Symbol:
Dll1
Name:
delta like canonical Notch ligand 1
RGD ID:
733843
MGI Page
MGI
Description:
Enables Notch binding activity and scaffold protein binding activity. Involved in several processes, including negative regulation of cell differentiation; nervous system development; and regionalization. Acts upstream of or within several processes, including inner ear development; negative regulation of cell differentiation; and regionalization. Located in several cellular components, including adherens junction; apical plasma membrane; and membrane raft. Is expressed in several structures, including alimentary system; central nervous system; limb; metanephros; and sensory organ. Orthologous to human DLL1 (delta like canonical Notch ligand 1).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
Delt; delta like-1; delta-like 1; delta-like 1 (Drosophila); delta-like protein 1; Delta1; drosophila Delta homolog 1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
DLL1 (delta like canonical Notch ligand 1) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OrthoDB, OrthoMCL, Treefam
Rattus norvegicus (Norway rat):
Dll1 (delta like canonical Notch ligand 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Dll1 (delta like canonical Notch ligand 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
DLL1 (delta like canonical Notch ligand 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
DLL1 (delta like canonical Notch ligand 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Dll1 (delta like canonical Notch ligand 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
DLL1 (delta like canonical Notch ligand 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
DLL1 (delta like canonical Notch ligand 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Dll1 (delta like canonical Notch ligand 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Dll1 (delta like canonical Notch ligand 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
DLL1 (delta like canonical Notch ligand 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
dla (deltaA)
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Danio rerio (zebrafish):
dld (deltaD)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Drosophila melanogaster (fruit fly):
Dl
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Dl
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
dsl-4
Alliance
DIOPT (Ensembl Compara|OrthoFinder)
Xenopus tropicalis (tropical clawed frog):
dll1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 17 15,587,616 - 15,597,275 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 17 15,587,616 - 15,597,134 (-) Ensembl GRCm39 Ensembl GRCm38 17 15,367,354 - 15,376,932 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 17 15,367,354 - 15,376,872 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 17 15,504,318 - 15,512,787 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 17 15,072,317 - 15,080,550 (-) NCBI MGSCv36 mm8 Celera 17 16,154,981 - 16,163,462 (-) NCBI Celera Cytogenetic Map 17 A2 NCBI cM Map 17 8.95 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Dll1 Mouse 1,2-dimethylhydrazine decreases expression EXP 6480464 1,2-Dimethylhydrazine results in decreased expression of DLL1 mRNA CTD PMID:22206623 Dll1 Mouse 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of DLL1 mRNA CTD PMID:25210133 Dll1 Mouse 17beta-estradiol decreases expression ISO RGD:733842 6480464 Estradiol results in decreased expression of DLL1 mRNA CTD PMID:31614463 Dll1 Mouse 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of DLL1 mRNA CTD PMID:39298647 Dll1 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of DLL1 mRNA CTD PMID:19933214 Dll1 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of DLL1 mRNA CTD PMID:28922406 Dll1 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:733842 6480464 Tetrachlorodibenzodioxin results in increased expression of DLL1 mRNA CTD PMID:17517823|PMID:22903824 Dll1 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:733842 6480464 Tetrachlorodibenzodioxin affects the expression of DLL1 mRNA CTD PMID:22298810 Dll1 Mouse 3,3',5,5'-tetrabromobisphenol A increases expression EXP 6480464 tetrabromobisphenol A results in increased expression of DLL1 mRNA CTD PMID:35230478 Dll1 Mouse 3-methylcholanthrene increases expression ISO RGD:70949 6480464 Methylcholanthrene results in increased expression of DLL1 mRNA CTD PMID:29094188 Dll1 Mouse 3-methylcholanthrene multiple interactions ISO RGD:70949 6480464 alpha-naphthoflavone inhibits the reaction [Methylcholanthrene results in increased expression of DLL1 mRNA] CTD PMID:29094188 Dll1 Mouse 3H-1,2-dithiole-3-thione increases expression ISO RGD:70949 6480464 1,2-dithiol-3-thione results in increased expression of DLL1 mRNA CTD PMID:19162173 Dll1 Mouse 4,4'-sulfonyldiphenol affects methylation EXP 6480464 bisphenol S affects the methylation of DLL1 gene CTD PMID:31683443 Dll1 Mouse 4-hydroxyphenyl retinamide increases expression EXP 6480464 Fenretinide results in increased expression of DLL1 mRNA CTD PMID:28973697 Dll1 Mouse 5-aza-2'-deoxycytidine affects expression ISO RGD:733842 6480464 Decitabine affects the expression of DLL1 mRNA CTD PMID:23300844 Dll1 Mouse 6-propyl-2-thiouracil increases expression ISO RGD:70949 6480464 Propylthiouracil results in increased expression of DLL1 mRNA CTD PMID:24780913|PMID:30047161 Dll1 Mouse acetohydrazide decreases expression EXP 6480464 acetylhydrazine results in decreased expression of DLL1 mRNA CTD PMID:15282401 Dll1 Mouse acrylamide decreases expression ISO RGD:70949 6480464 Acrylamide results in decreased expression of DLL1 mRNA CTD PMID:28959563 Dll1 Mouse all-trans-retinoic acid