Symbol:
Ppp3r1
Name:
protein phosphatase 3, regulatory subunit B, alpha isoform (calcineurin B, type I)
RGD ID:
735592
MGI Page
MGI
Description:
Enables phosphatase binding activity and phosphoprotein phosphatase activity. Involved in postsynaptic modulation of chemical synaptic transmission; regulation of postsynaptic neurotransmitter receptor internalization; and regulation of synaptic vesicle cycle. Acts upstream of or within several processes, including calcineurin-NFAT signaling cascade; circulatory system development; and myelination in peripheral nervous system. Located in sarcolemma. Part of calcineurin complex. Is active in several cellular components, including Schaffer collateral - CA1 synapse; hippocampal mossy fiber to CA3 synapse; and parallel fiber to Purkinje cell synapse. Is expressed in brain; heart; jaw skeleton; lung; and tooth. Used to study dilated cardiomyopathy and schizophrenia. Human ortholog(s) of this gene implicated in Alzheimer's disease and dilated cardiomyopathy. Orthologous to human PPP3R1 (protein phosphatase 3 regulatory subunit B, alpha).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
calcineurin subunit B type 1; CaN; CaNB1; Cnb; Cnb1; MCIP1; PP2B beta 1; protein phosphatase 2B regulatory subunit 1; protein phosphatase 3 regulatory subunit B alpha
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PPP3R1 (protein phosphatase 3 regulatory subunit B, alpha) HGNC
EggNOG, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Ppp3r1 (protein phosphatase 3, regulatory subunit B, alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Ppp3r1 (protein phosphatase 3 regulatory subunit B, alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PPP3R1 (protein phosphatase 3 regulatory subunit B, alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PPP3R1 (protein phosphatase 3 regulatory subunit B, alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Ppp3r1 (protein phosphatase 3 regulatory subunit B, alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PPP3R1 (protein phosphatase 3 regulatory subunit B, alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PPP3R1 (protein phosphatase 3 regulatory subunit B, alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Ppp3r1 (protein phosphatase 3 regulatory subunit B, alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
PPP3R2 (protein phosphatase 3 regulatory subunit B, beta) HGNC
OrthoDB, Treefam
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Ppp3r1 (protein phosphatase 3, regulatory subunit B, alpha)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
PPP3R1 (protein phosphatase 3 regulatory subunit B, alpha)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
ppp3r1a (protein phosphatase 3, regulatory subunit B, alpha a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA|PANTHER|ZFIN)
Danio rerio (zebrafish):
ppp3r1b (protein phosphatase 3 (formerly 2B), regulatory s1ubunit B, alpha isoform, b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Saccharomyces cerevisiae (baker's yeast):
CNB1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CanB
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CanB2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
cnb-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
ppp3r1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 17,109,298 - 17,150,380 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 17,109,263 - 17,150,375 (+) Ensembl GRCm39 Ensembl GRCm38 11 17,159,298 - 17,200,380 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 17,159,263 - 17,200,375 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 17,059,301 - 17,100,383 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 17,059,301 - 17,100,383 (+) NCBI MGSCv36 mm8 Celera 11 17,532,396 - 17,574,044 (+) NCBI Celera Cytogenetic Map 11 A2 NCBI cM Map 11 9.71 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ppp3r1 Mouse (+)-pilocarpine decreases expression ISO RGD:69230 6480464 Pilocarpine results in decreased expression of PPP3R1 mRNA CTD PMID:14656328 Ppp3r1 Mouse (S)-nicotine decreases expression EXP 6480464 Nicotine results in decreased expression of PPP3R1 mRNA CTD PMID:21955143 Ppp3r1 Mouse 1,2-dimethylhydrazine multiple interactions EXP 6480464 Folic Acid inhibits the reaction [1,2-Dimethylhydrazine results in decreased expression of PPP3R1 mRNA] CTD PMID:22206623 Ppp3r1 Mouse 1,2-dimethylhydrazine decreases expression EXP 6480464 1,2-Dimethylhydrazine