Symbol:
NTF3
Name:
neurotrophin 3
RGD ID:
732368
HGNC Page
HGNC:8023
Description:
Enables chemoattractant activity and growth factor activity. Involved in several processes, including induction of positive chemotaxis; positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction; and positive regulation of receptor internalization. Acts upstream of or within regulation of apoptotic process. Predicted to be located in cytoplasmic vesicle. Predicted to be active in several cellular components, including axon; dendrite; and synaptic vesicle. Implicated in Alzheimer's disease and asthma. Biomarker of alcohol use disorder; chronic obstructive pulmonary disease; hydrocephalus; and pulmonary sarcoidosis.
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
HDNF; MGC129711; nerve growth factor 2; neurotrophic factor; neurotrophin-3; NGF-2; NGF2; NT-3; NT3
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Mus musculus (house mouse):
Ntf3 (neurotrophin 3) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Ntf3 (neurotrophin 3) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Chinchilla lanigera (long-tailed chinchilla):
Ntf3 (neurotrophin 3) NCBI
Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):
NTF3 (neurotrophin 3) NCBI
Ortholog
Canis lupus familiaris (dog):
NTF3 (neurotrophin 3) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Ntf3 (neurotrophin 3) NCBI
Ortholog
Sus scrofa (pig):
NTF3 (neurotrophin 3) HGNC
Ensembl, Inparanoid, NCBI, OrthoDB, Panther
Chlorocebus sabaeus (green monkey):
NTF3 (neurotrophin 3) NCBI
Ortholog
Heterocephalus glaber (naked mole-rat):
Ntf3 (neurotrophin 3) NCBI
Ortholog
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Ntf3 (neurotrophin 3)
Alliance
DIOPT (HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Ntf3 (neurotrophin 3)
Alliance
DIOPT (HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
ntf3 (neurotrophin 3)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid|ZFIN)
Xenopus laevis (African clawed frog):
ntf3.S
Alliance
DIOPT (Xenbase)
Xenopus laevis (African clawed frog):
ntf3.L
Alliance
DIOPT (Xenbase)
Xenopus tropicalis (tropical clawed frog):
ntf3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Allele / Splice:
See ClinVar data
Latest Assembly:
GRCh38 - Human Genome Assembly GRCh38
Position:
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 5,430,332 - 5,495,299 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 5,432,108 - 5,521,536 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 5,541,274 - 5,604,465 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 5,411,541 - 5,474,726 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 12 5,473,526 - 5,474,725 NCBI Celera 12 7,162,184 - 7,225,194 (+) NCBI Celera Cytogenetic Map 12 p13.31 NCBI HuRef 12 5,455,606 - 5,458,036 (+) NCBI HuRef CHM1_1 12 5,540,527 - 5,604,287 (+) NCBI CHM1_1 T2T-CHM13v2.0 12 5,437,400 - 5,502,089 (+) NCBI T2T-CHM13v2.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
NTF3 Human (+)-pilocarpine decreases expression ISO Ntf3 (Rattus norvegicus) 6480464 Pilocarpine results in decreased expression of NTF3 mRNA CTD PMID:8635431 NTF3 Human (+)-pilocarpine multiple interactions ISO Ntf3 (Rattus norvegicus) 6480464 Scopolamine inhibits the reaction [Pilocarpine results in decreased expression of NTF3 mRNA] CTD PMID:8635431 NTF3 Human (R)-adrenaline increases expression ISO Ntf3 (Rattus norvegicus) 6480464 Epinephrine results in increased expression of NTF3 mRNA and Epinephrine results in increased expression of NTF3 protein CTD PMID:19854260 NTF3 Human (R)-noradrenaline increases expression ISO Ntf3 (Rattus norvegicus) 6480464 Norepinephrine results in increased expression of NTF3 mRNA and Norepinephrine results in increased expression of NTF3 protein CTD PMID:19854260 NTF3 Human 17beta-estradiol increases expression ISO Ntf3 (Rattus norvegicus) 6480464 Estradiol results in increased expression of NTF3 protein CTD PMID:15570173 NTF3 Human 17beta-estradiol increases expression ISO Ntf3 (Mus musculus) 6480464 Estradiol results in increased expression of NTF3 mRNA CTD PMID:39298647 NTF3 Human 17beta-estradiol multiple interactions ISO Ntf3 (Rattus norvegicus) 6480464 Progesterone inhibits the reaction [Estradiol results in increased expression of NTF3 protein] CTD PMID:15570173 NTF3 Human 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Ntf3 (Rattus norvegicus) 6480464 [3 more ... CTD PMID:16984957 NTF3 Human 2,2',4,4'-Tetrabromodiphenyl ether multiple interactions ISO Ntf3 (Mus musculus) 6480464 2 more ... CTD PMID:23564643 NTF3 Human 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Ntf3 (Mus musculus) 6480464 AHR gene mutant form inhibits the reaction [Tetrachlorodibenzodioxin results in decreased expression of NTF3 mRNA] CTD PMID:16984957 NTF3 Human 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Ntf3 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of NTF3 mRNA CTD PMID:20959002 more ... NTF3 Human 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Ntf3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of NTF3 mRNA CTD PMID:16984957 NTF3 Human 3,3',4,4',5-pentachlorobiphenyl multiple interactions ISO Ntf3 (Rattus norvegicus) 6480464 [3 more ... CTD PMID:16984957 NTF3 Human 3,3',4,4',5-pentachlorobiphenyl decreases expression ISO Ntf3 (Rattus norvegicus) 6480464 3 more ... CTD PMID:20959002 NTF3 Human 3,7-dihydropurine-6-thione increases expression ISO Ntf3 (Rattus norvegicus) 6480464 Mercaptopurine results in increased expression of NTF3 mRNA CTD PMID:23358152 NTF3 Human 4,4'-sulfonyldiphenol increases expression ISO Ntf3 (Mus musculus) 6480464 bisphenol S results in increased expression of NTF3 mRNA CTD PMID:30951980 NTF3 Human 5-aza-2'-deoxycytidine affects expression EXP 6480464 Decitabine affects the expression of NTF3 mRNA CTD PMID:23300844 NTF3 Human 6-aminonicotinamide multiple interactions ISO Ntf3 (Mus musculus) 6480464 IL6 protein promotes the reaction [6-Aminonicotinamide results in increased expression of NTF3 protein] CTD PMID:12898533 NTF3 Human 6-aminonicotinamide increases expression ISO Ntf3 (Mus musculus) 6480464 6-Aminonicotinamide results in increased expression of NTF3 protein CTD PMID:12898533 NTF3 Human 7,12-dimethyltetraphene increases expression ISO Ntf3 (Rattus norvegicus) 6480464 9 more ... CTD PMID:19480007 NTF3 Human acetamide decreases expression ISO Ntf3 (Rattus norvegicus) 6480464 acetamide results in decreased expression of NTF3 mRNA CTD PMID:31881176 NTF3 Human acrylamide multiple interactions ISO Ntf3 (Rattus norvegicus) 6480464 NTF3 protein inhibits the reaction [Acrylamide results in decreased activity of CHAT protein] CTD PMID:11779407 NTF3 Human aflatoxin B1 increases methylation EXP 6480464 Aflatoxin B1 results in increased methylation of NTF3 gene CTD PMID:27153756 NTF3 Human Aflatoxin B2 alpha increases methylation EXP 6480464 aflatoxin B2 results in increased methylation of NTF3 intron CTD PMID:30157460 NTF3 Human all-trans-retinoic acid multiple interactions EXP 6480464 [NTF3 protein co-treated with Tretinoin] results in increased expression of DLG4 protein more ... CTD PMID:16996685 NTF3 Human all-trans-retinoic acid decreases expression EXP 6480464 Tretinoin results in decreased expression of NTF3 mRNA CTD PMID:21934132 NTF3 Human amitrole increases expression ISO Ntf3 (Rattus norvegicus) 6480464 Amitrole results in increased expression of NTF3 mRNA CTD PMID:38685447 NTF3 Human ammonium chloride affects expression ISO Ntf3 (Rattus norvegicus) 6480464 Ammonium Chloride affects the expression of NTF3 mRNA CTD PMID:16483693 NTF3 Human amphetamine affects expression ISO Ntf3 (Rattus norvegicus) 6480464 Amphetamine affects the