decreases expression ISO RGD:733842 6480464 Tretinoin results in decreased expression of DLL1 mRNA CTD PMID:21934132 Dll1 Mouse alpha-naphthoflavone multiple interactions ISO RGD:70949 6480464 alpha-naphthoflavone inhibits the reaction [Methylcholanthrene results in increased expression of DLL1 mRNA] CTD PMID:29094188 Dll1 Mouse amitrole decreases expression ISO RGD:70949 6480464 Amitrole results in decreased expression of DLL1 mRNA CTD PMID:38685447 Dll1 Mouse amitrole increases expression ISO RGD:70949 6480464 Amitrole results in increased expression of DLL1 mRNA CTD PMID:30047161 Dll1 Mouse ammonium chloride affects expression ISO RGD:70949 6480464 Ammonium Chloride affects the expression of DLL1 mRNA CTD PMID:16483693 Dll1 Mouse antimycin A increases expression ISO RGD:733842 6480464 Antimycin A results in increased expression of DLL1 mRNA CTD PMID:33512557 Dll1 Mouse arsane increases expression EXP 6480464 Arsenic results in increased expression of DLL1 mRNA CTD PMID:24019935 Dll1 Mouse arsane multiple interactions ISO RGD:733842 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in increased expression of DLL1 more ... CTD PMID:32525701 Dll1 Mouse arsenic atom increases expression EXP 6480464 Arsenic results in increased expression of DLL1 mRNA CTD PMID:24019935 Dll1 Mouse arsenic atom multiple interactions ISO RGD:733842 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in increased expression of DLL1 more ... CTD PMID:32525701 Dll1 Mouse atrazine increases expression ISO RGD:733842 6480464 Atrazine results in increased expression of DLL1 mRNA CTD PMID:18585445 Dll1 Mouse atrazine increases expression ISO RGD:70949 6480464 Atrazine results in increased expression of DLL1 mRNA CTD PMID:36841081 Dll1 Mouse azoxystrobin multiple interactions ISO RGD:70949 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with more ... CTD PMID:33854195 Dll1 Mouse benzene increases expression ISO RGD:733842 6480464 Benzene results in increased expression of DLL1 mRNA CTD PMID:19162166 Dll1 Mouse benzo[a]pyrene increases mutagenesis ISO RGD:733842 6480464 Benzo(a)pyrene results in increased mutagenesis of DLL1 gene CTD PMID:25435355 Dll1 Mouse benzo[a]pyrene increases methylation ISO RGD:733842 6480464 Benzo(a)pyrene results in increased methylation of DLL1 3' UTR; Benzo(a)pyrene results in increased methylation of more ... CTD PMID:27901495 Dll1 Mouse benzo[a]pyrene increases expression ISO RGD:733842 6480464 Benzo(a)pyrene results in increased expression of DLL1 mRNA CTD PMID:22316170 Dll1 Mouse benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of DLL1 mRNA CTD PMID:19770486|PMID:22228805 Dll1 Mouse bis(2-chloroethyl) sulfide decreases expression ISO RGD:733842 6480464 Mustard Gas results in decreased expression of DLL1 mRNA CTD PMID:25102026 Dll1 Mouse bis(2-ethylhexyl) phthalate increases expression ISO RGD:70949 6480464 Diethylhexyl Phthalate results in increased expression of DLL1 mRNA; Diethylhexyl Phthalate results in increased expression more ... CTD PMID:36988346 Dll1 Mouse bis(2-ethylhexyl) phthalate decreases expression ISO RGD:733842 6480464 Diethylhexyl Phthalate results in decreased expression of DLL1 mRNA CTD PMID:31163220 Dll1 Mouse bisphenol A decreases expression ISO RGD:70949 6480464 bisphenol A results in decreased expression of DLL1 mRNA CTD PMID:25181051 Dll1 Mouse bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of DLL1 mRNA CTD PMID:32156529 Dll1 Mouse bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of DLL1 mRNA CTD PMID:35278557 Dll1 Mouse bisphenol A increases expression ISO RGD:70949 6480464 bisphenol A results in increased expression of DLL1 mRNA CTD PMID:32145629 Dll1 Mouse bisphenol F decreases expression EXP 6480464 bisphenol F results in decreased expression of DLL1 mRNA CTD PMID:35278557|PMID:38685157 Dll1 Mouse butan-1-ol multiple interactions ISO RGD:733842 6480464 [[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic more ... CTD PMID:29432896 Dll1 Mouse butanal increases expression ISO RGD:733842 6480464 butyraldehyde results in increased expression of DLL1 mRNA CTD PMID:26079696 Dll1 Mouse C60 fullerene decreases expression ISO RGD:70949 6480464 fullerene C60 results in decreased expression of DLL1 mRNA CTD PMID:19167457 Dll1 Mouse cadmium atom increases expression ISO RGD:733842 6480464 Cadmium results in increased expression of DLL1 mRNA CTD PMID:21120746 Dll1 Mouse calciol multiple interactions ISO RGD:70949 6480464 [Cholecalciferol co-treated with Dietary Fats co-treated with Particulate Matter] results in increased expression of DLL1 more ... CTD PMID:36603807 Dll1 Mouse cannabidiol multiple interactions EXP 6480464 Cannabidiol inhibits the reaction [lipopolysaccharide, E coli O55-B5 results in increased expression of DLL1 mRNA] CTD PMID:30742662 Dll1 Mouse cannabidiol increases expression EXP 6480464 Cannabidiol results in increased expression of DLL1 mRNA CTD PMID:30742662 Dll1 Mouse carbon nanotube affects expression EXP 6480464 Nanotubes, Carbon analog affects the expression of DLL1 mRNA CTD PMID:25554681 Dll1 Mouse chlorpyrifos multiple interactions ISO RGD:70949 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with more ... CTD PMID:33854195 Dll1 Mouse chlorpyrifos increases expression EXP 6480464 Chlorpyrifos results in increased expression of DLL1 mRNA CTD PMID:37019170 Dll1 Mouse cisplatin affects expression ISO RGD:733842 6480464 Cisplatin affects the expression of DLL1 mRNA CTD PMID:23300844 Dll1 Mouse copper atom multiple interactions ISO RGD:733842 6480464 [Disulfiram binds to Copper] which results in decreased expression of DLL1 mRNA CTD PMID:24690739 Dll1 Mouse copper(0) multiple interactions ISO