results in decreased expression of PPP3R1 mRNA CTD PMID:22206623 Ppp3r1 Mouse 1,3-dinitrobenzene increases expression ISO RGD:69230 6480464 3-dinitrobenzene results in increased expression of PPP3R1 mRNA CTD PMID:21983209 Ppp3r1 Mouse 17alpha-ethynylestradiol affects expression EXP 6480464 Ethinyl Estradiol affects the expression of PPP3R1 mRNA CTD PMID:17555576 Ppp3r1 Mouse 17beta-estradiol affects expression ISO RGD:1350432 6480464 Estradiol affects the expression of PPP3R1 mRNA CTD PMID:22574217 Ppp3r1 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of PPP3R1 mRNA CTD PMID:19770486 Ppp3r1 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:69230 6480464 Tetrachlorodibenzodioxin results in increased expression of PPP3R1 mRNA CTD PMID:34747641 Ppp3r1 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:69230 6480464 Tetrachlorodibenzodioxin affects the expression of PPP3R1 mRNA CTD PMID:32109520 Ppp3r1 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of PPP3R1 mRNA CTD PMID:21570461 Ppp3r1 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:69230 6480464 Tetrachlorodibenzodioxin results in decreased expression of PPP3R1 mRNA CTD PMID:21215274|PMID:33387578 Ppp3r1 Mouse 2,3,7,8-Tetrachlorodibenzofuran decreases expression ISO RGD:69230 6480464 2,3,7,8-tetrachlorodibenzofuran results in decreased expression of PPP3R1 mRNA CTD PMID:32109520 Ppp3r1 Mouse 2,4-dinitrotoluene affects expression ISO RGD:69230 6480464 2,4-dinitrotoluene affects the expression of PPP3R1 mRNA CTD PMID:21346803 Ppp3r1 Mouse 2-hydroxypropanoic acid increases expression ISO RGD:1350432 6480464 Lactic Acid results in increased expression of PPP3R1 mRNA CTD PMID:30851411 Ppp3r1 Mouse 2-methylcholine affects expression ISO RGD:1350432 6480464 beta-methylcholine affects the expression of PPP3R1 mRNA CTD PMID:21179406 Ppp3r1 Mouse 3,4-methylenedioxymethamphetamine increases expression EXP 6480464 N-Methyl-3,4-methylenedioxyamphetamine results in increased expression of PPP3R1 mRNA CTD PMID:19285098|PMID:20188158 Ppp3r1 Mouse 3,4-methylenedioxymethamphetamine decreases expression EXP 6480464 N-Methyl-3,4-methylenedioxyamphetamine results in decreased expression of PPP3R1 mRNA CTD PMID:26251327 Ppp3r1 Mouse 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO RGD:1350432 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ... CTD PMID:28628672 Ppp3r1 Mouse 4,4'-diaminodiphenylmethane increases expression EXP 6480464 4,4'-diaminodiphenylmethane results in increased expression of PPP3R1 mRNA CTD PMID:18648102 Ppp3r1 Mouse 4,4'-sulfonyldiphenol multiple interactions ISO RGD:1350432 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ... CTD PMID:28628672 Ppp3r1 Mouse 4-vinylcyclohexene dioxide affects expression EXP 6480464 4-vinyl-1-cyclohexene dioxide affects the expression of PPP3R1 mRNA CTD PMID:20829426 Ppp3r1 Mouse 6-propyl-2-thiouracil decreases expression ISO RGD:69230 6480464 Propylthiouracil results in decreased expression of PPP3R1 mRNA CTD PMID:24780913 Ppp3r1 Mouse acrylamide increases expression ISO RGD:1350432 6480464 Acrylamide results in increased expression of PPP3R1 mRNA CTD PMID:32763439 Ppp3r1 Mouse aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of PPP3R1 mRNA CTD PMID:19770486 Ppp3r1 Mouse aflatoxin B1 decreases methylation ISO RGD:1350432 6480464 Aflatoxin B1 results in decreased methylation of PPP3R1 gene CTD PMID:27153756 Ppp3r1 Mouse aflatoxin M1 decreases expression ISO RGD:1350432 6480464 Aflatoxin M1 results in decreased expression of PPP3R1 mRNA CTD PMID:30928695 Ppp3r1 Mouse amiodarone increases expression ISO RGD:1350432 6480464 Amiodarone results in increased expression of PPP3R1 mRNA CTD PMID:19774075 Ppp3r1 Mouse ammonium chloride affects expression ISO RGD:69230 6480464 Ammonium Chloride affects the expression of PPP3R1 mRNA CTD PMID:16483693 Ppp3r1 Mouse aristolochic acid A decreases expression ISO RGD:1350432 6480464 aristolochic acid I results in decreased expression of PPP3R1 mRNA CTD PMID:33212167 Ppp3r1 Mouse atrazine increases expression ISO RGD:1350432 6480464 Atrazine results in increased expression of PPP3R1 mRNA CTD PMID:22378314 Ppp3r1 Mouse bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of PPP3R1 mRNA CTD PMID:33162236 Ppp3r1 Mouse bisphenol A affects expression ISO RGD:69230 6480464 bisphenol A affects the expression of PPP3R1 mRNA CTD PMID:25181051 Ppp3r1 Mouse bisphenol A multiple interactions ISO RGD:1350432 6480464 [[ginger