QTL GWAS1286768 (human) 3e-38 testosterone measurement serum testosterone level (CMO:0000568) 17 7631360 7631361 Human 597279071 GWAS1375145_H testosterone measurement QTL GWAS1375145 (human) 1e-300 testosterone measurement serum testosterone level (CMO:0000568) 17 7630105 7630106 Human 597159262 GWAS1255336_H testosterone measurement QTL GWAS1255336 (human) 2e-12 testosterone measurement serum testosterone level (CMO:0000568) 17 7629697 7629698 Human 597127518 GWAS1223592_H estradiol measurement QTL GWAS1223592 (human) 9e-11 estradiol measurement blood estradiol level (CMO:0000513) 17 7629697 7629698 Human 597120089 GWAS1216163_H heel bone mineral density QTL GWAS1216163 (human) 4e-21 heel bone mineral density bone mineral density (CMO:0001226) 17 7631360 7631361 Human 597183054 GWAS1279128_H sex hormone-binding globulin measurement QTL GWAS1279128 (human) 8e-14 sex hormone-binding globulin measurement 17 7624628 7624629 Human 597183055 GWAS1279129_H sex hormone-binding globulin measurement QTL GWAS1279129 (human) 4e-48 sex hormone-binding globulin measurement 17 7630105 7630106 Human 597098318 GWAS1194392_H testosterone measurement QTL GWAS1194392 (human) 2e-424 testosterone measurement serum testosterone level (CMO:0000568) 17 7630105 7630106 Human 597098319 GWAS1194393_H testosterone measurement QTL GWAS1194393 (human) 5e-170 testosterone measurement serum testosterone level (CMO:0000568) 17 7631360 7631361 Human 597192005 GWAS1288079_H sex hormone-binding globulin measurement QTL GWAS1288079 (human) 2e-1854 sex hormone-binding globulin measurement 17 7630105 7630106 Human 597107572 GWAS1203646_H testosterone measurement QTL GWAS1203646 (human) 5e-169 testosterone measurement serum testosterone level (CMO:0000568) 17 7630105 7630106 Human 597328510 GWAS1424584_H N6-acetyllysine measurement QTL GWAS1424584 (human) 1e-11 N6-acetyllysine measurement 17 7626953 7626954 Human 597530229 GWAS1626303_H N6-acetyllysine measurement QTL GWAS1626303 (human) 6e-80 N6-acetyllysine measurement 17 7626584 7626585 Human 597503095 GWAS1599169_H N6-acetyllysine measurement QTL GWAS1599169 (human) 9e-176 N6-acetyllysine measurement 17 7626584 7626585 Human 597349744 GWAS1445818_H body fat percentage QTL GWAS1445818 (human) 1e-224 body fat mass (VT:0010482) body fat percentage (CMO:0000302) 17 7630105 7630106 Human 597106044 GWAS1202118_H sex hormone-binding globulin measurement QTL GWAS1202118 (human) 2e-1533 sex hormone-binding globulin measurement 17 7628647 7628648 Human 597504625 GWAS1600699_H N6-acetyllysine measurement QTL GWAS1600699 (human) 5e-80 N6-acetyllysine measurement 17 7626584 7626585 Human 597111674 GWAS1207748_H heel bone mineral density QTL GWAS1207748 (human) 1e-16 heel bone mineral density bone mineral density (CMO:0001226) 17 7631360 7631361 Human 597523315 GWAS1619389_H diamine