RGD:733842 6480464 [Disulfiram binds to Copper] which results in decreased expression of DLL1 mRNA CTD PMID:24690739 Dll1 Mouse copper(II) sulfate affects expression ISO RGD:733842 6480464 Copper Sulfate affects the expression of DLL1 mRNA CTD PMID:19549813 Dll1 Mouse Dibutyl phosphate affects expression ISO RGD:733842 6480464 di-n-butylphosphoric acid affects the expression of DLL1 mRNA CTD PMID:37042841 Dll1 Mouse dioxygen increases expression EXP 6480464 Oxygen deficiency results in increased expression of DLL1 mRNA CTD PMID:24223152 Dll1 Mouse dioxygen increases expression ISO RGD:733842 6480464 Oxygen deficiency results in increased expression of DLL1 mRNA CTD PMID:25596134 Dll1 Mouse dioxygen increases expression ISO RGD:70949 6480464 Oxygen deficiency results in increased expression of DLL1 mRNA; Oxygen deficiency results in increased expression more ... CTD PMID:24223152 Dll1 Mouse disulfiram multiple interactions ISO RGD:733842 6480464 [Disulfiram binds to Copper] which results in decreased expression of DLL1 mRNA CTD PMID:24690739 Dll1 Mouse dorsomorphin multiple interactions ISO RGD:733842 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ... CTD PMID:27188386 Dll1 Mouse entinostat multiple interactions ISO RGD:733842 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ... CTD PMID:27188386 Dll1 Mouse entinostat decreases expression ISO RGD:733842 6480464 entinostat results in decreased expression of DLL1 mRNA CTD PMID:26272509 Dll1 Mouse epoxiconazole increases expression EXP 6480464 epoxiconazole results in increased expression of DLL1 mRNA CTD PMID:35436446 Dll1 Mouse ethanol multiple interactions ISO RGD:733842 6480464 [[Gasoline co-treated with Ethanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic more ... CTD PMID:29432896 Dll1 Mouse flavonoids decreases expression ISO RGD:70949 6480464 Flavonoids results in decreased expression of DLL1 mRNA CTD PMID:18035473 Dll1 Mouse folic acid decreases expression EXP 6480464 Folic Acid results in decreased expression of DLL1 mRNA CTD PMID:25629700 Dll1 Mouse furan increases expression EXP 6480464 furan results in increased expression of DLL1 mRNA CTD PMID:24183702 Dll1 Mouse furan decreases expression ISO RGD:70949 6480464 furan results in decreased expression of DLL1 mRNA CTD PMID:25539665 Dll1 Mouse genistein increases expression EXP 6480464 Genistein results in increased expression of DLL1 mRNA CTD PMID:32186404 Dll1 Mouse glycidol decreases expression ISO RGD:70949 6480464 glycidol results in decreased expression of DLL1 mRNA CTD PMID:33150645 Dll1 Mouse glycidol increases methylation ISO RGD:70949 6480464 glycidol results in increased methylation of DLL1 promoter CTD PMID:33150595 Dll1 Mouse glyphosate increases expression ISO RGD:733842 6480464 Glyphosate results in increased expression of DLL1 mRNA CTD PMID:31295307 Dll1 Mouse glyphosate multiple interactions ISO RGD:70949 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with more ... CTD PMID:33854195 Dll1 Mouse hydrazine decreases expression EXP 6480464 hydrazine results in decreased expression of DLL1 mRNA CTD PMID:15282401 Dll1 Mouse imidacloprid multiple interactions ISO RGD:70949 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with more ... CTD PMID:33854195 Dll1 Mouse linuron increases expression ISO RGD:70949 6480464 Linuron results in increased expression of DLL1 mRNA CTD PMID:12730624 Dll1 Mouse lipopolysaccharide decreases expression ISO RGD:70949 6480464 Lipopolysaccharides results in decreased expression of DLL1 mRNA CTD PMID:18449946 Dll1 Mouse lipopolysaccharide multiple interactions ISO RGD:733842 6480464 [S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of DLL1 mRNA CTD PMID:35811015 Dll1 Mouse maneb multiple interactions EXP 6480464 [SNCA protein co-treated with Maneb co-treated with Paraquat] results in decreased expression of DLL1 mRNA CTD PMID:23017109 Dll1 Mouse mercury dibromide decreases expression ISO RGD:733842 6480464 mercuric bromide results in decreased expression of DLL1 mRNA CTD PMID:26272509 Dll1 Mouse mercury dibromide multiple interactions ISO RGD:733842 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Dll1 Mouse methimazole increases expression ISO RGD:70949 6480464 Methimazole results in increased expression of DLL1 mRNA CTD PMID:30047161 Dll1 Mouse methotrexate affects expression EXP 6480464 Methotrexate affects the expression of DLL1 mRNA CTD PMID:18502557 Dll1 Mouse methylisothiazolinone increases expression ISO RGD:733842 6480464 2-methyl-4-isothiazolin-3-one results in increased expression of DLL1 mRNA CTD PMID:31629900 Dll1 Mouse methylmercury chloride affects expression ISO RGD:70949 6480464 methylmercuric chloride affects the expression of DLL1 mRNA CTD PMID:20864626 Dll1 Mouse methylmercury chloride decreases expression ISO RGD:733842 6480464 methylmercuric chloride results in decreased expression of DLL1 mRNA CTD PMID:28001369 Dll1 Mouse mono(2-ethylhexyl) phthalate affects expression ISO RGD:70949 6480464 mono-(2-ethylhexyl)phthalate affects the expression of DLL1 protein CTD PMID:36988346 Dll1 Mouse mono(2-ethylhexyl) phthalate increases expression EXP 6480464 mono-(2-ethylhexyl)phthalate results in increased expression of DLL1 protein CTD PMID:33091777 Dll1 Mouse mono(2-ethylhexyl) phthalate increases expression ISO RGD:70949 6480464 mono-(2-ethylhexyl)phthalate results in increased expression of DLL1 mRNA CTD PMID:36988346 Dll1 Mouse N,N-diethyl-m-toluamide multiple interactions ISO RGD:70949 6480464 [Permethrin co-treated with DEET] results in increased methylation of DLL1 gene CTD PMID:33148267 Dll1 Mouse naphthalene increases expression EXP 6480464 naphthalene results in increased