Symbol:
ARF5
Name:
ARF GTPase 5 (Ensembl:ADP ribosylation factor 5)
RGD ID:
732462
HGNC Page
HGNC:658
Description:
Predicted to enable GTP binding activity. Involved in retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum. Located in extracellular exosome.
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
ADP ribosylation factor 5; ADP-ribosylation factor 5
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Mus musculus (house mouse):
Arf5 (ARF GTPase 5) HGNC
Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Arf5 (ARF GTPase 5) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Chinchilla lanigera (long-tailed chinchilla):
Arf5 (ARF GTPase 5) NCBI
Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):
ARF5 (ARF GTPase 5) NCBI
Ortholog
Canis lupus familiaris (dog):
ARF5 (ADP ribosylation factor 5) HGNC
Ensembl, HomoloGene, NCBI, OrthoMCL, Panther, PhylomeDB, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Arf5 (ARF GTPase 5) NCBI
Ortholog
Sus scrofa (pig):
ARF5 (ADP ribosylation factor 5) HGNC
Ensembl, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Chlorocebus sabaeus (green monkey):
ARF5 (ARF GTPase 5) NCBI
Ortholog
Heterocephalus glaber (naked mole-rat):
Arf5 (ARF GTPase 5) NCBI
Ortholog
Other homologs 2
Rattus norvegicus (Norway rat):
Arf4 (ARF GTPase 4) HGNC
OrthoDB
Mus musculus (house mouse):
Arf4 (ARF GTPase 4) HGNC
OrthoDB
Canis lupus familiaris (dog):
ARF4 (ADP ribosylation factor 4) HGNC
OrthoDB
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Arf5 (ARF GTPase 5)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Arf5 (ARF GTPase 5)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
arf4a (ADP-ribosylation factor 4a)
Alliance
DIOPT (OMA|OrthoFinder|PhylomeDB)
Danio rerio (zebrafish):
zgc:77650
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Danio rerio (zebrafish):
arf5 (ADP-ribosylation factor 5)
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
Arf102F
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
arf-3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Xenopus laevis (African clawed frog):
arf5.S
Alliance
DIOPT (Xenbase)
Xenopus laevis (African clawed frog):
arf5.L
Alliance
DIOPT (Xenbase)
Allele / Splice:
See ClinVar data
Latest Assembly:
GRCh38 - Human Genome Assembly GRCh38
Position:
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 7 127,588,411 - 127,591,700 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 7 127,588,386 - 127,591,700 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 7 127,228,465 - 127,231,754 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 7 127,015,753 - 127,018,988 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 7 126,822,467 - 126,825,703 NCBI Celera 7 122,032,245 - 122,035,480 (+) NCBI Celera Cytogenetic Map 7 q32.1 NCBI HuRef 7 121,589,476 - 121,592,829 (+) NCBI HuRef CHM1_1 7 127,161,703 - 127,165,056 (+) NCBI CHM1_1 T2T-CHM13v2.0 7 128,900,090 - 128,903,379 (+) NCBI T2T-CHM13v2.0 CRA_TCAGchr7v2 7 126,611,851 - 126,615,204 (+) NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
ARF5 Human 1,2-dimethylhydrazine increases expression ISO Arf5 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of ARF5 mRNA CTD PMID:22206623 ARF5 Human 1-chloro-2,4-dinitrobenzene affects binding EXP 6480464 Dinitrochlorobenzene binds to ARF5 protein CTD PMID:32991956 ARF5 Human 17beta-estradiol decreases expression ISO Arf5 (Mus musculus) 6480464 Estradiol results in decreased expression of ARF5 mRNA CTD PMID:39298647 ARF5 Human 2,2',4,4'-Tetrabromodiphenyl ether decreases expression EXP 6480464 2 more ... CTD PMID:31675489 ARF5 Human 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Arf5 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of ARF5 mRNA CTD PMID:21215274 and PMID:32109520 ARF5 Human 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Arf5 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in increased expression of ARF5 mRNA CTD PMID:33387578 ARF5 Human 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Arf5 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of ARF5 mRNA CTD PMID:21570461 ARF5 Human 3,3',5,5'-tetrabromobisphenol A decreases expression EXP 