acetyltransferase 2 measurement QTL GWAS1619389 (human) 9e-253 diamine acetyltransferase 2 measurement 17 7626584 7626585 Human 597087096 GWAS1183170_H type 2 diabetes mellitus QTL GWAS1183170 (human) 1e-09 type 2 diabetes mellitus 17 7628647 7628648 Human 597279081 GWAS1375155_H testosterone measurement QTL GWAS1375155 (human) 3e-289 testosterone measurement serum testosterone level (CMO:0000568) 17 7629697 7629698 Human 597349742 GWAS1445816_H body fat percentage QTL GWAS1445816 (human) 6e-19 body fat mass (VT:0010482) body fat percentage (CMO:0000302) 17 7629797 7629798 Human 597349743 GWAS1445817_H body fat percentage QTL GWAS1445817 (human) 1e-14 body fat mass (VT:0010482) body fat percentage (CMO:0000302) 17 7630049 7630050 Human 597349740 GWAS1445814_H body fat percentage QTL GWAS1445814 (human) 3e-22 body fat mass (VT:0010482) body fat percentage (CMO:0000302) 17 7615707 7615708 Human 597349741 GWAS1445815_H body fat percentage QTL GWAS1445815 (human) 1e-17 body fat mass (VT:0010482) body fat percentage (CMO:0000302) 17 7627926 7627927 Human 596949612 GWAS1069131_H Red cell distribution width QTL GWAS1069131 (human) 7e-09 Red cell distribution width red blood cell distribution width- standard deviation (CMO:0003232) 17 7629707 7629708 Human 596963693 GWAS1083212_H type 2 diabetes mellitus QTL GWAS1083212 (human) 2e-09 type 2 diabetes mellitus 17 7629707 7629708 Human 597338976 GWAS1435050_H sexual dimorphism measurement QTL GWAS1435050 (human) 6e-10 sexual dimorphism measurement 17 7624628 7624629 Human
SHGC-35513
Human Assembly Chr Position (strand) Source JBrowse GRCh37 17 7,536,558 - 7,536,684 UniSTS GRCh37 Build 36 17 7,477,283 - 7,477,409 RGD NCBI36 Celera 17 7,562,975 - 7,563,101 RGD Cytogenetic Map 17 p13-p12 UniSTS HuRef 17 7,430,564 - 7,430,690 UniSTS Stanford-G3 RH Map 17 451.0 UniSTS Whitehead-RH Map 17 64.1 UniSTS NCBI RH Map 17 205.1 UniSTS GeneMap99-G3 RH Map 17 451.0 UniSTS
RH66154
Human Assembly Chr Position (strand) Source JBrowse GRCh37 17 7,529,598 - 7,529,739 UniSTS GRCh37 Build 36 17 7,470,323 - 7,470,464 RGD NCBI36 Celera 17 7,556,014 - 7,556,155 RGD Cytogenetic Map 17 p13.1 UniSTS Cytogenetic Map 17 p13-p12 UniSTS HuRef 17 7,423,628 - 7,423,769 UniSTS
PMC150924P1
Human Assembly Chr Position (strand) Source JBrowse GRCh37 17 7,534,457 - 7,534,739 UniSTS GRCh37 Build 36 17 7,475,182 - 7,475,464 RGD NCBI36 Celera 17 7,560,874 - 7,561,156 RGD Cytogenetic Map 17 p13-p12 UniSTS HuRef 17 7,428,463 - 7,428,745 UniSTS
RH18329
Human Assembly Chr Position (strand) Source JBrowse GRCh37 17 7,529,621 - 7,529,752 UniSTS GRCh37 Build 36 17 7,470,346 - 7,470,477 RGD NCBI36 Celera 17 7,556,037 - 7,556,168 RGD Cytogenetic Map 17 p13.1 UniSTS Cytogenetic Map 17 p13-p12 UniSTS HuRef 17 7,423,651 - 7,423,782 UniSTS GeneMap99-GB4 RH Map 17 48.53 UniSTS
SHGC-166