extract results in increased abundance of Oils, Volatile] which co-treated with bisphenol A] affects more ... CTD PMID:33376534 Ppp3r1 Mouse bisphenol F increases expression EXP 6480464 bisphenol F results in increased expression of PPP3R1 mRNA CTD PMID:38685157 Ppp3r1 Mouse bortezomib decreases expression ISO RGD:1350432 6480464 Bortezomib results in decreased expression of PPP3R1 mRNA CTD PMID:20977926 Ppp3r1 Mouse Brodifacoum increases expression ISO RGD:69230 6480464 bromfenacoum results in increased expression of PPP3R1 protein CTD PMID:28903499 Ppp3r1 Mouse cadmium atom multiple interactions ISO RGD:1350432 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of PPP3R1 more ... CTD PMID:35301059 Ppp3r1 Mouse cadmium dichloride multiple interactions ISO RGD:1350432 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of PPP3R1 more ... CTD PMID:35301059 Ppp3r1 Mouse calcidiol decreases expression ISO RGD:69230 6480464 Calcifediol deficiency results in decreased expression of PPP3R1 mRNA CTD PMID:17293106 Ppp3r1 Mouse calcium atom multiple interactions EXP 6480464 PPP3R1 gene mutant form inhibits the reaction [ATP2A2 protein affects the transport of Calcium]; PPP3R1 more ... CTD PMID:19700627 Ppp3r1 Mouse calcium atom affects response to substance EXP 6480464 PPP3R1 gene mutant form affects the susceptibility to Calcium CTD PMID:19700627 Ppp3r1 Mouse calcium(0) multiple interactions EXP 6480464 PPP3R1 gene mutant form inhibits the reaction [ATP2A2 protein affects the transport of Calcium]; PPP3R1 more ... CTD PMID:19700627 Ppp3r1 Mouse calcium(0) affects response to substance EXP 6480464 PPP3R1 gene mutant form affects the susceptibility to Calcium CTD PMID:19700627 Ppp3r1 Mouse cannabidiol decreases expression EXP 6480464 Cannabidiol results in decreased expression of PPP3R1 mRNA CTD PMID:33019509 Ppp3r1 Mouse cannabigerol decreases expression EXP 6480464 cannabigerol results in decreased expression of PPP3R1 mRNA CTD PMID:33019509 Ppp3r1 Mouse CGP 52608 multiple interactions ISO RGD:1350432 6480464 CGP 52608 promotes the reaction [RORA protein binds to PPP3R1 gene] CTD PMID:28238834 Ppp3r1 Mouse chromium(6+) affects expression EXP 6480464 chromium hexavalent ion affects the expression of PPP3R1 mRNA CTD PMID:28472532 Ppp3r1 Mouse copper atom multiple interactions ISO RGD:1350432 6480464 [Chelating Agents binds to Copper] which results in increased expression of PPP3R1 mRNA CTD PMID:30911355 Ppp3r1 Mouse copper(0) multiple interactions ISO RGD:1350432 6480464 [Chelating Agents binds to Copper] which results in increased expression of PPP3R1 mRNA CTD PMID:30911355 Ppp3r1 Mouse copper(II) sulfate increases expression ISO RGD:1350432 6480464 Copper Sulfate results in increased expression of PPP3R1 mRNA CTD PMID:19549813 Ppp3r1 Mouse Cuprizon decreases expression ISO RGD:69230 6480464 Cuprizone results in decreased expression of PPP3R1 mRNA CTD PMID:26577399 Ppp3r1 Mouse cyclosporin A decreases expression ISO RGD:69230 6480464 Cyclosporine results in decreased expression of PPP3R1 mRNA CTD PMID:18344631 Ppp3r1 Mouse DDE increases expression ISO RGD:1350432 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of PPP3R1 mRNA CTD PMID:38568856 Ppp3r1 Mouse dexamethasone multiple interactions ISO RGD:1350432 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ... CTD PMID:28628672 Ppp3r1 Mouse dorsomorphin multiple interactions ISO RGD:1350432 6480464 [NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Ppp3r1 Mouse doxorubicin decreases expression ISO RGD:1350432 6480464 Doxorubicin results in decreased expression of PPP3R1 mRNA CTD PMID:29803840 Ppp3r1 Mouse endosulfan increases expression ISO RGD:69230 6480464 Endosulfan results in increased expression of PPP3R1 mRNA CTD PMID:31464424 Ppp3r1 Mouse ethanol decreases expression ISO RGD:69230 6480464 Ethanol results in decreased expression of PPP3R1 mRNA CTD PMID:20655511 Ppp3r1 Mouse ethanol increases expression EXP 6480464 Ethanol results in increased expression of PPP3R1 mRNA CTD PMID:30319688 Ppp3r1 Mouse ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of PPP3R1 mRNA CTD PMID:21955143 Ppp3r1 Mouse fenvalerate increases expression ISO RGD:69230 6480464 fenvalerate results in increased expression of PPP3R1 mRNA CTD PMID:30307764 Ppp3r1 Mouse flutamide increases expression ISO RGD:69230 6480464 Flutamide results in increased expression of PPP3R1 mRNA CTD PMID:24136188 Ppp3r1 Mouse folic acid multiple interactions EXP 