expression of DLL1 mRNA CTD PMID:18978301 Dll1 Mouse nitrofen increases expression ISO RGD:70949 6480464 nitrofen results in increased expression of DLL1 mRNA CTD PMID:17618886 Dll1 Mouse orphenadrine affects expression ISO RGD:70949 6480464 Orphenadrine affects the expression of DLL1 mRNA CTD PMID:23665939 Dll1 Mouse p-chloromercuribenzoic acid decreases expression ISO RGD:733842 6480464 p-Chloromercuribenzoic Acid results in decreased expression of DLL1 mRNA CTD PMID:26272509 Dll1 Mouse p-chloromercuribenzoic acid multiple interactions ISO RGD:733842 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Dll1 Mouse paraquat multiple interactions EXP 6480464 [SNCA protein co-treated with Maneb co-treated with Paraquat] results in decreased expression of DLL1 mRNA CTD PMID:23017109 Dll1 Mouse pentachlorophenol increases expression EXP 6480464 Pentachlorophenol results in increased expression of DLL1 mRNA CTD PMID:23892564 Dll1 Mouse pentanal increases expression ISO RGD:733842 6480464 pentanal results in increased expression of DLL1 mRNA CTD PMID:26079696 Dll1 Mouse permethrin multiple interactions ISO RGD:70949 6480464 [Permethrin co-treated with DEET] results in increased methylation of DLL1 gene CTD PMID:33148267 Dll1 Mouse phenylmercury acetate decreases expression ISO RGD:733842 6480464 Phenylmercuric Acetate results in decreased expression of DLL1 mRNA CTD PMID:26272509 Dll1 Mouse phenylmercury acetate multiple interactions ISO RGD:733842 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Dll1 Mouse pirinixic acid decreases expression EXP 6480464 pirinixic acid results in decreased expression of DLL1 mRNA CTD PMID:23811191 Dll1 Mouse pregnenolone 16alpha-carbonitrile increases expression EXP 6480464 Pregnenolone Carbonitrile results in increased expression of DLL1 mRNA CTD PMID:28903501 Dll1 Mouse propanal increases expression ISO RGD:733842 6480464 propionaldehyde results in increased expression of DLL1 mRNA CTD PMID:26079696 Dll1 Mouse S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO RGD:733842 6480464 [S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of DLL1 mRNA CTD PMID:35811015 Dll1 Mouse S-(1,2-dichlorovinyl)-L-cysteine decreases expression ISO RGD:733842 6480464 S-(1,2-dichlorovinyl)cysteine results in decreased expression of DLL1 mRNA CTD PMID:35811015 Dll1 Mouse SB 431542 multiple interactions ISO RGD:733842 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ... CTD PMID:27188386 Dll1 Mouse sodium arsenate multiple interactions ISO RGD:733842 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in increased expression of DLL1 more ... CTD PMID:32525701 Dll1 Mouse sodium arsenite increases expression ISO RGD:733842 6480464 sodium arsenite results in increased expression of DLL1 mRNA CTD PMID:38568856 Dll1 Mouse sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of DLL1 mRNA CTD PMID:37682722 Dll1 Mouse tebufenpyrad increases expression ISO RGD:733842 6480464 4-chloro-N-((4-(1,1-dimethylethyl)phenyl)methyl)-3-ethyl-1-methyl-1H-pyrazole-5-carboxamide results in increased expression of DLL1 mRNA CTD PMID:33512557 Dll1 Mouse temozolomide increases expression ISO RGD:733842 6480464 Temozolomide results in increased expression of DLL1 mRNA CTD PMID:31758290 Dll1 Mouse thiabendazole multiple interactions ISO RGD:70949 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with more ... CTD PMID:33854195 Dll1 Mouse thiram increases expression ISO RGD:733842 6480464 Thiram results in increased expression of DLL1 mRNA CTD PMID:38568856 Dll1 Mouse titanium dioxide affects expression EXP 6480464 titanium dioxide affects the expression of DLL1 mRNA CTD PMID:17656681 Dll1 Mouse titanium dioxide increases methylation EXP 6480464 titanium dioxide results in increased methylation of DLL1 promoter CTD PMID:35295148 Dll1 Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of DLL1 gene; titanium dioxide results in decreased methylation more ... CTD PMID:35295148 Dll1 Mouse titanium dioxide decreases expression ISO RGD:70949 6480464 titanium dioxide results in decreased expression of DLL1 mRNA CTD PMID:30012374 Dll1 Mouse triadimefon increases expression ISO RGD:70949 6480464 triadimefon results in increased expression of DLL1 mRNA CTD PMID:30047161 Dll1 Mouse trichloroethene multiple interactions EXP 6480464 PPARA protein inhibits the reaction [Trichloroethylene results in increased expression of DLL1 protein] CTD PMID:15363585 Dll1 Mouse trichloroethene increases methylation ISO RGD:70949 6480464 Trichloroethylene results in increased methylation of DLL1 gene CTD PMID:27618143 Dll1 Mouse trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of DLL1 mRNA CTD PMID:15363585 Dll1 Mouse trichostatin A increases expression ISO RGD:733842 6480464 trichostatin A results in increased expression of DLL1 mRNA CTD PMID:24935251 Dll1 Mouse trichostatin A multiple interactions ISO RGD:733842 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Dll1 Mouse trichostatin A decreases expression ISO RGD:733842 6480464 trichostatin A results in decreased expression of DLL1 mRNA CTD PMID:24935251|PMID:26272509 Dll1 Mouse triptonide increases expression EXP 6480464 triptonide results in increased expression of DLL1 mRNA CTD PMID:33045310 Dll1 Mouse urethane decreases expression ISO RGD:733842 6480464 Urethane results in decreased expression of DLL1 mRNA CTD PMID:28818685 Dll1 Mouse valproic acid affects expression ISO RGD:733842 6480464 Valproic Acid affects the expression of DLL1 mRNA CTD PMID:25979313 Dll1 Mouse valproic acid increases methylation ISO RGD:733842 6480464 Valproic Acid results in increased methylation of DLL1 gene CTD PMID:29154799 Dll1 Mouse valproic acid decreases expression ISO RGD:733842 6480464 Valproic Acid results in decreased expression of DLL1 mRNA CTD PMID:23179753|PMID:24383497|PMID:26272509|PMID:28001369 Dll1 Mouse valproic acid multiple interactions ISO RGD:733842 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Dll1 Mouse vorinostat multiple interactions ISO RGD:733842 6480464 [NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ... CTD PMID:27188386 Dll1 Mouse vorinostat decreases expression ISO RGD:733842 6480464 vorinostat results in decreased expression of DLL1 mRNA CTD PMID:26272509