6480464 tetrabromobisphenol A results in decreased expression of ARF5 protein CTD PMID:31675489 ARF5 Human 3,4-methylenedioxymethamphetamine increases expression ISO Arf5 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of ARF5 mRNA CTD PMID:20188158 ARF5 Human 4,4'-sulfonyldiphenol multiple interactions ISO Arf5 (Rattus norvegicus) 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of ARF5 mRNA CTD PMID:36041667 ARF5 Human ammonium chloride affects expression ISO Arf5 (Rattus norvegicus) 6480464 Ammonium Chloride affects the expression of ARF5 mRNA CTD PMID:16483693 ARF5 Human arsenite(3-) multiple interactions EXP 6480464 arsenite promotes the reaction [G3BP1 protein binds to ARF5 mRNA] CTD PMID:32406909 ARF5 Human atrazine increases expression EXP 6480464 Atrazine results in increased expression of ARF5 mRNA CTD PMID:22378314 ARF5 Human benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of ARF5 mRNA CTD PMID:20106945 ARF5 Human benzo[a]pyrene increases expression ISO Arf5 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of ARF5 mRNA CTD PMID:22228805 ARF5 Human bis(2-ethylhexyl) phthalate decreases expression ISO Arf5 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of ARF5 mRNA CTD PMID:34319233 ARF5 Human bis(2-ethylhexyl) phthalate increases expression ISO Arf5 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of ARF5 mRNA CTD PMID:33754040 ARF5 Human bisphenol A increases expression ISO Arf5 (Rattus norvegicus) 6480464 bisphenol A results in increased expression of ARF5 mRNA CTD PMID:25181051 and PMID:32145629 ARF5 Human bisphenol A multiple interactions ISO Arf5 (Rattus norvegicus) 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of ARF5 mRNA CTD PMID:36041667 ARF5 Human bisphenol A increases expression ISO Arf5 (Mus musculus) 6480464 bisphenol A results in increased expression of ARF5 mRNA CTD PMID:32156529 ARF5 Human bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of ARF5 mRNA CTD PMID:30903817 ARF5 Human bisphenol F decreases expression ISO Arf5 (Mus musculus) 6480464 bisphenol F results in decreased expression of ARF5 mRNA CTD PMID:38685157 ARF5 Human bisphenol F multiple interactions ISO Arf5 (Rattus norvegicus) 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of ARF5 mRNA CTD PMID:36041667 ARF5 Human butan-1-ol multiple interactions EXP 6480464 [[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in increased expression of ARF5 mRNA CTD PMID:29432896 ARF5 Human carbon nanotube decreases expression ISO Arf5 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 ARF5 Human CGP 52608 multiple interactions EXP 6480464 CGP 52608 promotes the reaction [RORA protein binds to ARF5 gene] CTD PMID:28238834 ARF5 Human chlorpyrifos increases expression ISO Arf5 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of ARF5 mRNA CTD PMID:37019170 ARF5 Human clobetasol increases expression ISO Arf5 (Mus musculus) 6480464 Clobetasol results in increased expression of ARF5 mRNA CTD PMID:27462272 ARF5 Human clofibrate decreases expression ISO Arf5 (Mus musculus) 6480464 Clofibrate results in decreased expression of ARF5 mRNA CTD PMID:17585979 ARF5 Human dibutyl phthalate decreases expression ISO Arf5 (Rattus norvegicus) 6480464 Dibutyl Phthalate results in decreased expression of ARF5 mRNA CTD PMID:17379624 ARF5 Human dichlorine increases expression ISO Arf5 (Rattus norvegicus) 6480464 Chlorine results in increased expression of ARF5 mRNA CTD PMID:18636392 ARF5 Human dichlorine multiple interactions ISO Arf5 (Rattus norvegicus) 6480464 [Ozone co-treated with Chlorine] results in decreased expression of ARF5 mRNA CTD PMID:18636392 ARF5 Human diethylstilbestrol decreases expression EXP 6480464 Diethylstilbestrol results in decreased expression of ARF5 mRNA CTD PMID:36621641 ARF5 Human disodium selenite increases expression EXP 6480464 Sodium Selenite results in increased expression of ARF5 mRNA CTD PMID:18175754 ARF5 Human doxorubicin decreases expression EXP 6480464 Doxorubicin results in decreased expression of ARF5 mRNA CTD PMID:29803840 ARF5 Human elemental selenium increases expression EXP 6480464 Selenium results in increased expression of ARF5 