expression of NTF3 protein CTD PMID:17512948 NTF3 Human amphetamine multiple interactions ISO Ntf3 (Rattus norvegicus) 6480464 Lithium inhibits the reaction [Amphetamine affects the expression of NTF3 protein] and Valproic Acid inhibits the reaction [Amphetamine affects the expression of NTF3 protein] CTD PMID:17512948 NTF3 Human androgen antagonist multiple interactions ISO Ntf3 (Rattus norvegicus) 6480464 [Pesticides co-treated with Phthalic Acids co-treated with Androgen Antagonists] results in increased expression of NTF3 mRNA CTD PMID:29945228 NTF3 Human arsane affects expression EXP 6480464 Arsenic affects the expression of NTF3 protein CTD PMID:24675094 NTF3 Human arsenic atom affects expression EXP 6480464 Arsenic affects the expression of NTF3 protein CTD PMID:24675094 NTF3 Human benzene multiple interactions ISO Ntf3 (Mus musculus) 6480464 [Formaldehyde co-treated with Benzene co-treated with Toluene co-treated with Xylenes] results in increased expression of NTF3 protein CTD PMID:22863854 NTF3 Human benzo[a]pyrene increases expression ISO Ntf3 (Rattus norvegicus) 6480464 Benzo(a)pyrene results in increased expression of NTF3 mRNA CTD PMID:21839799 NTF3 Human benzo[a]pyrene increases methylation EXP 6480464 Benzo(a)pyrene results in increased methylation of NTF3 exon CTD PMID:27901495 NTF3 Human benzo[a]pyrene affects methylation EXP 6480464 Benzo(a)pyrene affects the methylation of NTF3 intron and Benzo(a)pyrene affects the methylation of NTF3 promoter CTD PMID:27901495 and PMID:30157460 NTF3 Human benzo[a]pyrene increases expression ISO Ntf3 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of NTF3 mRNA CTD PMID:22228805 and PMID:27195522 NTF3 Human benzo[e]pyrene increases methylation EXP 6480464 benzo(e)pyrene results in increased methylation of NTF3 intron CTD PMID:30157460 NTF3 Human beta-naphthoflavone multiple interactions ISO Ntf3 (Rattus norvegicus) 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in decreased expression of NTF3 mRNA CTD PMID:18164116 NTF3 Human bis(2-chloroethyl) sulfide multiple interactions EXP 6480464 IL10 protein affects the reaction [Mustard Gas affects the expression of NTF3 mRNA] CTD PMID:16173061 NTF3 Human bis(2-chloroethyl) sulfide decreases expression EXP 6480464 Mustard Gas results in decreased expression of NTF3 mRNA CTD PMID:16173061 NTF3 Human bis(2-ethylhexyl) phthalate multiple interactions ISO Ntf3 (Rattus norvegicus) 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate] affects the methylation of NTF3 promoter CTD PMID:23359474 NTF3 Human bisphenol A multiple interactions ISO Ntf3 (Rattus norvegicus) 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate] affects the methylation of NTF3 promoter CTD PMID:23359474 NTF3 Human bisphenol A increases expression ISO Ntf3 (Rattus norvegicus) 6480464 bisphenol A results in increased expression of NTF3 mRNA CTD PMID:32145629 NTF3 Human bisphenol A increases expression ISO Ntf3 (Mus musculus) 6480464 bisphenol A results in increased expression of NTF3 mRNA CTD PMID:30951980 and PMID:32156529 NTF3 Human bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of NTF3 mRNA CTD PMID:29275510 NTF3 Human bisphenol A affects expression ISO Ntf3 (Rattus norvegicus) 6480464 bisphenol A affects the expression of NTF3 mRNA CTD PMID:25181051 NTF3 Human bisphenol F increases expression ISO Ntf3 (Mus musculus) 6480464 bisphenol F results in increased expression of NTF3 mRNA CTD PMID:30951980 NTF3 Human bucladesine increases expression ISO Ntf3 (Rattus norvegicus) 6480464 Bucladesine results in increased expression of NTF3 protein CTD PMID:19854260 NTF3 Human cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of NTF3 protein CTD PMID:26138014 NTF3 Human cadmium dichloride multiple interactions EXP 6480464 Acetylcysteine inhibits the reaction [Cadmium Chloride results in decreased