Dll1 (delta like canonical Notch ligand 1)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Dll1 (delta like canonical Notch ligand 1) Rattus norvegicus

Analyze

Symbol:

Dll1

Name:

delta like canonical Notch ligand 1

RGD ID:

70949

Description:

Enables Notch binding activity. Involved in clathrin-dependent endocytosis and positive regulation of Notch signaling pathway. Predicted to be located in several cellular components, including adherens junction; apical plasma membrane; and membrane raft. Predicted to be active in plasma membrane. Orthologous to human DLL1 (delta like canonical Notch ligand 1); PARTICIPATES IN altered Notch signaling pathway; Notch signaling pathway; Notch signaling pathway; INTERACTS WITH 3-methylcholanthrene; 3H-1,2-dithiole-3-thione; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

delta (Drosophila)-like 1; delta-like 1 (Drosophila); delta-like protein 1; delta1; drosophila Delta homolog 1

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	DLL1 (delta like canonical Notch ligand 1)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI
Mus musculus (house mouse):	Dll1 (delta like canonical Notch ligand 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Dll1 (delta like canonical Notch ligand 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	DLL1 (delta like canonical Notch ligand 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	DLL1 (delta like canonical Notch ligand 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Dll1 (delta like canonical Notch ligand 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	DLL1 (delta like canonical Notch ligand 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	DLL1 (delta like canonical Notch ligand 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Dll1 (delta like canonical Notch ligand 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	KCNJ12 (potassium inwardly rectifying channel subfamily J member 12)	HGNC	OMA
Homo sapiens (human):	KCNJ18 (potassium inwardly rectifying channel subfamily J member 18)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	DLL1 (delta like canonical Notch ligand 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Dll1 (delta like canonical Notch ligand 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	dla (deltaA)	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	dld (deltaD)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Dl	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Dl	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	dsl-4	Alliance	DIOPT (Ensembl Compara\|OrthoFinder)
Xenopus tropicalis (tropical clawed frog):	dll1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	1	56,312,062 - 56,320,177 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	56,312,066 - 56,320,179 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	61,164,063 - 61,172,170 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	1	69,827,568 - 69,835,693 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	1	63,074,034 - 63,082,141 (-)	NCBI	Rnor_WKY
Rnor_6.0	1	57,318,621 - 57,326,732 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	57,318,708 - 57,327,379 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	242,107,684 - 242,115,795 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	54,240,395 - 54,248,183 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	54,243,339 - 54,251,125 (-)	NCBI
Celera	1	52,521,212 - 52,529,325 (-)	NCBI		Celera
Cytogenetic Map	1	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Brain Neoplasms (ISO)

Breast Neoplasms (ISO)

Chronic Pancreatitis (ISO)

Experimental Autoimmune Encephalomyelitis (ISO)

genetic disease (ISO)

holoprosencephaly (ISO)

methylmalonic aciduria and homocystinuria type cblC (ISO)

NEURODEVELOPMENTAL DISORDER WITH NONSPECIFIC BRAIN ABNORMALITIES AND WITH OR WITHOUT SEIZURES (ISO)

prostate cancer (ISO)

temporal arteritis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

3-methylcholanthrene (EXP)

3H-1,2-dithiole-3-thione (EXP)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

5-aza-2'-deoxycytidine (ISO)

6-propyl-2-thiouracil (EXP)

acetohydrazide (ISO)

acrylamide (EXP)

all-trans-retinoic acid (ISO)

alpha-naphthoflavone (EXP)

ammonium chloride (EXP)

antimycin A (ISO)

arsane (ISO)

arsenic atom (ISO)

atrazine (ISO)

azoxystrobin (EXP)

benzene (ISO)

benzo[a]pyrene (ISO)

bis(2-chloroethyl) sulfide (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

butan-1-ol (ISO)

butanal (ISO)

C60 fullerene (EXP)

cadmium atom (ISO)

cannabidiol (ISO)

carbon nanotube (ISO)

chlorpyrifos (EXP)

cisplatin (ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

dioxygen (EXP,ISO)

disulfiram (ISO)

dorsomorphin (ISO)

entinostat (ISO)

epoxiconazole (ISO)

ethanol (ISO)

flavonoids (EXP)

folic acid (ISO)

furan (EXP,ISO)

genistein (ISO)

glyphosate (EXP,ISO)

hydrazine (ISO)

imidacloprid (EXP)

linuron (EXP)

lipopolysaccharide (EXP,ISO)

maneb (ISO)

mercury dibromide (ISO)

methotrexate (ISO)

methylisothiazolinone (ISO)

methylmercury chloride (EXP,ISO)