mRNA CTD PMID:19244175 ARF5 Human fenthion increases expression ISO Arf5 (Mus musculus) 6480464 Fenthion results in increased expression of ARF5 mRNA CTD PMID:34813904 ARF5 Human flavonoids decreases expression ISO Arf5 (Rattus norvegicus) 6480464 Flavonoids results in decreased expression of ARF5 mRNA CTD PMID:18035473 ARF5 Human gentamycin decreases expression ISO Arf5 (Rattus norvegicus) 6480464 Gentamicins results in decreased expression of ARF5 mRNA CTD PMID:33387578 ARF5 Human ivermectin decreases expression EXP 6480464 Ivermectin results in decreased expression of ARF5 protein CTD PMID:32959892 ARF5 Human mercury dichloride increases expression ISO Arf5 (Rattus norvegicus) 6480464 Mercuric Chloride results in increased expression of ARF5 mRNA CTD PMID:16507785 ARF5 Human methidathion increases expression ISO Arf5 (Mus musculus) 6480464 methidathion results in increased expression of ARF5 mRNA CTD PMID:34813904 ARF5 Human N-methyl-4-phenylpyridinium increases expression ISO Arf5 (Mus musculus) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of ARF5 protein CTD PMID:26558463 ARF5 Human ozone multiple interactions ISO Arf5 (Rattus norvegicus) 6480464 [Ozone co-treated with Chlorine] results in decreased expression of ARF5 mRNA CTD PMID:18636392 ARF5 Human paraquat increases expression ISO Arf5 (Rattus norvegicus) 6480464 Paraquat results in increased expression of ARF5 mRNA CTD PMID:17077588 ARF5 Human pirinixic acid multiple interactions EXP 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of ARF5 mRNA CTD PMID:19710929 ARF5 Human resveratrol increases expression ISO Arf5 (Mus musculus) 6480464 resveratrol results in increased expression of ARF5 protein CTD PMID:25505154 ARF5 Human SB 431542 multiple interactions EXP 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in increased expression of ARF5 protein CTD PMID:37664457 ARF5 Human selenium atom increases expression EXP 6480464 Selenium results in increased expression of ARF5 mRNA CTD PMID:19244175 ARF5 Human sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of ARF5 mRNA CTD PMID:38568856 ARF5 Human sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of ARF5 mRNA CTD PMID:34032870 ARF5 Human temozolomide decreases expression EXP 6480464 Temozolomide results in decreased expression of ARF5 mRNA CTD PMID:31758290 ARF5 Human tetrachloroethene decreases expression ISO Arf5 (Mus musculus) 6480464 Tetrachloroethylene results in decreased expression of ARF5 mRNA CTD PMID:28973375 ARF5 Human tetrachloromethane decreases expression ISO Arf5 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of ARF5 mRNA CTD PMID:31919559 ARF5 Human thioacetamide decreases expression ISO Arf5 (Rattus norvegicus) 6480464 Thioacetamide results in decreased expression of ARF5 mRNA CTD PMID:23411599 and PMID:34492290 ARF5 Human thiram decreases expression EXP 6480464 Thiram results in decreased expression of ARF5 mRNA CTD PMID:38568856 ARF5 Human titanium dioxide increases expression ISO Arf5 (Mus musculus) 6480464 titanium dioxide results in increased expression of ARF5 mRNA CTD PMID:27760801 ARF5 Human trichloroethene increases methylation ISO Arf5 (Rattus norvegicus) 6480464 Trichloroethylene results in increased methylation of ARF5 gene CTD PMID:27618143 ARF5 Human triphenyl phosphate affects expression EXP 6480464 triphenyl phosphate affects the expression of ARF5 mRNA CTD PMID:37042841 ARF5 Human valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of ARF5 mRNA CTD PMID:19101580 ARF5 Human vitamin E increases expression EXP 6480464 Vitamin E results in increased expression of ARF5 mRNA CTD PMID:19244175
Imported Annotations - PID (archival)