expression of NTF3 protein] CTD PMID:26138014 NTF3 Human Calcimycin increases expression ISO Ntf3 (Rattus norvegicus) 6480464 Calcimycin results in increased expression of NTF3 protein CTD PMID:19854260 NTF3 Human carbon monoxide multiple interactions ISO Ntf3 (Rattus norvegicus) 6480464 Carbon Monoxide results in decreased expression of and results in decreased secretion of NTF3 protein CTD PMID:27113706 NTF3 Human carbon monoxide decreases expression ISO Ntf3 (Rattus norvegicus) 6480464 Carbon Monoxide results in decreased expression of NTF3 mRNA CTD PMID:27113706 NTF3 Human carbon nanotube increases expression ISO Ntf3 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 NTF3 Human CGP 52608 multiple interactions EXP 6480464 CGP 52608 promotes the reaction [RORA protein binds to NTF3 gene] CTD PMID:28238834 NTF3 Human chlorpyrifos decreases expression ISO Ntf3 (Rattus norvegicus) 6480464 Chlorpyrifos results in decreased expression of NTF3 mRNA CTD PMID:18502319 NTF3 Human cimetidine multiple interactions ISO Ntf3 (Rattus norvegicus) 6480464 Cimetidine inhibits the reaction [Histamine results in increased expression of NTF3 protein] CTD PMID:21276809 NTF3 Human cisplatin affects expression EXP 6480464 Cisplatin affects the expression of NTF3 mRNA CTD PMID:23300844 NTF3 Human colforsin daropate hydrochloride increases expression ISO Ntf3 (Rattus norvegicus) 6480464 Colforsin results in increased expression of NTF3 protein CTD PMID:19854260 NTF3 Human cyclophosphamide increases expression ISO Ntf3 (Rattus norvegicus) 6480464 Cyclophosphamide results in increased expression of NTF3 mRNA CTD PMID:10683293 NTF3 Human decabromodiphenyl ether increases expression ISO Ntf3 (Rattus norvegicus) 6480464 decabromobiphenyl ether results in increased expression of NTF3 mRNA CTD PMID:23640034 NTF3 Human dibutyl phthalate decreases expression ISO Ntf3 (Rattus norvegicus) 6480464 Dibutyl Phthalate results in decreased expression of NTF3 mRNA CTD PMID:21266533 NTF3 Human dibutyl phthalate multiple interactions ISO Ntf3 (Rattus norvegicus) 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate] affects the methylation of NTF3 promoter CTD PMID:23359474 NTF3 Human dibutyl phthalate increases expression ISO Ntf3 (Rattus norvegicus) 6480464 Dibutyl Phthalate results in increased expression of NTF3 mRNA CTD PMID:17379624 NTF3 Human diethyl maleate decreases expression ISO Ntf3 (Rattus norvegicus) 6480464 diethyl maleate results in decreased expression of NTF3 mRNA CTD PMID:21161181 NTF3 Human Dimaprit increases expression ISO Ntf3 (Rattus norvegicus) 6480464 Dimaprit results in increased expression of NTF3 protein CTD PMID:21276809 NTF3 Human Dimaprit multiple interactions ISO Ntf3 (Rattus norvegicus) 6480464 2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits the reaction [Dimaprit results in increased expression of NTF3 protein] more ... CTD PMID:21276809 NTF3 Human dopamine increases expression ISO Ntf3 (Rattus norvegicus) 6480464 Dopamine results in increased expression of NTF3 mRNA and Dopamine results in increased expression of NTF3 protein CTD PMID:19854260 NTF3 Human endosulfan decreases expression ISO Ntf3 (Rattus norvegicus) 6480464 Endosulfan results in decreased expression of NTF3 mRNA CTD PMID:29391264 NTF3 Human famotidine multiple interactions ISO Ntf3 (Rattus norvegicus) 6480464 [Pyrilamine co-treated with Famotidine co-treated with ciproxifan] inhibits the reaction [Histamine results in increased expression of NTF3 protein] more ... CTD PMID:21276809 NTF3 Human formaldehyde increases expression ISO Ntf3 (Mus musculus) 6480464 Formaldehyde results in increased expression of NTF3 mRNA CTD PMID:19904815 NTF3 Human formaldehyde multiple interactions ISO Ntf3 (Mus musculus) 6480464 [Formaldehyde co-treated with Benzene co-treated with Toluene co-treated with Xylenes] results