N,N-diethyl-m-toluamide (EXP)

naphthalene (ISO)

nitrofen (EXP)

orphenadrine (EXP)

p-chloromercuribenzoic acid (ISO)

paraquat (ISO)

pentachlorophenol (ISO)

pentanal (ISO)

permethrin (EXP)

phenylmercury acetate (ISO)

pirinixic acid (ISO)

pregnenolone 16alpha-carbonitrile (ISO)

propanal (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

sodium arsenate (ISO)

tebufenpyrad (ISO)

temozolomide (ISO)

thiabendazole (EXP)

titanium dioxide (EXP,ISO)

trichloroethene (EXP,ISO)

trichostatin A (ISO)

triptonide (ISO)

urethane (ISO)

valproic acid (ISO)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

astrocyte development (IEA,ISO,ISS)

auditory receptor cell fate commitment (NAS)

cell fate determination (TAS)

cell-cell signaling (ISO)

cerebellar molecular layer formation (IEA,ISO,ISS)

cerebellar Purkinje cell layer structural organization (IEA,ISO,ISS)

clathrin-dependent endocytosis (IDA)

compartment pattern specification (IEA,ISO)

determination of left/right symmetry (ISO)

developmental process (IEA)

endothelial tip cell fate specification (IEA,ISO,ISS)

energy homeostasis (IEA,ISO,ISS)

heart looping (IEA,ISO)

inhibition of neuroepithelial cell differentiation (IEA,ISO)

inner ear auditory receptor cell differentiation (IEA,ISO)

inner ear development (ISO)

lateral inhibition (IEA,ISO,ISS)

left/right axis specification (IEA,ISO)

loop of Henle development (IEA,ISO)

marginal zone B cell differentiation (IEA,ISO,ISS)

myeloid cell differentiation (IEA,ISO)

negative regulation of cardiac muscle cell differentiation (IEA,ISO)

negative regulation of cell differentiation (ISO,ISS)

negative regulation of cell population proliferation (IEA,ISO,ISS)

negative regulation of epidermal cell differentiation (ISO,ISS)

negative regulation of epithelial cell differentiation (ISO,ISS)

negative regulation of glial cell apoptotic process (IEA,ISO,ISS)

negative regulation of inner ear auditory receptor cell differentiation (IEA,ISO)

negative regulation of interleukin-10 production (IEA,ISO)

negative regulation of myeloid cell differentiation (IEA,ISO)

negative regulation of myoblast differentiation (IEA,ISO,ISS)

negative regulation of neuron differentiation (ISO,ISS)

negative regulation of Notch signaling pathway (IBA)

nephron development (ISO,ISS)

nervous system development (NAS)

neuroepithelial cell differentiation (IEA,ISO)

neuron differentiation (ISO)

neuron fate specification (IEA,ISO,ISS)

neuronal stem cell population maintenance (IEA,ISO,ISS)

Notch signaling pathway (IBA,IEA,ISO,ISS,NAS)

Notch signaling pathway involved in arterial endothelial cell fate commitment (IEA,ISO,ISS)

organ growth (IEA,ISO,ISS)

positive regulation of cell population proliferation (IEA,ISO,ISS)

positive regulation of endocytosis (IEA,ISO,ISS)

positive regulation of gene expression (IEA,ISO)

positive regulation of Notch signaling pathway (IDA,IEA,ISO,ISS)

positive regulation of skeletal muscle tissue growth (IEA,ISO,ISS)

positive regulation of sprouting angiogenesis (IEA,ISO,ISS)

positive regulation of transcription by RNA polymerase II (IEA,ISO)

proximal tubule development (IEA,ISO)

proximal/distal pattern formation (IEA,ISO,ISS)

regulation of blood pressure (IEA,ISO,ISS)

regulation of cell adhesion (IEA,ISO)

regulation of cell division (IEA,ISO,ISS)

regulation of growth (ISO,ISS)

regulation of neurogenesis (IEA,ISO,ISS)

regulation of skeletal muscle tissue growth (ISO,ISS)

regulation of somitogenesis (IEA,ISO,ISS)

regulation of vascular endothelial growth factor receptor signaling pathway (IEA,ISO)

regulation of vascular endothelial growth factor signaling pathway (IEA,ISO,ISS)

retina development in camera-type eye (ISO,ISS)

retina morphogenesis in camera-type eye (IEA,ISO,ISS)

skeletal muscle tissue growth (IEA,ISO,ISS)

skin epidermis development (IEA,ISO,ISS)

somite specification (IEA,ISO)

somitogenesis (ISO,ISS)

spinal cord development (IEA,ISO,ISS)

type B pancreatic cell development (IEA,ISO,ISS)