1,2-dimethylhydrazine (ISO) 1-chloro-2,4-dinitrobenzene (EXP) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 3,3',5,5'-tetrabromobisphenol A (EXP) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-sulfonyldiphenol (ISO) ammonium chloride (ISO) arsenite(3-) (EXP) atrazine (EXP) benzo[a]pyrene (EXP,ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) butan-1-ol (EXP) carbon nanotube (ISO) CGP 52608 (EXP) chlorpyrifos (ISO) clobetasol (ISO) clofibrate (ISO) dibutyl phthalate (ISO) dichlorine (ISO) diethylstilbestrol (EXP) disodium selenite (EXP) doxorubicin (EXP) elemental selenium (EXP) fenthion (ISO) flavonoids (ISO) gentamycin (ISO) ivermectin (EXP) mercury dichloride (ISO) methidathion (ISO) N-methyl-4-phenylpyridinium (ISO) ozone (ISO) paraquat (ISO) pirinixic acid (EXP) resveratrol (ISO) SB 431542 (EXP) selenium atom (EXP) sodium arsenite (EXP) temozolomide (EXP) tetrachloroethene (ISO) tetrachloromethane (ISO) thioacetamide (ISO) thiram (EXP) titanium dioxide (ISO) trichloroethene (ISO) triphenyl phosphate (EXP) valproic acid (EXP) vitamin E (EXP)
ARF5 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 7 127,588,411 - 127,591,700 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 7 127,588,386 - 127,591,700 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 7 127,228,465 - 127,231,754 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 7 127,015,753 - 127,018,988 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 7 126,822,467 - 126,825,703 NCBI Celera 7 122,032,245 - 122,035,480 (+) NCBI Celera Cytogenetic Map 7 q32.1 NCBI HuRef 7 121,589,476 - 121,592,829 (+) NCBI HuRef CHM1_1 7 127,161,703 - 127,165,056 (+) NCBI CHM1_1 T2T-CHM13v2.0 7 128,900,090 - 128,903,379 (+) NCBI T2T-CHM13v2.0 CRA_TCAGchr7v2 7 126,611,851 - 126,615,204 (+) NCBI
Arf5 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 6 28,423,603 - 28,426,601 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 6 28,423,559 - 28,426,601 (+) Ensembl GRCm39 Ensembl GRCm38 6 28,423,604 - 28,426,602 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 6 28,423,560 - 28,426,602 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 6 28,373,640 - 28,376,499 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 6 28,373,650 - 28,376,509 (+) NCBI MGSCv36 mm8 Celera 6 28,430,700 - 28,433,539 (+) NCBI Celera Cytogenetic Map 6 A3.3 NCBI cM Map 6 11.99 NCBI
Arf5 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 58,003,919 - 58,006,898 (+) NCBI GRCr8 mRatBN7.2 4 57,038,521 - 57,041,447 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 57,038,521 - 57,041,441 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 62,021,750 - 62,024,681 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 57,937,702 - 57,940,638 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 56,339,794 - 56,342,725 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 55,715,744 - 55,718,670 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 55,715,744 - 55,718,670 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 55,463,191 - 55,466,117 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 55,293,825 - 55,296,751 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 55,543,981 - 55,546,908 (+) NCBI Celera 4 52,150,105 - 52,153,031 (+) NCBI Celera Cytogenetic Map 4 q22 NCBI
Arf5 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955479 8,644,658 - 8,647,697 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955479 8,644,658 - 8,647,697 (+) NCBI ChiLan1.0 ChiLan1.0
ARF5 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 6 164,447,503 - 164,450,855 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 7 16,457,764 - 16,461,106 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 7 119,583,955 - 119,587,272 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 7 132,239,114 - 132,242,323 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 7 132,239,114 - 132,242,323 (+) Ensembl panpan1.1 panPan2
ARF5 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 14 8,732,305 - 8,735,427 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 14 8,732,479 - 8,735,419 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 14 8,425,123 - 8,428,255 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 14 8,505,833 - 8,508,962 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 14 8,506,007 - 8,508,943 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 14 8,710,066 - 8,713,195 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 14 8,444,533 - 8,447,665 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 14 8,598,297 - 8,601,427 (-) NCBI UU_Cfam_GSD_1.0