6480464 Folic Acid inhibits the reaction [1,2-Dimethylhydrazine results in decreased expression of PPP3R1 mRNA] CTD PMID:22206623 Ppp3r1 Mouse GSK-J4 increases expression ISO RGD:1350432 6480464 GSK-J4 results in increased expression of PPP3R1 mRNA CTD PMID:29301935 Ppp3r1 Mouse indometacin multiple interactions ISO RGD:1350432 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ... CTD PMID:28628672 Ppp3r1 Mouse ivermectin decreases expression ISO RGD:1350432 6480464 Ivermectin results in decreased expression of PPP3R1 protein CTD PMID:32959892 Ppp3r1 Mouse lead diacetate increases expression ISO RGD:69230 6480464 lead acetate results in increased expression of PPP3R1 mRNA CTD PMID:11578147 Ppp3r1 Mouse lithium chloride increases expression ISO RGD:1350432 6480464 Lithium Chloride results in increased expression of PPP3R1 mRNA CTD PMID:15711924 Ppp3r1 Mouse methamphetamine affects expression ISO RGD:69230 6480464 Methamphetamine affects the expression of PPP3R1 protein CTD PMID:17904249 Ppp3r1 Mouse methoxychlor affects expression EXP 6480464 Methoxychlor affects the expression of PPP3R1 mRNA CTD PMID:20829426 Ppp3r1 Mouse methylmercury chloride increases expression ISO RGD:1350432 6480464 methylmercuric chloride results in increased expression of PPP3R1 mRNA CTD PMID:23179753|PMID:26272509 Ppp3r1 Mouse methylmercury chloride decreases expression ISO RGD:1350432 6480464 methylmercuric chloride results in decreased expression of PPP3R1 mRNA CTD PMID:23179753|PMID:27188386 Ppp3r1 Mouse methylmercury chloride multiple interactions ISO RGD:1350432 6480464 [NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Ppp3r1 Mouse miconazole decreases expression EXP 6480464 Miconazole results in decreased expression of PPP3R1 mRNA CTD PMID:27462272 Ppp3r1 Mouse monosodium L-glutamate increases expression EXP 6480464 Sodium Glutamate results in increased expression of PPP3R1 mRNA CTD PMID:22078008 Ppp3r1 Mouse monosodium L-glutamate multiple interactions EXP 6480464 [Trans Fatty Acids co-treated with Sodium Glutamate] results in increased expression of PPP3R1 mRNA CTD PMID:22078008 Ppp3r1 Mouse morphine increases expression EXP 6480464 Morphine deficiency results in increased expression of PPP3R1 mRNA; Morphine results in increased expression of more ... CTD PMID:21955143|PMID:27126842 Ppp3r1 Mouse nefazodone increases expression ISO RGD:69230 6480464 nefazodone results in increased expression of PPP3R1 mRNA CTD PMID:24136188 Ppp3r1 Mouse nickel atom increases expression ISO RGD:1350432 6480464 Nickel results in increased expression of PPP3R1 mRNA CTD PMID:24768652|PMID:25583101 Ppp3r1 Mouse nicotine decreases expression EXP 6480464 Nicotine results in decreased expression of PPP3R1 mRNA CTD PMID:21955143 Ppp3r1 Mouse nitrates multiple interactions EXP 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of PPP3R1 more ... CTD PMID:35964746 Ppp3r1 Mouse O-palmitoylcarnitine decreases metabolic processing EXP 6480464 PPP3R1 gene mutant form results in decreased metabolism of Palmitoylcarnitine CTD PMID:19700627 Ppp3r1 Mouse ochratoxin A increases expression ISO RGD:69230 6480464 ochratoxin A results in increased expression of PPP3R1 mRNA CTD PMID:23358140 Ppp3r1 Mouse okadaic acid increases expression ISO RGD:1350432 6480464 Okadaic Acid results in increased expression of PPP3R1 mRNA CTD PMID:38832940 Ppp3r1 Mouse perfluorooctane-1-sulfonic acid increases expression ISO RGD:69230 6480464 perfluorooctane sulfonic acid results in increased expression of PPP3R1 mRNA CTD PMID:20136073 Ppp3r1 Mouse perindopril decreases expression ISO RGD:69230 6480464 Perindopril results in decreased expression of PPP3R1 mRNA CTD PMID:18344631 Ppp3r1 Mouse potassium dichromate increases expression ISO RGD:1350432 6480464 Potassium Dichromate results in increased expression of PPP3R1 mRNA CTD PMID:11678601 Ppp3r1 Mouse quercetin multiple interactions ISO RGD:1350432 6480464 Quercetin results in decreased activity of [PPP3CA protein binds to PPP3R1 protein] CTD PMID:19880376 Ppp3r1 Mouse quinolin-8-ol decreases expression ISO RGD:1350432 6480464 Oxyquinoline results in decreased expression of PPP3R1 mRNA CTD PMID:21632981 Ppp3r1 Mouse rac-lactic acid increases expression ISO RGD:1350432 6480464 Lactic Acid results in increased expression of PPP3R1 mRNA CTD PMID:30851411 Ppp3r1 Mouse rotenone increases expression ISO RGD:69230 6480464 Rotenone results in increased expression of PPP3R1 mRNA CTD PMID:27900601 Ppp3r1 