Cellular Component

adherens junction (IEA,ISO,ISS)

apical plasma membrane (IEA,ISO,ISS)

cytoplasmic vesicle (IEA,ISO)

membrane (IEA)

membrane raft (IEA,ISO,ISS)

plasma membrane (IBA,ISO,TAS)

Molecular Function

calcium ion binding (IEA)

Notch binding (IBA,IEA,IPI,ISO,TAS)

protein binding (IPI,ISO)

receptor ligand activity (IEA,ISO)

scaffold protein binding (IEA,ISO)

Tat protein binding (IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

altered Notch signaling pathway (ISS)

Notch signaling pathway (IEA,ISO,TAS)

References

References - curated

#	Reference Title	Reference Citation
1.	JAGGED1 and delta1 differentially regulate the outcome of experimental autoimmune encephalomyelitis.	Elyaman W, etal., J Immunol. 2007 Nov 1;179(9):5990-8.
2.	Localisation of members of the notch system and the differentiation of vibrissa hair follicles: receptors, ligands, and fringe modulators.	Favier B, etal., Dev Dyn. 2000 Jul;218(3):426-37.
3.	Cell and molecular biology of Notch.	Fiuza UM and Arias AM, J Endocrinol. 2007 Sep;194(3):459-74.
4.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
6.	Human ligands of the Notch receptor.	Gray GE, etal., Am J Pathol 1999 Mar;154(3):785-94.
7.	Patterns of Jagged1, Jagged2, Delta-like 1 and Delta-like 3 expression during late embryonic and postnatal brain development suggest multiple functional roles in progenitors and differentiated cells.	Irvin DK, etal., J Neurosci Res 2004 Feb 1;75(3):330-43.
8.	Deciphering the Fringe-Mediated Notch Code: Identification of Activating and Inhibiting Sites Allowing Discrimination between Ligands.	Kakuda S and Haltiwanger RS, Dev Cell. 2017 Jan 23;40(2):193-201. doi: 10.1016/j.devcel.2016.12.013. Epub 2017 Jan 12.
9.	Expression patterns of Jagged, Delta1, Notch1, Notch2, and Notch3 genes identify ligand-receptor pairs that may function in neural development.	Lindsell CE, etal., Mol Cell Neurosci. 1996;8(1):14-27.
10.	Notch ligand endocytosis generates mechanical pulling force dependent on dynamin, epsins, and actin.	Meloty-Kapella L, etal., Dev Cell. 2012 Jun 12;22(6):1299-312. doi: 10.1016/j.devcel.2012.04.005. Epub 2012 May 31.
11.	Gene Data Set	MGD Curation, June 12, 2002
12.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
13.	Reactivation of Delta-Notch signaling after injury: complementary expression patterns of ligand and receptor in dental pulp.	Mitsiadis TA, etal., Exp Cell Res. 1999 Feb 1;246(2):312-8.
14.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
15.	Blocking the NOTCH pathway inhibits vascular inflammation in large-vessel vasculitis.	Piggott K, etal., Circulation. 2011 Jan 25;123(3):309-18. Epub 2011 Jan 10.
16.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
17.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
18.	GOA pipeline	RGD automated data pipeline
19.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
20.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
21.	Information Derived from GenBank Report	RGD, Sept. 2003
22.	Integrity of intracellular domain of Notch ligand is indispensable for cleavage required for release of the Notch2 intracellular domain.	Shimizu K, etal., EMBO J. 2002 Feb 1;21(3):294-302.
23.	Pancreatic regeneration in chronic pancreatitis requires activation of the notch signaling pathway.	Su Y, etal., J Gastrointest Surg. 2006 Nov;10(9):1230-41; discussion 1242.
24.	Cloning of a cDNA encoding a rat DNase II-like acid DNase.	Tanuma S and Shiokawa D, Biochem Biophys Res Commun 1999 Nov 19;265(2):395-9.