Arf5 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 53,666,834 - 53,669,835 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936479 14,790,519 - 14,793,733 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936479 14,790,552 - 14,793,604 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ARF5 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 18 20,694,966 - 20,698,726 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 18 20,695,706 - 20,698,635 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 18 21,699,373 - 21,702,302 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ARF5 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 21 96,403,360 - 96,406,901 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 21 96,403,609 - 96,407,215 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666042 7,000,073 - 7,003,409 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Arf5
.
Predicted Target Of
Count of predictions: 1492 Count of miRNA genes: 703 Interacting mature miRNAs: 832 Transcripts: ENST00000000233, ENST00000415666, ENST00000459680, ENST00000463733, ENST00000467281, ENST00000489673 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
597603000 GWAS1659860_H type 2 diabetes mellitus QTL GWAS1659860 (human) 5e-24 type 2 diabetes mellitus 7 127590622 127590623 Human
D7S2378
Human Assembly Chr Position (strand) Source JBrowse GRCh37 7 127,231,340 - 127,231,516 UniSTS GRCh37 Build 36 7 127,018,576 - 127,018,752 RGD NCBI36 Celera 7 122,035,068 - 122,035,244 RGD Cytogenetic Map 7 q31.3 UniSTS HuRef 7 121,592,410 - 121,592,586 UniSTS CRA_TCAGchr7v2 7 126,614,785 - 126,614,961 UniSTS Whitehead-YAC Contig Map 7 UniSTS
ECD01410
Human Assembly Chr Position (strand) Source JBrowse GRCh37 7 127,227,426 - 127,228,292 UniSTS GRCh37 Build 36 7 127,014,662 - 127,015,528 RGD NCBI36 Celera 7 122,031,154 - 122,032,020 RGD Cytogenetic Map 7 q31.3 UniSTS HuRef 7 121,588,496 - 121,589,362 UniSTS CRA_TCAGchr7v2 7 126,610,871 - 126,611,737 UniSTS
ECD08424
Human Assembly Chr Position (strand) Source JBrowse GRCh37 7 127,231,438 - 127,232,093 UniSTS GRCh37 Build 36 7 127,018,674 - 127,019,329 RGD NCBI36 Celera 7 122,035,166 - 122,035,821 RGD Cytogenetic Map 7 q31.3 UniSTS HuRef 7 121,592,508 - 121,593,163 UniSTS CRA_TCAGchr7v2 7 126,614,883 - 126,615,538 UniSTS
ECD09111
Human Assembly Chr Position (strand) Source JBrowse GRCh37 7 127,230,721 - 127,231,358 UniSTS GRCh37 Build 36 7 127,017,957 - 127,018,594 RGD NCBI36 Celera 7 122,034,449 - 122,035,086 RGD Cytogenetic Map 7 q31.3 UniSTS HuRef 7 121,591,791 - 121,592,428 UniSTS CRA_TCAGchr7v2 7 126,614,166 - 126,614,803 UniSTS
ECD12455
Human Assembly Chr Position (strand) Source JBrowse GRCh37 7 127,229,287 - 127,229,830 UniSTS GRCh37 Build 36 7 127,016,523 - 127,017,066 RGD NCBI36 Celera 7 122,033,015 - 122,033,558 RGD Cytogenetic Map 7 q31.3 UniSTS HuRef 7 121,590,357 - 121,590,900 UniSTS CRA_TCAGchr7v2 7 126,612,732 - 126,613,275 UniSTS
ECD13587
Human Assembly Chr Position (strand) Source JBrowse GRCh37 7 127,226,638 - 127,227,152 UniSTS GRCh37 Build 36 7 127,013,874 - 127,014,388 RGD NCBI36 Celera 7 122,030,366 - 122,030,880 RGD Cytogenetic Map 7 q31.3 UniSTS Cytogenetic Map 7 q32.1 UniSTS HuRef 7 121,587,708 - 121,588,222 UniSTS CRA_TCAGchr7v2 7 126,610,083 - 126,610,597 UniSTS
ECD14108
Human Assembly Chr Position (strand) Source JBrowse GRCh37 7 127,228,720 - 127,229,221 UniSTS GRCh37 Build 36 7 127,015,956 - 127,016,457 RGD NCBI36 Celera 7 122,032,448 - 122,032,949 RGD Cytogenetic Map 7 q31.3 UniSTS HuRef 7 121,589,790 - 121,590,291 UniSTS CRA_TCAGchr7v2 7 126,612,165 - 126,612,666 UniSTS
ECD17077
Human Assembly Chr Position (strand) Source JBrowse GRCh37 7 127,229,952 - 127,230,366 UniSTS GRCh37 Build 36 7 127,017,188 - 127,017,602 RGD NCBI36 Celera 7 122,033,680 - 122,034,094 RGD Cytogenetic Map 7 q31.3 UniSTS HuRef 7 121,591,022 - 121,591,436 UniSTS CRA_TCAGchr7v2 7 126,613,397 - 126,613,811 UniSTS
REN115652
Human Assembly Chr Position (strand) Source JBrowse GRCh37 7 127,226,530 - 127,226,769 UniSTS GRCh37 Build 36 7 127,013,766 - 127,014,005 RGD NCBI36 Celera 7 122,030,258 - 122,030,497 RGD HuRef 7 121,587,600 - 121,587,839 UniSTS CRA_TCAGchr7v2 7 126,609,975 - 126,610,214 UniSTS