in increased expression of NTF3 protein CTD PMID:22863854 NTF3 Human furan decreases expression ISO Ntf3 (Rattus norvegicus) 6480464 furan results in decreased expression of NTF3 mRNA CTD PMID:25539665 and PMID:26194646 NTF3 Human gentamycin decreases expression ISO Ntf3 (Rattus norvegicus) 6480464 Gentamicins results in decreased expression of NTF3 mRNA CTD PMID:33387578 NTF3 Human glycidol decreases expression ISO Ntf3 (Rattus norvegicus) 6480464 glycidol results in decreased expression of NTF3 mRNA CTD PMID:24915197 NTF3 Human histamine multiple interactions ISO Ntf3 (Rattus norvegicus) 6480464 2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits the reaction [Histamine results in increased expression of NTF3 protein] more ... CTD PMID:21276809 NTF3 Human histamine increases expression ISO Ntf3 (Rattus norvegicus) 6480464 Histamine results in increased expression of NTF3 mRNA and Histamine results in increased expression of NTF3 protein CTD PMID:21276809 NTF3 Human hydrogen peroxide affects expression EXP 6480464 Hydrogen Peroxide affects the expression of NTF3 mRNA CTD PMID:20044591 NTF3 Human imetit multiple interactions ISO Ntf3 (Rattus norvegicus) 6480464 2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits the reaction [imetit results in increased expression of NTF3 protein] more ... CTD PMID:21276809 NTF3 Human imetit increases expression ISO Ntf3 (Rattus norvegicus) 6480464 imetit results in increased expression of NTF3 protein CTD PMID:21276809 NTF3 Human indole-3-methanol affects expression ISO Ntf3 (Rattus norvegicus) 6480464 indole-3-carbinol affects the expression of NTF3 mRNA CTD PMID:21396975 NTF3 Human isoprenaline decreases expression ISO Ntf3 (Mus musculus) 6480464 Isoproterenol results in decreased expression of NTF3 mRNA CTD PMID:20003209 NTF3 Human ketamine decreases expression ISO Ntf3 (Rattus norvegicus) 6480464 Ketamine results in decreased expression of NTF3 mRNA CTD PMID:20080153 NTF3 Human lead diacetate decreases expression ISO Ntf3 (Rattus norvegicus) 6480464 lead acetate results in decreased expression of NTF3 mRNA CTD PMID:22160880 NTF3 Human lithium atom multiple interactions ISO Ntf3 (Rattus norvegicus) 6480464 Lithium inhibits the reaction [Amphetamine affects the expression of NTF3 protein] CTD PMID:17512948 NTF3 Human lithium atom increases expression ISO Ntf3 (Rattus norvegicus) 6480464 Lithium results in increased expression of NTF3 protein CTD PMID:17512948 NTF3 Human lithium hydride increases expression ISO Ntf3 (Rattus norvegicus) 6480464 Lithium results in increased expression of NTF3 protein CTD PMID:17512948 NTF3 Human lithium hydride multiple interactions ISO Ntf3 (Rattus norvegicus) 6480464 Lithium inhibits the reaction [Amphetamine affects the expression of NTF3 protein] CTD PMID:17512948 NTF3 Human LY294002 decreases transport ISO Ntf3 (Mus musculus) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one results in decreased transport of NTF3 protein CTD PMID:11948662 NTF3 Human manganese atom multiple interactions ISO Ntf3 (Mus musculus) 6480464 [manganese chloride results in increased abundance of Manganese] which results in decreased expression of NTF3 protein and benzyloxycarbonylvalyl-alanyl-aspartyl fluoromethyl ketone promotes the reaction [[manganese chloride results in increased abundance of Manganese] which results in decreased expression of NTF3 protein] CTD PMID:31676349 NTF3 Human manganese atom multiple interactions EXP 6480464 NTF3 protein inhibits the reaction [[manganese chloride results in increased abundance of Manganese] which results in decreased expression of NTF3 protein] more ... CTD PMID:31676349 NTF3 Human manganese(0) multiple interactions ISO Ntf3 (Mus musculus) 6480464 [manganese chloride results in increased abundance of Manganese] which results in decreased expression of