Additional References at PubMed

PMID:9858718	PMID:9882480	PMID:10473134	PMID:10476967	PMID:10958687	PMID:11006133	PMID:11076679	PMID:11581320	PMID:11912004	PMID:12001066	PMID:12730124	PMID:14960495
PMID:15146182	PMID:15509766	PMID:15574878	PMID:15821257	PMID:15902259	PMID:15908431	PMID:16000382	PMID:16495313	PMID:16621992	PMID:17194759	PMID:17960184	PMID:18371447
PMID:18418349	PMID:18449946	PMID:18676613	PMID:18997111	PMID:19144989	PMID:19217325	PMID:19389377	PMID:19481784	PMID:19562077	PMID:19682396	PMID:20081190	PMID:21238454
PMID:21915337	PMID:21985982	PMID:22096075	PMID:22282195	PMID:22529374	PMID:22940113	PMID:23072809	PMID:23086448	PMID:23688253	PMID:23695674	PMID:23806616	PMID:24715457
PMID:25220152	PMID:26114479	PMID:26355680	PMID:29181775	PMID:32703409

Genomics

Comparative Map Data

Dll1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	1	56,312,062 - 56,320,177 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	56,312,066 - 56,320,179 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	61,164,063 - 61,172,170 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	1	69,827,568 - 69,835,693 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	1	63,074,034 - 63,082,141 (-)	NCBI	Rnor_WKY
Rnor_6.0	1	57,318,621 - 57,326,732 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	57,318,708 - 57,327,379 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	242,107,684 - 242,115,795 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	54,240,395 - 54,248,183 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	54,243,339 - 54,251,125 (-)	NCBI
Celera	1	52,521,212 - 52,529,325 (-)	NCBI		Celera
Cytogenetic Map	1	q12	NCBI

DLL1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	170,282,206 - 170,291,078 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	6	170,282,206 - 170,306,565 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	6	170,591,294 - 170,600,166 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	170,433,219 - 170,441,622 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	6	170,508,932 - 170,517,112	NCBI
Celera	6	171,388,861 - 171,397,261 (-)	NCBI		Celera
Cytogenetic Map	6	q27	NCBI
HuRef	6	168,098,039 - 168,106,439 (-)	NCBI		HuRef
CHM1_1	6	170,851,870 - 170,860,273 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	6	171,640,900 - 171,649,769 (-)	NCBI		T2T-CHM13v2.0

Dll1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	17	15,587,616 - 15,597,275 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	17	15,587,616 - 15,597,134 (-)	Ensembl		GRCm39 Ensembl
GRCm38	17	15,367,354 - 15,376,932 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	17	15,367,354 - 15,376,872 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	17	15,504,318 - 15,512,787 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	17	15,072,317 - 15,080,550 (-)	NCBI		MGSCv36	mm8
Celera	17	16,154,981 - 16,163,462 (-)	NCBI		Celera
Cytogenetic Map	17	A2	NCBI
cM Map	17	8.95	NCBI

Dll1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955411	3,478,033 - 3,486,604 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955411	3,478,943 - 3,486,541 (+)	NCBI	ChiLan1.0	ChiLan1.0

DLL1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	6	188,458,574 - 188,466,578 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	168,440,192 - 168,449,071 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	173,535,941 - 173,545,362 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	173,534,292 - 173,544,759 (-)	Ensembl	panpan1.1		panPan2

DLL1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	12	72,265,078 - 72,272,347 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	12	72,265,682 - 72,272,348 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	12	72,029,118 - 72,036,680 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	12	73,251,013 - 73,258,571 (-)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	12	72,524,902 - 72,532,408 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	12	72,346,638 - 72,354,211 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	12	72,737,393 - 72,744,967 (-)	NCBI		UU_Cfam_GSD_1.0

Dll1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	151,369,680 - 151,377,618 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004937098	213,227 - 220,427 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004937098	212,704 - 220,589 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

DLL1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	199,358 - 211,346 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	198,815 - 211,346 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	280,640 - 291,729 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