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
1,2-dimethylhydrazine (EXP) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3,3',5,5'-tetrabromobisphenol A (EXP) 3-methylcholanthrene (ISO) 3H-1,2-dithiole-3-thione (ISO) 4,4'-sulfonyldiphenol (EXP) 4-hydroxyphenyl retinamide (EXP) 5-aza-2'-deoxycytidine (ISO) 6-propyl-2-thiouracil (ISO) acetohydrazide (EXP) acrylamide (ISO) all-trans-retinoic acid (ISO) alpha-naphthoflavone (ISO) amitrole (ISO) ammonium chloride (ISO) antimycin A (ISO) arsane (EXP,ISO) arsenic atom (EXP,ISO) atrazine (ISO) azoxystrobin (ISO) benzene (ISO) benzo[a]pyrene (EXP,ISO) bis(2-chloroethyl) sulfide (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (EXP) butan-1-ol (ISO) butanal (ISO) C60 fullerene (ISO) cadmium atom (ISO) calciol (ISO) cannabidiol (EXP) carbon nanotube (EXP) chlorpyrifos (EXP,ISO) cisplatin (ISO) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) Dibutyl phosphate (ISO) dioxygen (EXP,ISO) disulfiram (ISO) dorsomorphin (ISO) entinostat (ISO) epoxiconazole (EXP) ethanol (ISO) flavonoids (ISO) folic acid (EXP) furan (EXP,ISO) genistein (EXP) glycidol (ISO) glyphosate (ISO) hydrazine (EXP) imidacloprid (ISO) linuron (ISO) lipopolysaccharide (ISO) maneb (EXP) mercury dibromide (ISO) methimazole (ISO) methotrexate (EXP) methylisothiazolinone (ISO) methylmercury chloride (ISO) mono(2-ethylhexyl) phthalate (EXP,ISO) N,N-diethyl-m-toluamide (ISO) naphthalene (EXP) nitrofen (ISO) orphenadrine (ISO) p-chloromercuribenzoic acid (ISO) paraquat (EXP) pentachlorophenol (EXP) pentanal (ISO) permethrin (ISO) phenylmercury acetate (ISO) pirinixic acid (EXP) pregnenolone 16alpha-carbonitrile (EXP) propanal (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) sodium arsenate (ISO) sodium arsenite (EXP,ISO) tebufenpyrad (ISO) temozolomide (ISO) thiabendazole (ISO) thiram (ISO) titanium dioxide (EXP,ISO) triadimefon (ISO) trichloroethene (EXP,ISO) trichostatin A (ISO) triptonide (EXP) urethane (ISO) valproic acid (ISO) vorinostat (ISO)
Biological Process
animal organ morphogenesis (NAS) astrocyte development (IMP) auditory receptor cell fate commitment (NAS) cell-cell signaling (IDA) cerebellar molecular layer formation (IMP) cerebellar Purkinje cell layer structural organization (IMP) clathrin-dependent endocytosis (ISO,ISS) compartment pattern specification (IMP) determination of left/right symmetry (IMP) endothelial tip cell fate specification (IMP) energy homeostasis (IMP) heart looping (IMP) in utero embryonic development (NAS) inhibition of neuroepithelial cell differentiation (IMP) inner ear auditory receptor cell differentiation (IMP,NAS) inner ear development (IMP) inner ear morphogenesis (NAS) lateral inhibition (IDA,IMP) left/right axis specification (IMP) loop of Henle development (IEP) marginal zone B cell differentiation (IMP) myeloid cell differentiation (IDA) negative regulation of cardiac muscle cell differentiation (IMP) negative regulation of cell differentiation (IMP) negative regulation of cell population proliferation (IMP) negative regulation of epidermal cell differentiation (IMP) negative regulation of epithelial cell differentiation (IMP) negative regulation of glial cell apoptotic process (IMP) negative regulation of inner ear auditory receptor cell differentiation (IMP) negative regulation of interleukin-10 production (IEA,ISO) negative regulation of myeloid cell differentiation (IDA) negative regulation of myoblast differentiation (IMP) negative regulation of neuron differentiation (IMP) negative regulation of Notch signaling pathway (IBA) nephron development (IMP) nervous system development (NAS) neuroepithelial cell differentiation (IMP) neuron differentiation (IMP) neuron fate specification (IDA) neuronal stem cell population maintenance (IMP) Notch signaling pathway (IBA,IEP,IMP,ISO,TAS) Notch signaling pathway involved in arterial endothelial cell fate commitment (IMP) odontogenesis of dentin-containing tooth (NAS) organ growth (IMP) positive regulation of cell population proliferation (IMP) positive regulation of endocytosis (IDA) positive regulation of gene expression (IMP,ISO) positive regulation of Notch signaling pathway (IDA,IMP,ISO) positive regulation of skeletal muscle tissue growth (IMP) positive regulation of sprouting angiogenesis (IMP) positive regulation of transcription by RNA polymerase II (IMP) proximal tubule development (IEP) proximal/distal pattern formation (IMP) regulation of blood pressure (IMP) regulation of cell adhesion (IMP) regulation of cell division (IMP) regulation of growth (IMP) regulation of neurogenesis (IMP) regulation of skeletal muscle tissue growth (IMP) regulation of somitogenesis (IMP) regulation of vascular endothelial growth factor receptor signaling pathway (IMP) regulation of vascular endothelial growth factor signaling pathway (IMP) retina development in camera-type eye (IMP) retina morphogenesis in camera-type eye (IMP) skeletal muscle tissue growth (IMP) skin epidermis development (IMP) somite specification (IMP) somitogenesis (IGI,IMP) spinal cord development (IMP) type B pancreatic cell development (IMP)
1.