NTF3 protein and benzyloxycarbonylvalyl-alanyl-aspartyl fluoromethyl ketone promotes the reaction [[manganese chloride results in increased abundance of Manganese] which results in decreased expression of NTF3 protein] CTD PMID:31676349 NTF3 Human manganese(0) multiple interactions EXP 6480464 NTF3 protein inhibits the reaction [[manganese chloride results in increased abundance of Manganese] which results in decreased expression of NTF3 protein] more ... CTD PMID:31676349 NTF3 Human manganese(II) chloride multiple interactions ISO Ntf3 (Mus musculus) 6480464 [manganese chloride results in increased abundance of Manganese] which results in decreased expression of NTF3 protein and benzyloxycarbonylvalyl-alanyl-aspartyl fluoromethyl ketone promotes the reaction [[manganese chloride results in increased abundance of Manganese] which results in decreased expression of NTF3 protein] CTD PMID:31676349 NTF3 Human manganese(II) chloride multiple interactions EXP 6480464 NTF3 protein inhibits the reaction [[manganese chloride results in increased abundance of Manganese] which results in decreased expression of NTF3 protein] more ... CTD PMID:31676349 NTF3 Human menadione affects expression EXP 6480464 Vitamin K 3 affects the expression of NTF3 mRNA CTD PMID:20044591 NTF3 Human mepyramine multiple interactions ISO Ntf3 (Rattus norvegicus) 6480464 [Pyrilamine co-treated with Famotidine co-treated with ciproxifan] inhibits the reaction [Histamine results in increased expression of NTF3 protein] more ... CTD PMID:21276809 NTF3 Human mercaptopurine increases expression ISO Ntf3 (Rattus norvegicus) 6480464 Mercaptopurine results in increased expression of NTF3 mRNA CTD PMID:23358152 NTF3 Human mercury dichloride decreases expression ISO Ntf3 (Rattus norvegicus) 6480464 Mercuric Chloride results in decreased expression of NTF3 mRNA CTD PMID:16507785 NTF3 Human methapyrilene increases methylation EXP 6480464 Methapyrilene results in increased methylation of NTF3 intron CTD PMID:30157460 NTF3 Human methimazole increases expression ISO Ntf3 (Rattus norvegicus) 6480464 Methimazole results in increased expression of NTF3 mRNA CTD PMID:38685447 NTF3 Human N-[2-(4-bromocinnamylamino)ethyl]isoquinoline-5-sulfonamide multiple interactions ISO Ntf3 (Rattus norvegicus) 6480464 N-(2-(4-bromocinnamylamino)ethyl)-5-isoquinolinesulfonamide inhibits the reaction [Dimaprit results in increased expression of NTF3 protein] more ... CTD PMID:19854260 and PMID:21276809 NTF3 Human N-acetyl-L-cysteine multiple interactions EXP 6480464 Acetylcysteine inhibits the reaction [Cadmium Chloride results in decreased expression of NTF3 protein] CTD PMID:26138014 NTF3 Human N-nitrosodiethylamine multiple interactions ISO Ntf3 (Rattus norvegicus) 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in decreased expression of NTF3 mRNA CTD PMID:18164116 NTF3 Human paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of NTF3 mRNA CTD PMID:22230336 NTF3 Human paracetamol decreases expression ISO Ntf3 (Rattus norvegicus) 6480464 Acetaminophen results in decreased expression of NTF3 mRNA CTD PMID:33387578 NTF3 Human perfluorooctanoic acid decreases expression EXP 6480464 perfluorooctanoic acid results in decreased expression of NTF3 mRNA CTD PMID:36326898 NTF3 Human phenytoin decreases expression ISO Ntf3 (Mus musculus) 6480464 Phenytoin results in decreased expression of NTF3 mRNA CTD PMID:7841657 NTF3 Human phorbol 13-acetate 12-myristate multiple interactions ISO Ntf3 (Rattus norvegicus) 6480464 Tetradecanoylphorbol Acetate inhibits the reaction [Histamine results in increased expression of NTF3 protein] more ... CTD PMID:21276809 NTF3 Human phorbol 13-acetate 12-myristate increases expression ISO Ntf3 (Rattus norvegicus) 6480464 Tetradecanoylphorbol Acetate results in increased expression of NTF3 protein CTD PMID:19854260 