DLL1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	13	97,928,480 - 97,936,594 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	13	97,928,634 - 97,936,589 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666040	69,934,302 - 69,943,226 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Dll1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624850	6,134,908 - 6,143,404 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624850	6,135,214 - 6,142,975 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Dll1
13 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	89
Count of miRNA genes:	72
Interacting mature miRNAs:	75
Transcripts:	ENSRNOT00000019934
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
738020	Pia8	Pristane induced arthritis QTL 8	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	1	65833076	Rat
1554320	Bmd1	Bone mineral density QTL 1	12.2	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	509108	86060548	Rat
631688	Hcas2	Hepatocarcinoma susceptibility QTL 2	3	0.0001	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	5925874	115540829	Rat
1300167	Hrtrt2	Heart rate QTL 2	4.35		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	11481312	75088344	Rat
2313062	Bmd73	Bone mineral density QTL 73	3.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	11481312	82174945	Rat
2313065	Bss67	Bone structure and strength QTL 67	3.1	0.0001	tibia area (VT:1000281)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
2313069	Bss68	Bone structure and strength QTL 68	2.9	0.0001	tibia size trait (VT:0100001)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
2313075	Bss66	Bone structure and strength QTL 66	3.4	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	11481312	82174945	Rat
2313077	Bss69	Bone structure and strength QTL 69	3.5	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	11481312	82174945	Rat
2313092	Bmd72	Bone mineral density QTL 72	2.5	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	11481312	82174945	Rat
2313097	Bss70	Bone structure and strength QTL 70	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
1578756	Iddm22	Insulin dependent diabetes mellitus QTL 22	2.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	11835181	56835181	Rat
634353	Rends2	Renal damage susceptibility QTL 2		0.05	kidney blood vessel morphology trait (VT:0000530)	organ lesion measurement (CMO:0000677)	1	19333571	56983283	Rat
724520	Bp145	Blood pressure QTL 145	2.1	0.0024	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	20784828	65784828	Rat
1357400	Bw62	Body weight QTL62	4.05		inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	1	22340647	67340647	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	22340647	102268831	Rat
1331785	Rf27	Renal function QTL 27	4.643		urine sodium amount (VT:0006274)	urine sodium level (CMO:0000129)	1	28879780	78430678	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	30882023	123479925	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32356093	162846471	Rat
1300172	Bp172	Blood pressure QTL 172	3.56		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	32737273	90665040	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32737458	199368955	Rat
1354599	Bw29	Body weight QTL 29	3.46	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	1	33449848	78449848	Rat
1354643	Foco2	Food consumption QTL 2	7.17	0.0001	eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	1	33449848	78449848	Rat
8552900	Pigfal1	Plasma insulin-like growth factor 1 level QTL 1	7.4		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	1	34836858	79836858	Rat
8552948	Pigfal11	Plasma insulin-like growth factor 1 level QTL 11	4.7		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	1	34836858	79836858	Rat
9589820	Insglur3	Insulin/glucose ratio QTL 3	10.75	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	1	34836858	79836858	Rat
1331732	Srn4	Serum renin concentration QTL 4	4.467		renin activity (VT:0005581)	plasma renin activity level (CMO:0000116)	1	35239598	78430678	Rat
1331792	Rf29	Renal function QTL 29	4.589		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	1	35239598	78430678	Rat
2313051	Bss57	Bone structure and strength QTL 57	3.7	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	43284731	118944897	Rat
2313059	Bss55	Bone structure and strength QTL 55	3.2	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
2313072	Bss53	Bone structure and strength QTL 53	4.3	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	43284731	118944897	Rat
2313078	Bss54	Bone structure and strength QTL 54	3.5	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
2313094	Bss58	Bone structure and strength QTL 58	3.7	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	43284731	118944897	Rat
2313098	Bmd70	Bone mineral density QTL 70	3.6	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	43284731	118944897	Rat
2313099	Bss56	Bone structure and strength QTL 56	2.4	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	1	43284731	118944897	Rat
2302059	Pia36	Pristane induced arthritis QTL 36	3.8	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	1	43333002	88333002	Rat
1331778	Rf28	Renal function QTL 28	4.66		urine potassium amount (VT:0010539)	urine potassium excretion rate (CMO:0000761)	1	45803140	78430678	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	48963584	144267916	Rat
4889962	Bss94	Bone structure and strength QTL 94	3.8		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	1	49361465	82174945	Rat
1578649	Bmd8	Bone mineral density QTL 8	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	49393172	94393172	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	49393172	159356837	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	49393289	199050459	Rat
6903308	Scl36	Serum cholesterol QTL 36	2	0.0125	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	53863041	90532583	Rat
4889919	Bss86	Bone structure and strength QTL 86	4.1		tibia area (VT:1000281)	tibia midshaft total cross-sectional area (CMO:0001715)	1	53895117	82174945	Rat
4889929	Bss87	Bone structure and strength QTL 87	6.7		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	1	53895117	82174945	Rat

Markers in Region

UniSTS:465448

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	56,313,301 - 56,313,409 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	57,319,861 - 57,319,968	NCBI	Rnor6.0
Rnor_5.0	1	242,108,924 - 242,109,031	UniSTS	Rnor5.0
RGSC_v3.4	1	54,241,310 - 54,241,417	UniSTS	RGSC3.4
Celera	1	52,522,452 - 52,522,559	UniSTS
Cytogenetic Map	1	q12	UniSTS

Dll1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	56,312,413 - 56,313,211 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	57,318,973 - 57,319,770	NCBI	Rnor6.0
Rnor_5.0	1	242,108,036 - 242,108,833	UniSTS	Rnor5.0
RGSC_v3.4	1	54,240,422 - 54,241,219	UniSTS	RGSC3.4
Celera	1	52,521,564 - 52,522,361	UniSTS
Cytogenetic Map	1	q12	UniSTS