REN115653
Human Assembly Chr Position (strand) Source JBrowse GRCh37 7 127,226,760 - 127,227,007 UniSTS GRCh37 Build 36 7 127,013,996 - 127,014,243 RGD NCBI36 Celera 7 122,030,488 - 122,030,735 RGD HuRef 7 121,587,830 - 121,588,077 UniSTS CRA_TCAGchr7v2 7 126,610,205 - 126,610,452 UniSTS
REN115654
Human Assembly Chr Position (strand) Source JBrowse GRCh37 7 127,226,982 - 127,227,230 UniSTS GRCh37 Build 36 7 127,014,218 - 127,014,466 RGD NCBI36 Celera 7 122,030,710 - 122,030,958 RGD HuRef 7 121,588,052 - 121,588,300 UniSTS CRA_TCAGchr7v2 7 126,610,427 - 126,610,675 UniSTS
REN115655
Human Assembly Chr Position (strand) Source JBrowse GRCh37 7 127,227,227 - 127,227,470 UniSTS GRCh37 Build 36 7 127,014,463 - 127,014,706 RGD NCBI36 Celera 7 122,030,955 - 122,031,198 RGD HuRef 7 121,588,297 - 121,588,540 UniSTS CRA_TCAGchr7v2 7 126,610,672 - 126,610,915 UniSTS
REN115656
Human Assembly Chr Position (strand) Source JBrowse GRCh37 7 127,227,468 - 127,227,723 UniSTS GRCh37 Build 36 7 127,014,704 - 127,014,959 RGD NCBI36 Celera 7 122,031,196 - 122,031,451 RGD HuRef 7 121,588,538 - 121,588,793 UniSTS CRA_TCAGchr7v2 7 126,610,913 - 126,611,168 UniSTS
REN115657
Human Assembly Chr Position (strand) Source JBrowse GRCh37 7 127,227,716 - 127,227,943 UniSTS GRCh37 Build 36 7 127,014,952 - 127,015,179 RGD NCBI36 Celera 7 122,031,444 - 122,031,671 RGD HuRef 7 121,588,786 - 121,589,013 UniSTS CRA_TCAGchr7v2 7 126,611,161 - 126,611,388 UniSTS
REN115658
Human Assembly Chr Position (strand) Source JBrowse GRCh37 7 127,227,916 - 127,228,162 UniSTS GRCh37 Build 36 7 127,015,152 - 127,015,398 RGD NCBI36 Celera 7 122,031,644 - 122,031,890 RGD HuRef 7 121,588,986 - 121,589,232 UniSTS CRA_TCAGchr7v2 7 126,611,361 - 126,611,607 UniSTS
REN115659
Human Assembly Chr Position (strand) Source JBrowse GRCh37 7 127,228,098 - 127,228,355 UniSTS GRCh37 Build 36 7 127,015,334 - 127,015,591 RGD NCBI36 Celera 7 122,031,826 - 122,032,083 RGD HuRef 7 121,589,168 - 121,589,425 UniSTS CRA_TCAGchr7v2 7 126,611,543 - 126,611,800 UniSTS
REN115660
Human Assembly Chr Position (strand) Source JBrowse GRCh37 7 127,228,340 - 127,228,592 UniSTS GRCh37 Build 36 7 127,015,576 - 127,015,828 RGD NCBI36 Celera 7 122,032,068 - 122,032,320 RGD HuRef 7 121,589,410 - 121,589,662 UniSTS CRA_TCAGchr7v2 7 126,611,785 - 126,612,037 UniSTS
REN115661
Human Assembly Chr Position (strand) Source JBrowse GRCh37 7 127,228,609 - 127,228,873 UniSTS GRCh37 Build 36 7 127,015,845 - 127,016,109 RGD NCBI36 Celera 7 122,032,337 - 122,032,601 RGD HuRef 7 121,589,679 - 121,589,943 UniSTS CRA_TCAGchr7v2 7 126,612,054 - 126,612,318 UniSTS
REN115662
Human Assembly Chr Position (strand) Source JBrowse GRCh37 7 127,228,872 - 127,229,122 UniSTS GRCh37 Build 36 7 127,016,108 - 127,016,358 RGD NCBI36 Celera 7 122,032,600 - 122,032,850 RGD HuRef 7 121,589,942 - 121,590,192 UniSTS CRA_TCAGchr7v2 7 126,612,317 - 126,612,567 UniSTS
REN115663
Human Assembly Chr Position (strand) Source JBrowse GRCh37 7 127,229,101 - 127,229,349 UniSTS GRCh37 Build 36 7 127,016,337 - 127,016,585 RGD NCBI36 Celera 7 122,032,829 - 122,033,077 RGD HuRef 7 121,590,171 - 121,590,419 UniSTS CRA_TCAGchr7v2 7 126,612,546 - 126,612,794 UniSTS
REN115664
Human Assembly Chr Position (strand) Source JBrowse GRCh37 7 127,229,332 - 127,229,593 UniSTS GRCh37 Build 36 7 127,016,568 - 127,016,829 RGD NCBI36 Celera 7 122,033,060 - 122,033,321 RGD HuRef 7 121,590,402 - 121,590,663 UniSTS CRA_TCAGchr7v2 7 126,612,777 - 126,613,038 UniSTS
REN115665
Human Assembly Chr Position (strand) Source JBrowse GRCh37 7 127,229,562 - 127,229,799 UniSTS GRCh37 Build 36 7 127,016,798 - 127,017,035 RGD NCBI36 Celera 7 122,033,290 - 122,033,527 RGD Cytogenetic Map 7 q31.3 UniSTS HuRef 7 121,590,632 - 121,590,869 UniSTS CRA_TCAGchr7v2 7 126,613,007 - 126,613,244 UniSTS
REN115666
Human Assembly Chr Position (strand) Source JBrowse GRCh37 7 127,229,777 - 127,230,040 UniSTS GRCh37 Build 36 7 127,017,013 - 127,017,276 RGD NCBI36 Celera 7 122,033,505 - 122,033,768 RGD Cytogenetic Map 7 q31.3 UniSTS HuRef 7 121,590,847 - 121,591,110 UniSTS CRA_TCAGchr7v2 7 126,613,222 - 126,613,485 UniSTS
REN115667