NTF3 Human pirinixic acid decreases expression ISO Ntf3 (Rattus norvegicus) 6480464 pirinixic acid results in decreased expression of NTF3 mRNA CTD PMID:19162173 NTF3 Human potassium atom increases expression ISO Ntf3 (Rattus norvegicus) 6480464 [Potassium results in increased expression of BDNF] which results in increased expression of NTF3 CTD PMID:8978711 NTF3 Human potassium dichromate decreases expression ISO Ntf3 (Mus musculus) 6480464 Potassium Dichromate results in decreased expression of NTF3 mRNA CTD PMID:23608068 NTF3 Human progesterone multiple interactions ISO Ntf3 (Rattus norvegicus) 6480464 Progesterone inhibits the reaction [Estradiol results in increased expression of NTF3 protein] CTD PMID:15570173 NTF3 Human purine-6-thiol increases expression ISO Ntf3 (Rattus norvegicus) 6480464 Mercaptopurine results in increased expression of NTF3 mRNA CTD PMID:23358152 NTF3 Human scopolamine multiple interactions ISO Ntf3 (Rattus norvegicus) 6480464 Scopolamine inhibits the reaction [Pilocarpine results in decreased expression of NTF3 mRNA] CTD PMID:8635431 NTF3 Human silicon dioxide increases expression EXP 6480464 Silicon Dioxide analog results in increased expression of NTF3 mRNA CTD PMID:23806026 NTF3 Human sodium arsenite affects methylation EXP 6480464 sodium arsenite affects the methylation of NTF3 gene CTD PMID:28589171 NTF3 Human sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of NTF3 mRNA CTD PMID:29301061 NTF3 Human Soman decreases expression ISO Ntf3 (Rattus norvegicus) 6480464 Soman results in decreased expression of NTF3 mRNA CTD PMID:19281266 NTF3 Human staurosporine multiple interactions ISO Ntf3 (Rattus norvegicus) 6480464 Staurosporine inhibits the reaction [Histamine results in increased expression of NTF3 protein] more ... CTD PMID:19854260 and PMID:21276809 NTF3 Human streptozocin affects localization ISO Ntf3 (Rattus norvegicus) 6480464 Streptozocin affects the localization of NTF3 protein CTD PMID:12031555 NTF3 Human tetrachloromethane decreases expression ISO Ntf3 (Rattus norvegicus) 6480464 Carbon Tetrachloride results in decreased expression of NTF3 mRNA CTD PMID:31150632 NTF3 Human tetraphene increases expression ISO Ntf3 (Mus musculus) 6480464 benz(a)anthracene results in increased expression of NTF3 mRNA CTD PMID:26377693 NTF3 Human thioacetamide decreases expression ISO Ntf3 (Rattus norvegicus) 6480464 Thioacetamide results in decreased expression of NTF3 mRNA CTD PMID:23411599 NTF3 Human Thioperamide multiple interactions ISO Ntf3 (Rattus norvegicus) 6480464 thioperamide inhibits the reaction [Histamine results in increased expression of NTF3 protein] CTD PMID:21276809 NTF3 Human toluene multiple interactions ISO Ntf3 (Mus musculus) 6480464 [Formaldehyde co-treated with Benzene co-treated with Toluene co-treated with Xylenes] results in increased expression of NTF3 protein CTD PMID:22863854 NTF3 Human trichloroethene decreases expression ISO Ntf3 (Mus musculus) 6480464 Trichloroethylene results in decreased expression of NTF3 mRNA CTD PMID:22421312 NTF3 Human trichostatin A decreases expression EXP 6480464 trichostatin A results in decreased expression of NTF3 mRNA CTD PMID:24935251 and PMID:26272509 NTF3 Human trimethyltin decreases expression ISO Ntf3 (Mus musculus) 6480464 trimethyltin results in decreased expression of NTF3 mRNA CTD PMID:24002884 NTF3 Human triprolidine multiple interactions ISO Ntf3 (Rattus norvegicus) 6480464 Triprolidine inhibits the reaction [Histamine results in increased expression of NTF3 protein] CTD PMID:21276809 NTF3 Human triptonide increases expression ISO Ntf3 (Mus musculus) 6480464 triptonide results in increased expression of NTF3 mRNA CTD PMID:33045310 NTF3 Human valproic acid affects expression ISO Ntf3 (Mus musculus) 6480464 Valproic Acid affects the expression of NTF3 mRNA CTD