Dll1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	56,312,588 - 56,313,318 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	57,319,148 - 57,319,877	NCBI	Rnor6.0
Rnor_5.0	1	242,108,211 - 242,108,940	UniSTS	Rnor5.0
RGSC_v3.4	1	54,240,597 - 54,241,326	UniSTS	RGSC3.4
Celera	1	52,521,739 - 52,522,468	UniSTS
Cytogenetic Map	1	q12	UniSTS

Dll1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	56,312,188 - 56,313,417 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	57,318,748 - 57,319,976	NCBI	Rnor6.0
Rnor_5.0	1	242,107,811 - 242,109,039	UniSTS	Rnor5.0
Celera	1	52,521,339 - 52,522,567	UniSTS
Cytogenetic Map	1	q12	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium					11				49	10	2	11
Low	3	43	57	41	8	41	8	11	25	25	35		8
Below cutoff											4

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_032063	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH474033	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000023	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U78889	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000080429 ⟹ ENSRNOP00000073159

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	56,312,066 - 56,320,179 (-)	Ensembl
Rnor_6.0 Ensembl	1	57,318,708 - 57,327,379 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000113128 ⟹ ENSRNOP00000089438

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	56,312,678 - 56,320,179 (-)	Ensembl

RefSeq Acc Id:

NM_032063 ⟹ NP_114452

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	1	56,312,062 - 56,320,177 (-)	NCBI
Rnor_6.0	1	57,318,621 - 57,326,732 (-)	NCBI
Rnor_5.0	1	242,107,684 - 242,115,795 (-)	NCBI
RGSC_v3.4	1	54,240,395 - 54,248,183 (-)	RGD
Celera	1	52,521,212 - 52,529,325 (-)	NCBI

Sequence:

show sequence

GGCACGAGAAAACCAGAAAGCAGGCGACCCTCACTTACCCGTGGACTGGAAGCCAGAAGAAGAG
GAAACCGAAAGTTGTCCTTTCTCAGTGCCTCGCAGAGCTCTTGTCAGGGACATATCTGTAGCAC
CGCACCCTCCTGAAGCGACCTGGCCCGATATCACACCTGGAGCCGAGAGGCGCCTTTCCACCAG
TGCTCCTCGGGTCACATAGACTTTCCGGGCATCCCTGGGTCTTTGAAGAAGAAAGAAAAGAGAT
ACTCTAGGAGAGTCAAGGGCGTCCAGCGGTACCATGGGCCGTCGGAGCGCGCTAGCCCTTGCCG
TGGTCTCAGCCCTGCTGTGCCAGGTCTGGAGCTCTGGCGTATTTGAGCTGAAGCTGCAGGAGTT
CGTCAACAAGAAGGGGCTGCTGGGGAACCGCAACTGCTGCCGCGGGGGCTCTGGCCCGCCGTGC
GCCTGCAGGACCTTCTTTCGCGTATGCCTCAAGCATTACCAGGCCAGCGTGTCCCCGGAGCCAC
CCTGCACCTACGGCAGTGCGGTCACCGCAGTGCTGGGTGTCGACTCCTTCAGCCTGCCTGATGG
CGCAGGCATCGACCCCGCCTTCAGCAACCCCATCCGATTCCCCTTCGGATTCACCTGGCCAGGT
ACCTTCTCTCTGATCATTGAAGCCCTCCACACAGATTCTCCTGACGACCTCGCAACAGAAAACC
CAGAAAGACTCATCAGCCGCCTGACCACACAGAGGCACCTCACTGTGGGAGAAGAGTGGTCTCA
GGACCTTCACAGTAGCGGCCGCACAGACCTCCGCTACTCTTACCGGTTTGTGTGTGATGAACAC
TACTATGGAGAAGGCTGCTCCGTGTTCTGCCGACCGCGGGATGATGCCTTTGGCCACTTCACCT
GCGGGGAGAGAGGGGAGAAGATGTGCGACCCTGGCTGGAAAGGCCAGTACTGCACTGACCCCAT
TTGTCTGCCAGGCTGTGATGACCAACATGGATATTGTGACAAACCGGGGGAATGCAAGTGCAGA
GTTGGCTGGCAGGGCCGCTACTGCGATGAATGCATCCGATACCCAGGCTGTCTCCATGGTACCT
GCCAGCAGCCCTGGCAGTGTAACTGCCAGGAAGGCTGGGGGGGCCTCTTCTGCAACCAGGATCT
GAACTACTGCACTCACCATAAGCCATGCAGGAACGGAGCCACCTGCACCAACACGGGCCAGGGG
AGCTACACATGCTCTTGCCGACCCGGGTATACAGGGGCCAACTGTGAGCTGGAGGTAGATGAGT
GTGCTCCCAGCCCCTGCAGGAATGGAGGGAGCTGCACGGATCTTGAGGACAGCTACTCTTGCAC
CTGCCCTCCTGGCTTCTATGGCAAGGTCTGTGAGCTGAGCGCCATGACGTGTGCAGATGGTCCT
TGCTTCAATGGGGGACGATGTTCGGATAACCCCGATGGAGGCTACACCTGCCATTGCCCTGCGG
GCTTCTCTGGCTTCAACTGTGAGAAGAAGATTGATCTCTGTAGCTCTTCCCCTTGTTCTAACGG
TGCCAAGTGTGTGGACCTCGGCAACTCCTACCTGTGCCGATGTCAGACTGGCTTCTCCGGGAGG
TACTGCGAGGACAATGTGGATGACTGTGCCTCTTCTCCCTGTGCAAACGGGGGCACCTGCCGGG
ACAGTGTGAACGATTTCTCCTGTACCTGCCCACCTGGCTACACAGGCAGGAACTGCAGCGCCCC
TGTCAGCAGGTGTGAGCATGCACCCTGTCATAACGGGGCCACCTGCCACCAGAGGGGCCAACGC
TACATGTGTGAGTGCGCCCAGGGCTATGGCGGCGCCAACTGCCAGTTCCTGCTCCCTGAGCCAC
CACCAGACCTCATAGTGGCGGCCCAGGGCGGGTCCTTCCCCTGGGTGGCTGTGTGTGCCGGGGT
GGTGCTTGTCCTCCTGCTGCTGCTGGGCTGTGCTGCTGTGGTGGTCTGCGTCCGGCTGAAGCTA
CAGAAACACCAGCCTCCGCCTGATCCTTGCGGGGGAGAGACAGAGACCATGAACAACCTAGCCA
ATTGCCAGCGTGAGAAGGATGTTTCTGTTAGCATCATTGGGGCTACACAGATCAAGAACACCAA
CAAGAAGGCGGACTTTCATGGGGACCATGGTGCTGACAAGAGCAGCTTTAAGGCCCGATACCCC
ACTGTGGACTATAACCTCATTCGAGACCTCAAGGGAGATGAAGCCACGGTCAGGGATGCACACA
GCAAACGTGACACCAAGTGCCAGTCACAGGGCTCTGTAGGAGAAGAGAAGAGCACCTCAACGCT
CAGGGGTGGGGAGGTTCCCGACAGAAAAAGGCCCGAGTCTGTCTACTCTACTTCAAAGGACACC
AAGTACCAGTCGGTGTATGTTCTATCTGCAGAAAAGGATGAGTGTGTTATAGCGACTGAGGTTT
AAGGTGGAAGTGATGTGGCAAAGTTCCCATTTCTCTTAAATAAAATTCCAAGGATATAGCCCCG
AGGAATGCTGCTGAGAGAGGAACCGGAGAGGAAACCCCAGGGACTGCTGCTGAGAAACAGACTC
AGGCGGAGGGTTCATCTCGGAGTTAGCAGAGAACCGGACACACCCAGCCCAGGATTGATGCCGC
TGTACTGCCTGCTGGATGTTCCCGTTGCACTATGGACAGTTGCTTTGAAGAGTATAATATTTAA
ATGGACGAGTGACTTGAGTTCACACAGGAAGCACGCACTGCCGGACATGTCTATCTTGGATACT
ATGAGCCAGTCTTTCCTTGAACTAGAAACACAACTGCCTTTATTGTCCTTTTTGATACTGAAAT
GTGGTTTGTTTTTTTTTTTTTTTCTAGAAGGGGAAAAAAAAACGTGTGTTATTTTTTTGGATTT
GTAAAAATATTTTTCATGATATCTGTAAAGCTTGAGTATTTTGTGATGTTCATTTTTTTTATAA
TTTAAATTTTTGGTAAATATGTACAAAGGCACTTCGGGTCTATGTGACTATATTTTTTTGTATA
TAAATGTATTTATGGAATATTGTGCAAATGTTATTTGAGTTTTTTTTACTGTTTTGTTAATGAA
GAAATTCATTTTAAAAATATTTTTCCAAAATAAATATAATGAACTACAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_114452	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAB37343	(Get FASTA)	NCBI Sequence Viewer
	EDL99825	(Get FASTA)	NCBI Sequence Viewer
	P97677	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_114452 ⟸ NM_032063
- Peptide Label:	precursor
- UniProtKB:	G3V7W6 (UniProtKB/TrEMBL)
- Sequence:	show sequence MGRRSALALAVVSALLCQVWSSGVFELKLQEFVNKKGLLGNRNCCRGGSGPPCACRTFFRVCLK HYQASVSPEPPCTYGSAVTAVLGVDSFSLPDGAGIDPAFSNPIRFPFGFTWPGTFSLIIEALHT DSPDDLATENPERLISRLTTQRHLTVGEEWSQDLHSSGRTDLRYSYRFVCDEHYYGEGCSVFCR PRDDAFGHFTCGERGEKMCDPGWKGQYCTDPICLPGCDDQHGYCDKPGECKCRVGWQGRYCDEC IRYPGCLHGTCQQPWQCNCQEGWGGLFCNQDLNYCTHHKPCRNGATCTNTGQGSYTCSCRPGYT GANCELEVDECAPSPCRNGGSCTDLEDSYSCTCPPGFYGKVCELSAMTCADGPCFNGGRCSDNP DGGYTCHCPAGFSGFNCEKKIDLCSSSPCSNGAKCVDLGNSYLCRCQTGFSGRYCEDNVDDCAS SPCANGGTCRDSVNDFSCTCPPGYTGRNCSAPVSRCEHAPCHNGATCHQRGQRYMCECAQGYGG ANCQFLLPEPPPDLIVAAQGGSFPWVAVCAGVVLVLLLLLGCAAVVVCVRLKLQKHQPPPDPCG GETETMNNLANCQREKDVSVSIIGATQIKNTNKKADFHGDHGADKSSFKARYPTVDYNLIRDLK GDEATVRDAHSKRDTKCQSQGSVGEEKSTSTLRGGEVPDRKRPESVYSTSKDTKYQSVYVLSAE KDECVIATEV hide sequence