Human Assembly Chr Position (strand) Source JBrowse GRCh37 7 127,230,020 - 127,230,247 UniSTS GRCh37 Build 36 7 127,017,256 - 127,017,483 RGD NCBI36 Celera 7 122,033,748 - 122,033,975 RGD HuRef 7 121,591,090 - 121,591,317 UniSTS CRA_TCAGchr7v2 7 126,613,465 - 126,613,692 UniSTS
REN115668
Human Assembly Chr Position (strand) Source JBrowse GRCh37 7 127,230,171 - 127,230,426 UniSTS GRCh37 Build 36 7 127,017,407 - 127,017,662 RGD NCBI36 Celera 7 122,033,899 - 122,034,154 RGD HuRef 7 121,591,241 - 121,591,496 UniSTS CRA_TCAGchr7v2 7 126,613,616 - 126,613,871 UniSTS
REN115669
Human Assembly Chr Position (strand) Source JBrowse GRCh37 7 127,230,685 - 127,230,918 UniSTS GRCh37 Build 36 7 127,017,921 - 127,018,154 RGD NCBI36 Celera 7 122,034,413 - 122,034,646 RGD HuRef 7 121,591,755 - 121,591,988 UniSTS CRA_TCAGchr7v2 7 126,614,130 - 126,614,363 UniSTS
REN115670
Human Assembly Chr Position (strand) Source JBrowse GRCh37 7 127,230,883 - 127,231,131 UniSTS GRCh37 Build 36 7 127,018,119 - 127,018,367 RGD NCBI36 Celera 7 122,034,611 - 122,034,859 RGD HuRef 7 121,591,953 - 121,592,201 UniSTS CRA_TCAGchr7v2 7 126,614,328 - 126,614,576 UniSTS
REN115671
Human Assembly Chr Position (strand) Source JBrowse GRCh37 7 127,231,110 - 127,231,347 UniSTS GRCh37 Build 36 7 127,018,346 - 127,018,583 RGD NCBI36 Celera 7 122,034,838 - 122,035,075 RGD Cytogenetic Map 7 q31.3 UniSTS HuRef 7 121,592,180 - 121,592,417 UniSTS CRA_TCAGchr7v2 7 126,614,555 - 126,614,792 UniSTS
REN115672
Human Assembly Chr Position (strand) Source JBrowse GRCh37 7 127,231,337 - 127,231,589 UniSTS GRCh37 Build 36 7 127,018,573 - 127,018,825 RGD NCBI36 Celera 7 122,035,065 - 122,035,317 RGD Cytogenetic Map 7 q31.3 UniSTS HuRef 7 121,592,407 - 121,592,659 UniSTS CRA_TCAGchr7v2 7 126,614,782 - 126,615,034 UniSTS
REN115673
Human Assembly Chr Position (strand) Source JBrowse GRCh37 7 127,231,561 - 127,231,804 UniSTS GRCh37 Build 36 7 127,018,797 - 127,019,040 RGD NCBI36 Celera 7 122,035,289 - 122,035,532 RGD HuRef 7 121,592,631 - 121,592,874 UniSTS CRA_TCAGchr7v2 7 126,615,006 - 126,615,249 UniSTS
REN115674
Human Assembly Chr Position (strand) Source JBrowse GRCh37 7 127,231,793 - 127,232,034 UniSTS GRCh37 Build 36 7 127,019,029 - 127,019,270 RGD NCBI36 Celera 7 122,035,521 - 122,035,762 RGD HuRef 7 121,592,863 - 121,593,104 UniSTS CRA_TCAGchr7v2 7 126,615,238 - 126,615,479 UniSTS
REN115675
Human Assembly Chr Position (strand) Source JBrowse GRCh37 7 127,231,957 - 127,232,195 UniSTS GRCh37 Build 36 7 127,019,193 - 127,019,431 RGD NCBI36 Celera 7 122,035,685 - 122,035,923 RGD HuRef 7 121,593,027 - 121,593,265 UniSTS CRA_TCAGchr7v2 7 126,615,402 - 126,615,640 UniSTS
D7S2779
Human Assembly Chr Position (strand) Source JBrowse GRCh37 7 127,231,493 - 127,231,745 UniSTS GRCh37 Build 36 7 127,018,729 - 127,018,981 RGD NCBI36 Celera 7 122,035,221 - 122,035,473 RGD Cytogenetic Map 7 q31.3 UniSTS HuRef 7 121,592,563 - 121,592,815 UniSTS CRA_TCAGchr7v2 7 126,614,938 - 126,615,190 UniSTS Whitehead-YAC Contig Map 7 UniSTS
RH69260
Human Assembly Chr Position (strand) Source JBrowse GRCh37 7 127,231,617 - 127,231,714 UniSTS GRCh37 Build 36 7 127,018,853 - 127,018,950 RGD NCBI36 Celera 7 122,035,345 - 122,035,442 RGD Cytogenetic Map 7 q31.3 UniSTS HuRef 7 121,592,687 - 121,592,784 UniSTS CRA_TCAGchr7v2 7 126,615,062 - 126,615,159 UniSTS GeneMap99-GB4 RH Map 7 576.92 UniSTS
stSG613722
Human Assembly Chr Position (strand) Source JBrowse GRCh37 7 127,226,809 - 127,228,066 UniSTS GRCh37 Build 36 7 127,014,045 - 127,015,302 RGD NCBI36 Celera 7 122,030,537 - 122,031,794 RGD HuRef 7 121,587,879 - 121,589,136 UniSTS CRA_TCAGchr7v2 7 126,610,254 - 126,611,511 UniSTS
stSG613724
Human Assembly Chr Position (strand) Source JBrowse GRCh37 7 127,229,293 - 127,230,295 UniSTS GRCh37 Build 36 7 127,016,529 - 127,017,531 RGD NCBI36 Celera 7 122,033,021 - 122,034,023 RGD HuRef 7 121,590,363 - 121,591,365 UniSTS CRA_TCAGchr7v2 7 126,612,738 - 126,613,740 UniSTS
stSG613725
Human Assembly Chr Position (strand) Source JBrowse GRCh37 7 127,230,276 - 127,231,760 UniSTS GRCh37 Build 36 7 127,017,512 - 127,018,996 RGD NCBI36 Celera 7 122,034,004 - 122,035,488 RGD HuRef 7 121,591,346 - 121,592,830 UniSTS CRA_TCAGchr7v2 7 126,613,721 - 126,615,205 UniSTS