Human Assembly Chr Position (strand) Source JBrowse GRCh37 17 7,529,595 - 7,529,745 UniSTS GRCh37 Build 36 17 7,470,320 - 7,470,470 RGD NCBI36 Celera 17 7,556,011 - 7,556,161 RGD Cytogenetic Map 17 p13.1 UniSTS Cytogenetic Map 17 p13-p12 UniSTS HuRef 17 7,423,625 - 7,423,775 UniSTS TNG Radiation Hybrid Map 17 3956.0 UniSTS GeneMap99-G3 RH Map 17 451.0 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
entire extraembryonic component
1201
2406
2737
2178
4899
1723
2328
4
621
1458
464
2223
6712
5907
48
3707
841
1726
1595
169
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENST00000340624 ⟹ ENSP00000345675
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 17 7,627,969 - 7,633,382 (+) Ensembl
Ensembl Acc Id:
ENST00000380450 ⟹ ENSP00000369816
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 17 7,630,135 - 7,633,372 (+) Ensembl
Ensembl Acc Id:
ENST00000416273 ⟹ ENSP00000388867
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 17 7,630,152 - 7,633,372 (+) Ensembl
Ensembl Acc Id:
ENST00000441599 ⟹ ENSP00000393426
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 17 7,630,094 - 7,633,382 (+) Ensembl
Ensembl Acc Id:
ENST00000570353 ⟹ ENSP00000458199
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 17 7,630,152 - 7,633,372 (+) Ensembl
Ensembl Acc Id:
ENST00000570527 ⟹ ENSP00000461162
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 17 7,630,152 - 7,633,372 (+) Ensembl
Ensembl Acc Id:
ENST00000570547 ⟹ ENSP00000458875
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 17 7,614,064 - 7,633,354 (+) Ensembl
Ensembl Acc Id:
ENST00000571153 ⟹ ENSP00000458858
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 17 7,630,254 - 7,633,354 (+) Ensembl
Ensembl Acc Id:
ENST00000572182 ⟹ ENSP00000458816
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 17 7,614,064 - 7,633,354 (+) Ensembl
Ensembl Acc Id:
ENST00000572262 ⟹ ENSP00000459999
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 17 7,614,064 - 7,633,354 (+) Ensembl
Ensembl Acc Id:
ENST00000574539 ⟹ ENSP00000458181
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 17 7,614,064 - 7,633,354 (+) Ensembl
Ensembl Acc Id:
ENST00000575314 ⟹ ENSP00000458559
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 17 7,614,064 - 7,633,354 (+) Ensembl
Ensembl Acc Id:
ENST00000575618 ⟹ ENSP00000459826
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 17 7,630,254 - 7,633,354 (+) Ensembl
Ensembl Acc Id:
ENST00000575729 ⟹ ENSP00000458719
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 17 7,627,969 - 7,631,260 (+) Ensembl
Ensembl Acc Id:
ENST00000575903 ⟹ ENSP00000458973
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 17 7,630,152 - 7,633,372 (+) Ensembl
Ensembl Acc Id:
ENST00000576152 ⟹ ENSP00000461743
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 17 7,630,254 - 7,633,354 (+) Ensembl
Ensembl Acc Id:
ENST00000576478 ⟹ ENSP00000461133
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 17 7,614,064 - 7,633,354 (+) Ensembl
Ensembl Acc Id:
ENST00000576728 ⟹ ENSP00000459620
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 17 7,614,064 - 7,633,354 (+) Ensembl
Ensembl Acc Id:
ENST00000576747
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 17 7,631,309 - 7,632,057 (+) Ensembl
Ensembl Acc Id:
ENST00000576830 ⟹ ENSP00000460219
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 17 7,630,254 - 7,633,354 (+) Ensembl
Ensembl Acc Id:
ENST00000624152
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 17 7,613,946 - 7,614,109 (+) Ensembl
RefSeq Acc Id:
NM_001040 ⟹ NP_001031
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 17 7,630,135 - 7,633,372 (+) NCBI GRCh37 17 7,517,382 - 7,536,700 (+) ENTREZGENE Build 36 17 7,474,216 - 7,477,395 (+) NCBI Archive HuRef 17 7,411,426 - 7,430,708 (+) NCBI CHM1_1 17 7,542,593 - 7,545,882 (+) NCBI T2T-CHM13v2.0 17 7,534,326 - 7,537,563 (+) NCBI
Sequence:
AAGAGTTGTCTGAGCCGCCGAGTGGACAGTGGCTGATTATGGAGAGCAGAGGCCCACTGGCTACCTCGCGCCTGCTGCTGTTGCTGCTGTTGCTACTACTGCGTCACACCCGCCAGGGATGGGCCCTG
hide sequence
RefSeq Acc Id:
NM_001146279 ⟹ NP_001139751
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 17 7,630,135 - 7,633,372 (+) NCBI GRCh37 17 7,517,382 - 7,536,700 (+) ENTREZGENE HuRef 17 7,411,426 - 7,430,708 (+) NCBI CHM1_1 17 7,542,593 - 7,545,882 (+) NCBI T2T-CHM13v2.0 17 7,534,326 - 7,537,563 (+) NCBI
Sequence:
AAGAGTTGTCTGAGCCGCCGAGTGGACAGTGGCTGATTATGGAGAGCAGAGGCCCACTGGCTACCTCGCGCCTGCTGCTGTTGCTGCTGTTGCTACTACTGCGTCACACCCGCCAGGGATGGGCCCTG
hide sequence
RefSeq Acc Id:
NM_001146280 ⟹ NP_001139752
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 17 7,630,135 - 7,633,372 (+) NCBI GRCh37 17 7,517,382 - 7,536,700 (+) ENTREZGENE HuRef 17 7,411,426 - 7,430,708 (+) NCBI CHM1_1 17 7,542,593 - 7,545,882 (+) NCBI T2T-CHM13v2.0 17 7,534,326 - 7,537,563 (+) NCBI
Sequence:
AAGAGTTGTCTGAGCCGCCGAGTGGACAGTGGCTGATTATGGAGAGCAGAGGCCCACTGGCTAC
hide sequence
RefSeq Acc Id:
NM_001146281 ⟹ NP_001139753
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 17 7,630,135 - 7,633,372 (+) NCBI GRCh37 17 7,517,382 - 7,536,700 (+) ENTREZGENE HuRef 17 7,411,426 - 7,430,708 (+) NCBI CHM1_1 17 7,542,593 - 7,545,882 (+) NCBI T2T-CHM13v2.0 17 7,534,326 - 7,537,563 (+) NCBI
Sequence:
AAGAGTTGTCTGAGCCGCCGAGTGGACAGTGGCTGATTATGGAGAGCAGAGGCCCACTGGCTACCTCGCGCCTGCTGCTGTTGCTGCTGTTGCTACTACTGCGTCACACCCGCCAGGGATGGGCCCTG
hide sequence
RefSeq Acc Id:
NM_001289113 ⟹ NP_001276042
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 17 7,627,561 - 7,633,372 (+) NCBI HuRef 17 7,411,426 - 7,430,708 (+) NCBI CHM1_1 17 7,540,468 - 7,545,882 (+) NCBI T2T-CHM13v2.0 17 7,531,762 - 7,537,563 (+) NCBI
Sequence:
AGTCTTCACCCGAATCAGCCTCAGGATATCTCCACAGTCTCCCTCCTTGGCCTCTCGGATCCGC
hide sequence
RefSeq Acc Id:
NM_001289114 ⟹ NP_001276043
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 17 7,614,064 - 7,633,372 (+) NCBI HuRef 17 7,411,426 - 7,430,708 (+) NCBI CHM1_1 17 7,526,291 - 7,545,882 (+) NCBI T2T-CHM13v2.0 17 7,518,285 - 7,537,563 (+) NCBI
Sequence:
AATTCTCCATGTGCTTGGATCGTGGGGAAGATGTGATTAAGGTCTAAGTGCCCACGACCCTCCGGCTGTCCACCTCAGCAATGGCCCAGGACAAGAGCCTATCGCTGTCATGACCTTTGACCTCACCA
hide sequence
RefSeq Acc Id:
NM_001289115 ⟹ NP_001276044
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 17 7,627,561 - 7,633,372 (+) NCBI HuRef 17 7,411,426 - 7,430,708 (+) NCBI CHM1_1 17 7,540,468 - 7,545,882 (+) NCBI T2T-CHM13v2.0 17 7,531,762 - 7,537,563 (+) NCBI
Sequence:
AGTCTTCACCCGAATCAGCCTCAGGATATCTCCACAGTCTCCCTCCTTGGCCTCTCGGATCCGC
hide sequence
RefSeq Acc Id:
NM_001289116 ⟹ NP_001276045
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 17 7,630,135 - 7,633,372 (+) NCBI HuRef 17 7,411,426 - 7,430,708 (+) NCBI CHM1_1 17 7,542,593 - 7,545,882 (+) NCBI T2T-CHM13v2.0 17 7,534,326 - 7,537,563 (+) NCBI
Sequence:
AAGAGTTGTCTGAGCCGCCGAGTGGACAGTGGCTGATTATGGAGAGCAGAGGCCCACTGGCTAC
hide sequence
RefSeq Acc Id:
NP_001031 ⟸ NM_001040
- Peptide Label:
isoform 1 precursor
- UniProtKB:
Q3MIL0 (UniProtKB/Swiss-Prot), Q16616 (UniProtKB/Swiss-Prot), P14689 (UniProtKB/Swiss-Prot), I3L1N7 (UniProtKB/Swiss-Prot), F5H5Z8 (UniProtKB/Swiss-Prot), E9PGW1 (UniProtKB/Swiss-Prot), B4DYU0 (UniProtKB/Swiss-Prot), B0FWH4 (UniProtKB/Swiss-Prot), Q6ISD2 (UniProtKB/Swiss-Prot), P04278 (UniProtKB/Swiss-Prot)
- Sequence:
MESRGPLATSRLLLLLLLLLLRHTRQGWALRPVLPTQSAHDPPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGR
hide sequence
RefSeq Acc Id:
NP_001139752 ⟸ NM_001146280
- Peptide Label:
isoform 3 precursor
- UniProtKB:
P04278 (UniProtKB/Swiss-Prot), B0FWH2 (UniProtKB/TrEMBL)
- Sequence:
MESRGPLATSRLLLLLLLLLLRHTRQGWALRPVLPTQSAHDPPAVHLSNGPGQEPIAVMTFDLT
hide sequence
RefSeq Acc Id:
NP_001139753 ⟸ NM_001146281
- Peptide Label:
isoform 4 precursor
- UniProtKB:
A0A0C4DGN2 (UniProtKB/TrEMBL)
- Sequence:
MESRGPLATSRLLLLLLLLLLRHTRQGWALRPVLPTQSAHDPPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGR
hide sequence
RefSeq Acc Id:
NP_001139751 ⟸ NM_001146279
- Peptide Label:
isoform 2 precursor
- UniProtKB:
P04278 (UniProtKB/Swiss-Prot), B0FWH2 (UniProtKB/TrEMBL)
- Sequence:
MESRGPLATSRLLLLLLLLLLRHTRQGWALRPVLPTQSAHDPPAVHLSNGPGQEPIAVMTFDLT
hide sequence
RefSeq Acc Id:
NP_001276043 ⟸ NM_001289114
- Peptide Label:
isoform 5
- UniProtKB:
I3L145 (UniProtKB/TrEMBL), I3L2X4 (UniProtKB/TrEMBL)
- Sequence:
MTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGP
hide sequence
RefSeq Acc Id:
NP_001276042 ⟸ NM_001289113
- Peptide Label:
isoform 5
- UniProtKB:
I3L145 (UniProtKB/TrEMBL), I3L2X4 (UniProtKB/TrEMBL)
- Sequence:
MTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGP
hide sequence
RefSeq Acc Id:
NP_001276044 ⟸ NM_001289115