JAGGED1 and delta1 differentially regulate the outcome of experimental autoimmune encephalomyelitis.
Elyaman W, etal., J Immunol. 2007 Nov 1;179(9):5990-8.
2.
Cell and molecular biology of Notch.
Fiuza UM and Arias AM, J Endocrinol. 2007 Sep;194(3):459-74.
3.
A family of mammalian Fringe genes implicated in boundary determination and the Notch pathway.
Johnston SH, etal., Development 1997 Jun;124(11):2245-54.
4.
Electronic Transfer of Homolog Data
MGD and Homologene mouse data transfer
5.
MGDs mouse GO annotations
MGD data from the GO Consortium
6.
MGD IEA
MGD IEA
7.
HNF3beta and Lim1 interact in the visceral endoderm to regulate primitive streak formation and anterior-posterior polarity in the mouse embryo.
Perea-Gomez A, etal., Development 1999 Oct;126(20):4499-511.
8.
Blocking the NOTCH pathway inhibits vascular inflammation in large-vessel vasculitis.
Piggott K, etal., Circulation. 2011 Jan 25;123(3):309-18. Epub 2011 Jan 10.
9.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
10.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
11.
Mouse MP Annotation Import Pipeline
RGD automated import pipeline
12.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
13.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
14.
Pancreatic regeneration in chronic pancreatitis requires activation of the notch signaling pathway.
Su Y, etal., J Gastrointest Surg. 2006 Nov;10(9):1230-41; discussion 1242.
Dll1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 17 15,587,616 - 15,597,275 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 17 15,587,616 - 15,597,134 (-) Ensembl GRCm39 Ensembl GRCm38 17 15,367,354 - 15,376,932 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 17 15,367,354 - 15,376,872 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 17 15,504,318 - 15,512,787 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 17 15,072,317 - 15,080,550 (-) NCBI MGSCv36 mm8 Celera 17 16,154,981 - 16,163,462 (-) NCBI Celera Cytogenetic Map 17 A2 NCBI cM Map 17 8.95 NCBI
DLL1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 170,282,206 - 170,291,078 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 170,282,206 - 170,306,565 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 170,591,294 - 170,600,166 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 170,433,219 - 170,441,622 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 6 170,508,932 - 170,517,112 NCBI Celera 6 171,388,861 - 171,397,261 (-) NCBI Celera Cytogenetic Map 6 q27 NCBI HuRef 6 168,098,039 - 168,106,439 (-) NCBI HuRef CHM1_1 6 170,851,870 - 170,860,273 (-) NCBI CHM1_1 T2T-CHM13v2.0 6 171,640,900 - 171,649,769 (-) NCBI T2T-CHM13v2.0
Dll1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 64,985,161 - 64,993,274 (-) NCBI GRCr8 mRatBN7.2 1 56,312,062 - 56,320,177 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 56,312,066 - 56,320,179 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 61,164,063 - 61,172,170 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 69,827,568 - 69,835,693 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 63,074,034 - 63,082,141 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 57,318,621 - 57,326,732 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 57,318,708 - 57,327,379 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 242,107,684 - 242,115,795 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 54,240,395 - 54,248,183 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 54,243,339 - 54,251,125 (-) NCBI Celera 1 52,521,212 - 52,529,325 (-) NCBI Celera Cytogenetic Map 1 q12 NCBI
Dll1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955411 3,478,033 - 3,486,604 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955411 3,478,943 - 3,486,541 (+) NCBI ChiLan1.0 ChiLan1.0
DLL1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 5 190,554,039 - 190,562,923 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 6 188,458,574 - 188,466,578 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 6 168,440,192 - 168,449,071 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 6 173,535,941 - 173,545,362 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 6 173,534,292 - 173,544,759 (-) Ensembl panpan1.1 panPan2
DLL1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 12 72,265,078 - 72,272,347 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 12 72,265,682 - 72,272,348 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 12 72,029,118 - 72,036,680 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 12 73,251,013 - 73,258,571 (-) NCBI ROS_Cfam_1.0 UMICH_Zoey_3.1 12 72,524,902 - 72,532,408 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 12 72,346,638 - 72,354,211 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 12 72,737,393 - 72,744,967 (-) NCBI UU_Cfam_GSD_1.0
Dll1
DLL1
DLL1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 13 97,928,480 - 97,936,594 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 13 97,928,634 - 97,936,589 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666040 69,934,302 - 69,943,226 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Dll1
.