Mouse SB 431542 multiple interactions ISO RGD:1350432 6480464 [NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Ppp3r1 Mouse silicon dioxide decreases expression EXP 6480464 Silicon Dioxide results in decreased expression of PPP3R1 mRNA CTD PMID:19073995 Ppp3r1 Mouse sodium arsenite increases expression ISO RGD:1350432 6480464 sodium arsenite results in increased expression of PPP3R1 mRNA CTD PMID:38568856 Ppp3r1 Mouse tamoxifen affects expression EXP 6480464 Tamoxifen affects the expression of PPP3R1 mRNA CTD PMID:17555576 Ppp3r1 Mouse tetrachloromethane decreases expression ISO RGD:69230 6480464 Carbon Tetrachloride results in decreased expression of PPP3R1 mRNA CTD PMID:16644059 Ppp3r1 Mouse thioacetamide increases expression ISO RGD:69230 6480464 Thioacetamide results in increased expression of PPP3R1 mRNA CTD PMID:34492290 Ppp3r1 Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of PPP3R1 gene CTD PMID:35295148 Ppp3r1 Mouse titanium dioxide increases methylation EXP 6480464 titanium dioxide results in increased methylation of PPP3R1 promoter CTD PMID:35295148 Ppp3r1 Mouse triphenyl phosphate affects expression ISO RGD:1350432 6480464 triphenyl phosphate affects the expression of PPP3R1 mRNA CTD PMID:37042841 Ppp3r1 Mouse valproic acid increases methylation ISO RGD:1350432 6480464 Valproic Acid results in increased methylation of PPP3R1 gene CTD PMID:29154799 Ppp3r1 Mouse valproic acid decreases expression ISO RGD:1350432 6480464 Valproic Acid results in decreased expression of PPP3R1 mRNA CTD PMID:23179753|PMID:27188386 Ppp3r1 Mouse venlafaxine hydrochloride decreases expression ISO RGD:69230 6480464 Venlafaxine Hydrochloride results in decreased expression of PPP3R1 mRNA CTD PMID:25423262 Ppp3r1 Mouse vinclozolin affects expression ISO RGD:69230 6480464 vinclozolin affects the expression of PPP3R1 mRNA CTD PMID:19015723 Ppp3r1 Mouse zinc atom multiple interactions ISO RGD:1350432 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of PPP3R1 mRNA CTD PMID:18593933 Ppp3r1 Mouse zinc(0) multiple interactions ISO RGD:1350432 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of PPP3R1 mRNA CTD PMID:18593933
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(+)-pilocarpine (ISO) (S)-nicotine (EXP) 1,2-dimethylhydrazine (EXP) 1,3-dinitrobenzene (ISO) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (ISO) 2,4-dinitrotoluene (ISO) 2-hydroxypropanoic acid (ISO) 2-methylcholine (ISO) 3,4-methylenedioxymethamphetamine (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-diaminodiphenylmethane (EXP) 4,4'-sulfonyldiphenol (ISO) 4-vinylcyclohexene dioxide (EXP) 6-propyl-2-thiouracil (ISO) acrylamide (ISO) aflatoxin B1 (EXP,ISO) aflatoxin M1 (ISO) amiodarone (ISO) ammonium chloride (ISO) aristolochic acid A (ISO) atrazine (ISO) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (ISO) bisphenol F (EXP) bortezomib (ISO) Brodifacoum (ISO) cadmium atom (ISO) cadmium dichloride (ISO) calcidiol (ISO) calcium atom (EXP) calcium(0) (EXP) cannabidiol (EXP) cannabigerol (EXP) CGP 52608 (ISO) chromium(6+) (EXP) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) Cuprizon (ISO) cyclosporin A (ISO) DDE (ISO) dexamethasone (ISO) dorsomorphin (ISO) doxorubicin (ISO) endosulfan (ISO) ethanol (EXP,ISO) fenvalerate (ISO) flutamide (ISO) folic acid (EXP) GSK-J4 (ISO) indometacin (ISO) ivermectin (ISO) lead diacetate (ISO) lithium chloride (ISO) methamphetamine (ISO) methoxychlor (EXP) methylmercury chloride (ISO) miconazole (EXP) monosodium L-glutamate (EXP) morphine (EXP) nefazodone (ISO) nickel atom (ISO) nicotine (EXP) nitrates (EXP) O-palmitoylcarnitine (EXP) ochratoxin A (ISO) okadaic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) perindopril (ISO) potassium dichromate (ISO) quercetin (ISO) quinolin-8-ol (ISO) rac-lactic acid (ISO) rotenone (ISO) SB 431542 (ISO) silicon dioxide (EXP) sodium arsenite (ISO) tamoxifen (EXP) tetrachloromethane (ISO) thioacetamide (ISO) titanium dioxide (EXP) triphenyl phosphate (ISO) valproic acid (ISO) venlafaxine hydrochloride (ISO) vinclozolin (ISO) zinc atom (ISO) zinc(0) (ISO)
Cellular Component
calcineurin complex (IBA,IDA,ISO,NAS) cytosol (NAS,TAS) glutamatergic synapse (EXP,IDA,IMP) hippocampal mossy fiber to CA3 synapse (IDA,IMP) parallel fiber to Purkinje cell synapse (IDA,IMP) postsynapse (IEA) protein serine/threonine phosphatase complex (NAS) sarcolemma (IDA) Schaffer collateral - CA1 synapse (IDA,IMP) synapse (EXP,IDA)
1.