- Peptide Label:
isoform 6
- UniProtKB:
P04278 (UniProtKB/Swiss-Prot), B4DYU0 (UniProtKB/TrEMBL)
- Sequence:
MTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGP
hide sequence
RefSeq Acc Id:
NP_001276045 ⟸ NM_001289116
- Peptide Label:
isoform 7
- UniProtKB:
P04278 (UniProtKB/Swiss-Prot), B0FWH2 (UniProtKB/TrEMBL)
- Sequence:
MGIPTLRMTGLCWDFETAGLRSNCTITGPSLRWVLRLRQVSGPLTSKRHPIMRIALGGLLFPAS
hide sequence
Ensembl Acc Id:
ENSP00000458199 ⟸ ENST00000570353
Ensembl Acc Id:
ENSP00000461162 ⟸ ENST00000570527
Ensembl Acc Id:
ENSP00000458875 ⟸ ENST00000570547
Ensembl Acc Id:
ENSP00000458858 ⟸ ENST00000571153
Ensembl Acc Id:
ENSP00000458816 ⟸ ENST00000572182
Ensembl Acc Id:
ENSP00000459999 ⟸ ENST00000572262
Ensembl Acc Id:
ENSP00000388867 ⟸ ENST00000416273
Ensembl Acc Id:
ENSP00000393426 ⟸ ENST00000441599
Ensembl Acc Id:
ENSP00000458181 ⟸ ENST00000574539
Ensembl Acc Id:
ENSP00000459826 ⟸ ENST00000575618
Ensembl Acc Id:
ENSP00000458559 ⟸ ENST00000575314
Ensembl Acc Id:
ENSP00000458973 ⟸ ENST00000575903
Ensembl Acc Id:
ENSP00000458719 ⟸ ENST00000575729
Ensembl Acc Id:
ENSP00000461133 ⟸ ENST00000576478
Ensembl Acc Id:
ENSP00000461743 ⟸ ENST00000576152
Ensembl Acc Id:
ENSP00000460219 ⟸ ENST00000576830
Ensembl Acc Id:
ENSP00000459620 ⟸ ENST00000576728
Ensembl Acc Id:
ENSP00000345675 ⟸ ENST00000340624
Ensembl Acc Id:
ENSP00000369816 ⟸ ENST00000380450
RGD ID: 6794512 Promoter ID: HG_KWN:24902 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: CD4+TCell, CD4+TCell_12Hour, HeLa_S3, K562, Lymphoblastoid Transcripts: ENST00000340624, ENST00000380466, NM_133491, NR_027462, UC010CMV.1, UC010CMW.1, UC010CMX.1, UC010CMZ.1 Position: Human Assembly Chr Position (strand) Source Build 36 17 7,471,616 - 7,472,116 (-) MPROMDB
RGD ID: 7233811 Promoter ID: EPDNEW_H22650 Type: initiation region Name: SHBG_2 Description: sex hormone binding globulin SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_H22653 EPDNEW_H22654 Experiment Methods: Single-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 17 7,614,032 - 7,614,092 EPDNEW
RGD ID: 7233813 Promoter ID: EPDNEW_H22653 Type: initiation region Name: SHBG_3 Description: sex hormone binding globulin SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_H22650 EPDNEW_H22654 Experiment Methods: Single-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 17 7,627,994 - 7,628,054 EPDNEW
RGD ID: 7233817 Promoter ID: EPDNEW_H22654 Type: initiation region Name: SHBG_1 Description: sex hormone binding globulin SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_H22650 EPDNEW_H22653 Experiment Methods: Single-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 17 7,630,135 - 7,630,195 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-04-12
SHBG
sex hormone binding globulin
SHBG
sex hormone-binding globulin
Symbol and/or name change
5135510 APPROVED