Predicted Target Of
Count of predictions: 795 Count of miRNA genes: 506 Interacting mature miRNAs: 587 Transcripts: ENSMUST00000014917, ENSMUST00000124196, ENSMUST00000129395, ENSMUST00000140784, ENSMUST00000143460, ENSMUST00000152416 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
1558807 Ceat1_m chronic experimental autoimmune thyroiditis 1 (mouse) Not determined 17 12636682 26401133 Mouse 12910982 Pifs2_m peptide-induced fatal syndrome 2 (mouse) 17 1 26189355 Mouse 12910528 Nrq1_m noise-induced hearing loss resistant QTL 1 (mouse) 17 1 29198453 Mouse 1302100 Circp2_m circadian photosensitivity 2 (mouse) Not determined 17 1 29198453 Mouse 1300890 Bhr3_m bronchial hyperresponsiveness 3 (mouse) Not determined 17 3974890 48866091 Mouse 1357789 Kdnw3_m kidney weight 3 (mouse) Not determined 17 4854752 47885665 Mouse 1301338 Lmr1_m leishmaniasis resistance 1 (mouse) Not determined 17 10081340 86996400 Mouse 1300995 Fembrs4_m femur breaking strength 4 (mouse) Not determined 17 15061652 49061760 Mouse 4142507 Obrq13_m obesity resistance QTL 13 (mouse) Not determined 12198329 25076769 Mouse 1300613 Pcyts4_m plasmacytoma susceptibility 4 (mouse) Not determined 17 1 27081639 Mouse 4141608 Phl1_m progressive hearing loss 1 (mouse) Not determined 17 7875843 29487423 Mouse 1357452 Vtbt18_m vertebral trabecular bone trait 18 (mouse) Not determined 17 1 20975022 Mouse 1357902 Obq19_m obesity QTL 19 (mouse) Not determined 17 1 25662076 Mouse 1301327 Lmr7_m leishmaniasis resistance 7 (mouse) Not determined 17 4854752 27715939 Mouse 1302028 Asbb3_m autoimmune susceptibility in C57BL/6J and BALB/c 3 (mouse) Not determined 17 10878119 44878219 Mouse 4141215 Mnic1_m macronutrient intake, carbohydrate 1 (mouse) Not determined 4854752 45670266 Mouse 1300787 Cd8mts5_m CD8 memory T cell subset 5 (mouse) Not determined 17 8584914 42585149 Mouse 13524847 Asrq8a_m acoustic startle response 8a (mouse) 17 12646961 46646961 Mouse 1300914 Pcir4_m periosteal circumference 4 (mouse) Not determined 17 15061652 49061760 Mouse 14747010 Mancz14_m mandible centroid size 14 (mouse) 17 11998184 45998184 Mouse 1357680 Idd23_m insulin dependent diabetes susceptibility 23 (mouse) Not determined 17 3974890 26401133 Mouse 1302070 Tbbmd7_m total body bone mineral density 7 (mouse) Not determined 17 15061652 49061760 Mouse 1302196 Myaa1_m modifier of Yaa 1 (mouse) Not determined 17 1 20975022 Mouse 4141272 Tfv1_m total food volume 1 (mouse) Not determined 4854752 65637357 Mouse 10412276 Leci2_m leukocyte endothelial cell interactions 2 (mouse) Not determined 17 3348175 37348299 Mouse 1300706 Alan1_m alloantigen response 1 (mouse) Not determined 17 4854752 46469702 Mouse 1558886 Lgth9_m body length 9 (mouse) Not determined 17 15061652 49061760 Mouse 10043949 Pbft7_m percent body fat 7 (mouse) Not determined 17 6893936 40893936 Mouse 4141067 Hbnr2_m Heligmosomoides bakeri nematode resistance 2 (mouse) Not determined 11885971 45886119 Mouse 12904946 Tammq8_m tibialis anterior muscle mass QTL 8 (mouse) 17 12451787 46451787 Mouse 4142342 Lfnq4_m lung function QTL 4 (mouse) Not determined 11206484 39364059 Mouse 4142150 Stheal11_m soft tissue heal 11 (mouse) Not determined 17 12286211 83361768 Mouse 11081168 Tir7_m trypanosome infection response 7 (mouse) 17 14123372 48123496 Mouse 1357743 Lith3_m lithogenic gene 3 (mouse) Not determined 17 1 26194456 Mouse 12910527 Nrq1a_m noise-induced hearing loss resistant QTL 1a (mouse) 17 1 29198453 Mouse 1301615 Cfld3_m cystic fibrosis lung disease 3 (mouse) Not determined 17 1 27081639 Mouse 1301935 Skull24_m skull morphology 24 (mouse) Not determined 17 8584914 42585149 Mouse 13524851 Asrq8_m acoustic startle response 8 (mouse) 17 1 31030170 Mouse
Dll1
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 17 A2 UniSTS cM Map 17 8.2 UniSTS
UniSTS:237573
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 17 15,375,459 - 15,375,659 UniSTS GRCm38 MGSCv37 17 15,512,423 - 15,512,623 UniSTS GRCm37 Celera 17 16,163,098 - 16,163,298 UniSTS Cytogenetic Map 17 A2 UniSTS cM Map 17 8.2 UniSTS
UniSTS:225019
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 17 15,367,806 - 15,367,966 UniSTS GRCm38 MGSCv37 17 15,504,770 - 15,504,930 UniSTS GRCm37 Celera 17 16,155,433 - 16,155,593 UniSTS Cytogenetic Map 17 A2 UniSTS cM Map 17 8.2 UniSTS
PMC281641P2
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 17 15,374,728 - 15,374,820 UniSTS GRCm38 MGSCv37 17 15,511,692 - 15,511,784 UniSTS GRCm37 Celera 17 16,162,367 - 16,162,459 UniSTS Cytogenetic Map 17 A2 UniSTS cM Map 17 8.2 UniSTS
Dll1
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 17 15,367,871 - 15,368,602 UniSTS GRCm38 MGSCv37 17 15,504,835 - 15,505,566 UniSTS GRCm37 Celera 17 16,155,498 - 16,156,229 UniSTS Cytogenetic Map 17 A2 UniSTS
Dll1
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 17 A2 UniSTS
Dll1
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 17 A2 UniSTS
Dll1
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 17 A2 UniSTS
Dll1
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 17 15,368,586 - 15,368,693 UniSTS GRCm38 MGSCv37 17 15,505,550 - 15,505,657 UniSTS GRCm37 Celera 17 16,156,213 - 16,156,320 UniSTS Cytogenetic Map 17 A2 UniSTS