Regional calcineurin subunit B isoform expression in rat hippocampus following a traumatic brain injury.
Bales JW, etal., Brain Res. 2010 Oct 28;1358:211-20. doi: 10.1016/j.brainres.2010.08.029. Epub 2010 Aug 13.
2.
Increased regulatory activity of the calcineurin/NFAT pathway in human heart failure.
Diedrichs H, etal., Eur J Heart Fail. 2004 Jan;6(1):3-9.
3.
Calcineurin and matrix protein expression in cardiac hypertrophy : Evidence for calcineurin B to control excessive hypertrophic signaling.
Grammer JB, etal., Basic Res Cardiol. 2006 Jul;101(4):292-300. Epub 2006 May 10.
4.
Integration of Notch 1 and calcineurin/NFAT signaling pathways in keratinocyte growth and differentiation control.
Mammucari C, etal., Dev Cell. 2005 May;8(5):665-76.
5.
Electronic Transfer of Homolog Data
MGD and Homologene mouse data transfer
6.
MGDs mouse GO annotations
MGD data from the GO Consortium
7.
MGD IEA
MGD IEA
8.
Variants in PPP3R1 and MAPT are associated with more rapid functional decline in Alzheimer's disease: the Cache County Dementia Progression Study.
Peterson D, etal., Alzheimers Dement. 2014 May;10(3):366-71. doi: 10.1016/j.jalz.2013.02.010. Epub 2013 May 30.
9.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
10.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
11.
Mouse MP Annotation Import Pipeline
RGD automated import pipeline
12.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
13.
Differential expression and redox proteomics analyses of an Alzheimer disease transgenic mouse model: effects of the amyloid-β peptide of amyloid precursor protein.
Robinson RA, etal., Neuroscience. 2011 Mar 17;177:207-22. doi: 10.1016/j.neuroscience.2011.01.005. Epub 2011 Jan 9.
14.
Direct and indirect interactions between calcineurin-NFAT and MEK1-extracellular signal-regulated kinase 1/2 signaling pathways regulate cardiac gene expression and cellular growth.
Sanna B, etal., Mol Cell Biol. 2005 Feb;25(3):865-78.
15.
Cardioplegia prevents ischemia-induced transcriptional alterations of cytoprotective genes in rat hearts: a DNA microarray study.
Schomisch SJ, etal., J Thorac Cardiovasc Surg. 2005 Oct;130(4):1151.
16.
Identification of a novel 5-base pair deletion in calcineurin B (PPP3R1) promoter region and its association with left ventricular hypertrophy.
Tang W, etal., Am Heart J. 2005 Oct;150(4):845-51.
17.
Calcium-calcineurin signaling in the regulation of cardiac hypertrophy.
Wilkins BJ and Molkentin JD, Biochem Biophys Res Commun. 2004 Oct 1;322(4):1178-91.
Ppp3r1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 17,109,298 - 17,150,380 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 17,109,263 - 17,150,375 (+) Ensembl GRCm39 Ensembl GRCm38 11 17,159,298 - 17,200,380 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 17,159,263 - 17,200,375 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 17,059,301 - 17,100,383 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 17,059,301 - 17,100,383 (+) NCBI MGSCv36 mm8 Celera 11 17,532,396 - 17,574,044 (+) NCBI Celera Cytogenetic Map 11 A2 NCBI cM Map 11 9.71 NCBI
PPP3R1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 68,178,857 - 68,252,532 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 68,178,857 - 68,256,237 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 68,405,989 - 68,479,664 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 68,259,493 - 68,333,155 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 2 68,317,639 - 68,391,302 NCBI Celera 2 68,255,597 - 68,329,209 (-) NCBI Celera Cytogenetic Map 2 p14 NCBI HuRef 2 68,143,447 - 68,181,703 (-) NCBI HuRef CHM1_1 2 68,336,792 - 68,410,397 (-) NCBI CHM1_1 T2T-CHM13v2.0 2 68,189,412 - 68,263,096 (-) NCBI T2T-CHM13v2.0
Ppp3r1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 95,758,333 - 95,808,015 (+) NCBI GRCr8 mRatBN7.2 14 91,556,743 - 91,606,391 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 91,604,121 - 91,606,907 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 95,875,569 - 95,913,609 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 97,119,906 - 97,157,946 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 93,584,970 - 93,623,011 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 100,311,224 - 100,360,879 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 100,311,173 - 100,360,879 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 100,178,695 - 100,227,295 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 98,060,302 - 98,099,092 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 14 98,079,446 - 98,118,237 (+) NCBI Celera 14 90,614,429 - 90,652,365 (+) NCBI Celera Cytogenetic Map 14 q22 NCBI