ARF5
Human Assembly Chr Position (strand) Source JBrowse GRCh37 7 127,228,585 - 127,229,196 UniSTS GRCh37 Celera 7 122,032,313 - 122,032,924 UniSTS HuRef 7 121,589,655 - 121,590,266 UniSTS CRA_TCAGchr7v2 7 126,612,030 - 126,612,641 UniSTS
MARC_26030-26031:1032381284:1
Human Assembly Chr Position (strand) Source JBrowse GRCh37 7 127,230,139 - 127,231,079 UniSTS GRCh37 Celera 7 122,033,867 - 122,034,807 UniSTS HuRef 7 121,591,209 - 121,592,149 UniSTS CRA_TCAGchr7v2 7 126,613,584 - 126,614,524 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
entire extraembryonic component
1204
2439
2788
2253
4974
1726
2351
6
624
1951
465
2270
7306
6472
53
3734
1
852
1744
1617
175
1
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENST00000000233 ⟹ ENSP00000000233
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 7 127,588,411 - 127,591,700 (+) Ensembl
Ensembl Acc Id:
ENST00000415666 ⟹ ENSP00000412701
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 7 127,588,403 - 127,591,088 (+) Ensembl
Ensembl Acc Id:
ENST00000459680
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 7 127,589,045 - 127,589,831 (+) Ensembl
Ensembl Acc Id:
ENST00000463733
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 7 127,588,386 - 127,591,681 (+) Ensembl
Ensembl Acc Id:
ENST00000467281
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 7 127,588,405 - 127,589,574 (+) Ensembl
Ensembl Acc Id:
ENST00000489673
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 7 127,588,413 - 127,591,112 (+) Ensembl
RefSeq Acc Id:
NM_001662 ⟹ NP_001653
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 7 127,588,411 - 127,591,700 (+) NCBI GRCh37 7 127,228,406 - 127,231,759 (+) ENTREZGENE Build 36 7 127,015,753 - 127,018,988 (+) NCBI Archive HuRef 7 121,589,476 - 121,592,829 (+) ENTREZGENE CHM1_1 7 127,161,703 - 127,165,056 (+) NCBI T2T-CHM13v2.0 7 128,900,090 - 128,903,379 (+) NCBI CRA_TCAGchr7v2 7 126,611,851 - 126,615,204 (+) ENTREZGENE
Sequence:
CTGCTGCTGCTGCGCCCCATCCCCCCGCGGCCGGCCAGTTCCAGCCCGCACCCCGCGTCGGTGCCCGCGCCCCTCCCCGGGCCCCGCCATGGGCCTCACCGTGTCCGCGCTCTTTTCGCGGATCTTCG
hide sequence
RefSeq Acc Id:
NP_001653 ⟸ NM_001662
- UniProtKB:
P26437 (UniProtKB/Swiss-Prot), P84085 (UniProtKB/Swiss-Prot), A4D0Z3 (UniProtKB/TrEMBL), C9J1Z8 (UniProtKB/TrEMBL)
- Sequence:
MGLTVSALFSRIFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAVLLVFANKQ
hide sequence
Ensembl Acc Id:
ENSP00000412701 ⟸ ENST00000415666
Ensembl Acc Id:
ENSP00000000233 ⟸ ENST00000000233
RGD ID: 6805239 Promoter ID: HG_KWN:59592 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: CD4+TCell, CD4+TCell_12Hour, HeLa_S3, K562, Lymphoblastoid, NB4 Transcripts: OTTHUMT00000059567, OTTHUMT00000141971, OTTHUMT00000141972, OTTHUMT00000141973, OTTHUMT00000141974, OTTHUMT00000308979, OTTHUMT00000317141, UC010LLB.1 Position: Human Assembly Chr Position (strand) Source Build 36 7 127,015,641 - 127,016,257 (+) MPROMDB
RGD ID: 6853358 Promoter ID: EP74504 Type: initiation region Name: HS_ARF5 Description: ADP-ribosylation factor 5. SO ACC ID: SO:0000170 Source: EPD (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Mammalian gene collection (MGC) full-length cDNA cloning Position: Human Assembly Chr Position (strand) Source Build 36 7 127,015,741 - 127,015,801 EPD
RGD ID: 7211833 Promoter ID: EPDNEW_H11663 Type: initiation region Name: ARF5_1 Description: ADP ribosylation factor 5 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_H11665 Experiment Methods: Single-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 7 127,588,411 - 127,588,471 EPDNEW
RGD ID: 7211837 Promoter ID: EPDNEW_H11665 Type: single initiation site Name: ARF5_2 Description: ADP ribosylation factor 5 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_H11663 Experiment Methods: Single-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 7 127,588,969 - 127,589,029 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2024-10-31
ARF5
ARF GTPase 5
ARF5
ADP ribosylation factor 5
Symbol and/or name change
19259463 PROVISIONAL
2015-11-24
ARF5
ADP ribosylation factor 5
ADP-ribosylation factor 5
Symbol and/or name change
5135510 APPROVED