Dll1
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 17 15,367,796 - 15,368,040 UniSTS GRCm38 MGSCv37 17 15,504,760 - 15,505,004 UniSTS GRCm37 Celera 17 16,155,423 - 16,155,667 UniSTS Cytogenetic Map 17 A2 UniSTS cM Map 17 8.2 UniSTS
Dll1
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 17 15,367,697 - 15,368,495 UniSTS GRCm38 MGSCv37 17 15,504,661 - 15,505,459 UniSTS GRCm37 Celera 17 16,155,324 - 16,156,122 UniSTS Cytogenetic Map 17 A2 UniSTS cM Map 17 8.2 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000014917 ⟹ ENSMUSP00000014917
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 17 15,587,616 - 15,596,238 (-) Ensembl GRCm38.p6 Ensembl 17 15,367,354 - 15,375,976 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000124196
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 17 15,591,886 - 15,595,362 (-) Ensembl GRCm38.p6 Ensembl 17 15,371,624 - 15,375,100 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000129395
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 17 15,590,871 - 15,594,334 (-) Ensembl GRCm38.p6 Ensembl 17 15,370,609 - 15,374,072 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000140784
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 17 15,587,787 - 15,588,652 (-) Ensembl GRCm38.p6 Ensembl 17 15,367,525 - 15,368,390 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000143460 ⟹ ENSMUSP00000156341
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 17 15,595,056 - 15,597,134 (-) Ensembl GRCm38.p6 Ensembl 17 15,374,794 - 15,376,872 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000152416
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 17 15,590,518 - 15,592,093 (-) Ensembl GRCm38.p6 Ensembl 17 15,370,256 - 15,371,831 (-) Ensembl
RefSeq Acc Id:
NM_001379042 ⟹ NP_001365971
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 17 15,587,618 - 15,597,194 (-) NCBI GRCm38 17 15,367,356 - 15,376,932 (-) NCBI
Sequence:
GAGTGGGACCGGACACCAGTGAAGGTGGTGTTGGTTGAAAATCTCCCGGGAGAGGGTGTGTACACCGGGAAAGGGGTAAGCTTAGCTTTTGGCTCTGCTGGCTCAGGGAATACACTATCCGGACCCCA
hide sequence
RefSeq Acc Id:
NM_007865 ⟹ NP_031891
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 17 15,587,616 - 15,596,085 (-) NCBI GRCm38 17 15,367,354 - 15,375,823 (-) NCBI MGSCv37 17 15,504,318 - 15,512,787 (-) RGD Celera 17 16,154,981 - 16,163,462 (-) RGD cM Map 17 ENTREZGENE
Sequence:
CTTGGCGATAGTGCAAGAGATACCGGTCTAGAACACTCTGGGAGCGGCAGCGGCTGCCGAGTGACGCCGGGCCGGGAAACCAGGGCGCGCGCCGCAGTCCTTGCCACCACCGTTCCCACCGCGCCCCT
hide sequence
RefSeq Acc Id:
XM_011246267 ⟹ XP_011244569
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 17 15,587,616 - 15,596,411 (-) NCBI GRCm38 17 15,367,354 - 15,376,048 (-) NCBI
Sequence:
GAGGGTTGCACATTTTACAGCTCACTGACCATTTGGCGATCCATTGAGAGGAGGGTTTGGAAAAGTGGCTCCTTTGTGACAGCTCTCGCCAGATTGGGGGGCTGCTCATTTGCATCTCATTAGTTATG
hide sequence
RefSeq Acc Id:
XM_036160292 ⟹ XP_036016185
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 17 15,587,616 - 15,597,275 (-) NCBI
Sequence:
CCTTAATGACAGCCACGCGAACGACACACACCAAACTCACTTTTTACCAAGCAGAGGGAGGCCT
hide sequence
RefSeq Acc Id:
NP_031891 ⟸ NM_007865
- Peptide Label:
precursor
- UniProtKB:
Q6PFV7 (UniProtKB/Swiss-Prot), Q61483 (UniProtKB/Swiss-Prot)
- Sequence:
MGRRSALALAVVSALLCQVWSSGVFELKLQEFVNKKGLLGNRNCCRGGSGPPCACRTFFRVCLKHYQASVSPEPPCTYGSAVTPVLGVDSFSLPDGAGIDPAFSNPIRFPFGFTWPGTFSLIIEALHT
hide sequence
RefSeq Acc Id:
XP_011244569 ⟸ XM_011246267
- Peptide Label:
isoform X1
- Sequence:
MGRRSALALAVVSALLCQVWSSGVFELKLQEFVNKKGLLGNRNCCRGGSGPPCACRTFFRVCLKHYQASVSPEPPCTYGSAVTPVLGVDSFSLPDGAGIDPAFSNPIRFPFGFTWPGTFSLIIEALHT
hide sequence
RefSeq Acc Id:
NP_001365971 ⟸ NM_001379042
- Peptide Label:
precursor
- UniProtKB:
Q61483 (UniProtKB/Swiss-Prot), Q6PFV7 (UniProtKB/Swiss-Prot)
Ensembl Acc Id:
ENSMUSP00000156341 ⟸ ENSMUST00000143460
Ensembl Acc Id:
ENSMUSP00000014917 ⟸ ENSMUST00000014917
RefSeq Acc Id:
XP_036016185 ⟸ XM_036160292
- Peptide Label:
isoform X1
RGD ID: 6828007 Promoter ID: MM_KWN:22219 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Liver Transcripts: OTTMUST00000049751 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 17 15,505,871 - 15,506,371 (-) MPROMDB
RGD ID: 6828008 Promoter ID: MM_KWN:22221 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: ES_Cell Transcripts: OTTMUST00000049749 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 17 15,511,376 - 15,511,876 (-) MPROMDB
RGD ID: 6828005 Promoter ID: MM_KWN:22222 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, Spleen Transcripts: OTTMUST00000049746, OTTMUST00000049748 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 17 15,512,236 - 15,513,392 (-) MPROMDB
RGD ID: 6828006 Promoter ID: MM_KWN:22223 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: ES_Cell Transcripts: OTTMUST00000049747 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 17 15,513,516 - 15,514,016 (-) MPROMDB
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2017-10-31
Dll1
delta like canonical Notch ligand 1
delta-like 1 (Drosophila)
Symbol and/or name change
5135510 APPROVED