Ppp3r1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955424 16,623,917 - 16,690,783 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955424 16,624,214 - 16,690,783 (+) NCBI ChiLan1.0 ChiLan1.0
PPP3R1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 12 58,156,551 - 58,229,424 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2A 58,160,135 - 58,233,372 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2A 68,227,282 - 68,300,482 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3
PPP3R1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 10 67,242,552 - 67,308,469 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 10 67,244,329 - 67,275,487 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 10 67,135,373 - 67,199,366 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 10 68,263,516 - 68,327,586 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 10 68,261,752 - 68,325,387 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 10 67,946,324 - 68,012,242 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 10 68,243,919 - 68,309,976 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 10 68,541,451 - 68,605,689 (-) NCBI UU_Cfam_GSD_1.0
Ppp3r1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024406292 15,826,513 - 15,947,768 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936491 12,718,720 - 12,744,428 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 Ensembl NW_004936491 12,623,349 - 12,654,502 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936491 12,623,931 - 12,654,463 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PPP3R1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 3 74,000,517 - 74,068,172 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 3 74,004,620 - 74,068,173 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 3 77,531,587 - 77,598,082 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PPP3R1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 14 38,832,976 - 38,907,425 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 14 38,832,809 - 38,905,321 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666045 73,068,593 - 73,142,887 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ppp3r1
.
Predicted Target Of
Count of predictions: 640 Count of miRNA genes: 411 Interacting mature miRNAs: 486 Transcripts: ENSMUST00000102880, ENSMUST00000154425 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
39128214 Lwq20_m liver weight QTL 20 (mouse) 11 12268637 118022724 Mouse 26884446 Sklq10_m skull length QTL 10, 10 week (mouse) 11 3250000 62890826 Mouse 1302171 Pgia28_m proteoglycan induced arthritis 28 (mouse) Not determined 11 8906097 42906218 Mouse 4141047 Nilac1_m nicotine induced locomotor activity 1 (mouse) Not determined 11 9011780 43011942 Mouse 1357720 Kidpq1_m kidney weight percentage QTL 1 (mouse) Not determined 11 12268637 68500330 Mouse 1559002 Lmrq4_m Leishmania major resistance QTL 4 (mouse) Not determined 11 12268637 69684947 Mouse 1357722 Vtbt11_m vertebral trabecular bone trait 11 (mouse) Not determined 11 1 23880487 Mouse 1357851 Scfq3_m subcutaneous fat pad weight QTL 3 (mouse) Not determined 11 12268637 68500330 Mouse 27226762 Feml21_m femur length 21, 16 week (mouse) 11 11750000 65990826 Mouse 1301765 Skull15_m skull morphology 15 (mouse) Not determined 11 1 25976374 Mouse 1357518 Tgyl1_m triglyceride level 1 (mouse) Not determined 11 6880277 33916219 Mouse 4142308 W6q3_m weight 6 weeks QTL 3 (mouse) Not determined 11 12268637 68500330 Mouse 1357640 Orq2_m ovulation rate QTL 2 (mouse) Not determined 11 12268637 68500330 Mouse 4141470 Egq4_m early growth QTL 4 (mouse) Not determined 12268637 68500330 Mouse 13524844 Ppiq9_m prepulse inhibition QTL 9 (mouse) 11 9049997 35077325 Mouse 4142109 W10q2_m weight 10 weeks QTL 2 (mouse) Not determined 12268637 68500330 Mouse 1300599 Cocrb11_m cocaine related behavior 11 (mouse) Not determined 11 2670355 36671472 Mouse 1300661 Lmr6_m leishmaniasis resistance 6 (mouse) Not determined 11 1 25976374 Mouse 13208559 Wght10_m weight 10 (mouse) 11 3950000 88890826 Mouse 10412216 Eae44_m experimental allergic encephalomyelitis susceptibility 44 (mouse) Not determined 11 12268637 39950840 Mouse 13208558 Lgth12_m body length 12 (mouse) 11 3950000 94890826 