RefSeq Acc Id:

ENSRNOP00000073159 ⟸ ENSRNOT00000080429

RefSeq Acc Id:

ENSRNOP00000089438 ⟸ ENSRNOT00000113128

Protein Domains

DSL EGF-like

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P97677-F1-model_v2	AlphaFold	P97677	1-714	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13689642

Promoter ID:

EPDNEW_R167

Type:

single initiation site

Name:

Dll1_1

Description:

delta like canonical Notch ligand 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	57,327,192 - 57,327,252	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:70949	AgrOrtholog
BioCyc Gene	G2FUF-61314	BioCyc
Ensembl Genes	ENSRNOG00000059984	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000073159	ENTREZGENE
	ENSRNOP00000073159.1	UniProtKB/TrEMBL
	ENSRNOP00000089438.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000080429	ENTREZGENE
	ENSRNOT00000080429.2	UniProtKB/TrEMBL
	ENSRNOT00000113128.1	UniProtKB/TrEMBL
Gene3D-CATH	2.10.25.140	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	2.60.40.3510	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Laminin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	DSL	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	EGF-like_Ca-bd_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	EGF-like_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	EGF-type_Asp/Asn_hydroxyl_site	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	EGF_Ca-bd_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Growth_fac_rcpt_cys_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Notch_ligand_N	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:84010	UniProtKB/Swiss-Prot
NCBI Gene	84010	ENTREZGENE
PANTHER	CYTOCHROME C OXIDASE POLYPEPTIDE VIC-2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	DSL	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	EGF	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	EGF_CA	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	MNNL	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Dll1	PhenoGen
PRINTS	EGFBLOOD	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	ASX_HYDROXYL	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	DSL	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	EGF_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	EGF_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	EGF_3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	EGF_CA	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	DSL	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	EGF	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	EGF_CA	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	EGF/Laminin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SSF57184	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I6A9U8_RAT	UniProtKB/TrEMBL
	DLL1_RAT	UniProtKB/Swiss-Prot
	G3V7W6	ENTREZGENE, UniProtKB/TrEMBL
	P97677	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-05-20	Dll1	delta like canonical Notch ligand 1	Dll1	delta-like 1 (Drosophila)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-07-09	Dll1	delta-like 1 (Drosophila)			Symbol and Name updated to reflect Human and Mouse nomenclature	70877	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed in neurons and glia of the brain during late embryonic and early postnatal development; in embryonic stages, present in cells lining the ventricles and in the germinal center in astrocyte precursors; during the first 2 weeks postnatal, found in white matter tracts of the brain	1304491

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)