Mouse 27095925 Pglq5_m pelvic girdle length QTL 5, 5 week (mouse) 11 3250000 19750000 Mouse 1357437 Epfq4_m epididymal fat pad weight QTL 4 (mouse) Not determined 11 12268637 68500330 Mouse 27226741 Metcl5_m metatarsal-calcaneal length 5, 5 week (mouse) 11 4650000 46290827 Mouse 26884401 Huml4_m humerus length 4, 10 week (mouse) 11 11550000 68490826 Mouse 1300990 Bits3_m bitterness sensitivity 3 (mouse) Not determined 11 8372121 42372260 Mouse 27226738 Metcl11_m metatarsal-calcaneal length 11, 10 week (mouse) 11 8850000 61390826 Mouse 27226735 Metcl16_m metatarsal-calcaneal length 16, 16 week (mouse) 11 5250000 35090827 Mouse 10044008 Hbnr15_m Heligmosomoides bakeri nematode resistance 15 (mouse) Not determined 11 227052 34227232 Mouse 27226798 Scvln18_m sacral vertebrae length 2, 16 week (mouse) 11 3250000 60690826 Mouse 4141582 Lgaq1_m late growth adjusted QTL 1 (mouse) Not determined 12268637 68500330 Mouse 4141966 Tailq1_m tail length QTL 1 (mouse) Not determined 12268637 68500330 Mouse 27095919 Pglq10_m pelvic girdle length QTL 10, 10 week (mouse) 11 3250000 18450000 Mouse 1300768 Tshp9_m tooth shape 9 (mouse) Not determined 11 1 25976374 Mouse 10053676 Eae44a_m experimental allergic encephalomyelitis susceptibility 44a (mouse) Not determined 11 4507896 21379532 Mouse 1558945 Orgwq8_m organ weight QTL 8 (mouse) Not determined 11 17056175 67078411 Mouse 27095914 Pglq16_m pelvic girdle length QTL 16, 16 week (mouse) 11 3250000 18150000 Mouse 4142216 Lgq1_m late growth QTL 1 (mouse) Not determined 12268637 68500330 Mouse 27095909 Scvln6_m sacral vertebrae length 2, 5 week (mouse) 11 3250000 44090827 Mouse 4141127 W3q4_m weight 3 weeks QTL 4 (mouse) Not determined 12268637 68500330 Mouse 1300905 Scc6_m colon tumor susceptibility 6 (mouse) Not determined 11 6880277 89019734 Mouse 13463479 Mchq19_m mean corpuscular hemoglobin QTL 19 (mouse) 11 10951232 44951464 Mouse 27095904 Scvln12_m sacral vertebrae length 2, 10 week (mouse) 11 3250000 34495048 Mouse 13463472 Mcvq15_m mean corpuscular volume QTL 15 (mouse) 11 10951232 44951464 Mouse 26884453 Sklq16_m skull length QTL 16, 16 week (mouse) 11 3250000 72690826 Mouse
Ppp3r1
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 4 B3 UniSTS Cytogenetic Map 11 A3.1 UniSTS cM Map 11 UniSTS cM Map 4 UniSTS
UniSTS:236523
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 11 17,199,650 - 17,199,851 UniSTS GRCm38 MGSCv37 11 17,099,653 - 17,099,854 UniSTS GRCm37 Celera 11 17,573,314 - 17,573,515 UniSTS Cytogenetic Map 11 A3.1 UniSTS
D2S2724
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 11 17,198,415 - 17,198,738 UniSTS GRCm38 MGSCv37 11 17,098,418 - 17,098,741 UniSTS GRCm37 Celera 11 17,572,079 - 17,572,402 UniSTS Cytogenetic Map 11 A3.1 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000102880 ⟹ ENSMUSP00000099944
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 17,109,263 - 17,150,375 (+) Ensembl GRCm38.p6 Ensembl 11 17,159,263 - 17,200,375 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000154425
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 17,142,844 - 17,145,109 (+) Ensembl GRCm38.p6 Ensembl 11 17,192,844 - 17,195,109 (+) Ensembl
RefSeq Acc Id:
NM_024459 ⟹ NP_077779
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 11 17,109,298 - 17,150,380 (+) NCBI GRCm38 11 17,159,298 - 17,200,380 (+) ENTREZGENE MGSCv37 11 17,059,301 - 17,100,383 (+) RGD Celera 11 17,532,396 - 17,574,044 (+) RGD cM Map 11 ENTREZGENE
Sequence:
TCTGCGCGCCCTGTTCCGTGCCTTGAGGTTGCGGTCAGCGCGAGCCGCTGCAACGAGTCGGGGCCGCCTGTGAGCGTGAGGCTGCAACCCTCTCCTCCCGCCGACGCATCTCCAACCGGGACTCCGCC
hide sequence
RefSeq Acc Id:
NP_077779 ⟸ NM_024459
- UniProtKB:
Q3V067 (UniProtKB/Swiss-Prot), Q5F225 (UniProtKB/Swiss-Prot), Q63810 (UniProtKB/Swiss-Prot)
- Sequence:
MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQ
hide sequence
Ensembl Acc Id:
ENSMUSP00000099944 ⟸ ENSMUST00000102880
RGD ID: 6821601 Promoter ID: MM_KWN:6515 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day4, 3T3L1_Day6, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen Transcripts: OTTMUST00000011611 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 11 17,058,934 - 17,059,434 (+) MPROMDB
RGD ID: 8674028 Promoter ID: EPDNEW_M15042 Type: initiation region Name: Ppp3r1_1 Description: Mus musculus protein phosphatase 3, regulatory subunit B, alphaisoform (calcineurin B, type I) , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 11 17,159,317 - 17,159,377 EPDNEW