PMID:17963808 NTF3 Human valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of NTF3 mRNA CTD PMID:24383497 more ... NTF3 Human valproic acid multiple interactions ISO Ntf3 (Rattus norvegicus) 6480464 Valproic Acid inhibits the reaction [Amphetamine affects the expression of NTF3 protein] CTD PMID:17512948 NTF3 Human valproic acid increases expression ISO Ntf3 (Rattus norvegicus) 6480464 Valproic Acid results in increased expression of NTF3 protein CTD PMID:17512948 NTF3 Human wortmannin decreases transport ISO Ntf3 (Mus musculus) 6480464 wortmannin results in decreased transport of NTF3 protein CTD PMID:11948662 NTF3 Human XL147 multiple interactions ISO Ntf3 (Mus musculus) 6480464 XL147 inhibits the reaction [N-nitroso-tris-chloroethylurea results in increased expression of NTF3 mRNA] CTD PMID:29891994
Imported Annotations - KEGG (archival)
(+)-pilocarpine (ISO) (R)-adrenaline (ISO) (R)-noradrenaline (ISO) 17beta-estradiol (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 3,3',4,4',5-pentachlorobiphenyl (ISO) 3,7-dihydropurine-6-thione (ISO) 4,4'-sulfonyldiphenol (ISO) 5-aza-2'-deoxycytidine (EXP) 6-aminonicotinamide (ISO) 7,12-dimethyltetraphene (ISO) acetamide (ISO) acrylamide (ISO) aflatoxin B1 (EXP) Aflatoxin B2 alpha (EXP) all-trans-retinoic acid (EXP) amitrole (ISO) ammonium chloride (ISO) amphetamine (ISO) androgen antagonist (ISO) arsane (EXP) arsenic atom (EXP) benzene (ISO) benzo[a]pyrene (EXP,ISO) benzo[e]pyrene (EXP) beta-naphthoflavone (ISO) bis(2-chloroethyl) sulfide (EXP) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) bucladesine (ISO) cadmium dichloride (EXP) Calcimycin (ISO) carbon monoxide (ISO) carbon nanotube (ISO) CGP 52608 (EXP) chlorpyrifos (ISO) cimetidine (ISO) cisplatin (EXP) colforsin daropate hydrochloride (ISO) cyclophosphamide (ISO) decabromodiphenyl ether (ISO) dibutyl phthalate (ISO) diethyl maleate (ISO) Dimaprit (ISO) dopamine (ISO) endosulfan (ISO) famotidine (ISO) formaldehyde (ISO) furan (ISO) gentamycin (ISO) glycidol (ISO) histamine (ISO) hydrogen peroxide (EXP) imetit (ISO) indole-3-methanol (ISO) isoprenaline (ISO) ketamine (ISO) lead diacetate (ISO) lithium atom (ISO) lithium hydride (ISO) LY294002 (ISO) manganese atom (EXP,ISO) manganese(0) (EXP,ISO) manganese(II) chloride (EXP,ISO) menadione (EXP) mepyramine (ISO) mercaptopurine (ISO) mercury dichloride (ISO) methapyrilene (EXP) methimazole (ISO) N-[2-(4-bromocinnamylamino)ethyl]isoquinoline-5-sulfonamide (ISO) N-acetyl-L-cysteine (EXP) N-nitrosodiethylamine (ISO) paracetamol (EXP,ISO) perfluorooctanoic acid (EXP) phenytoin (ISO) phorbol 13-acetate 12-myristate (ISO) pirinixic acid (ISO) potassium atom (ISO) potassium dichromate (ISO) progesterone (ISO) purine-6-thiol (ISO) scopolamine (ISO) silicon dioxide (EXP) sodium arsenite (EXP) Soman (ISO) staurosporine (ISO) streptozocin (ISO) tetrachloromethane (ISO) tetraphene (ISO) thioacetamide (ISO) Thioperamide (ISO) toluene (ISO) trichloroethene (ISO) trichostatin A (EXP) trimethyltin (ISO) triprolidine (ISO) triptonide (ISO) valproic acid (EXP,ISO) wortmannin (ISO) XL147 (ISO)
1.
Increased neurotrophin production in a Penicillium chrysogenum-induced allergic asthma model in mice.
Chung YJ, etal., J Toxicol Environ Health A. 2007 Jun;70(12):1020-6.
2.
Neurotrophins and neurotrophin receptors in pulmonary sarcoidosis - granulomas as a source of expression.
Dagnell C, etal., Respir Res. 2010 Nov 8;11:156.
3.
GOAs Human GO annotations
GOA_HUMAN data from the GO Consortium
4.
Transcriptional down-regulation of neurotrophin-3 in chronic obstructive pulmonary disease.
Groneberg DA, etal., Biol Chem. 2005 Jan;386(1):53-9.
5.
Elevated nerve growth factor and neurotrophin-3 levels in cerebrospinal fluid of children with hydrocephalus.
Hochhaus F, etal., BMC Pediatr 2001;1(1):2. Epub 2001 Aug 24.
6.
Possible association of missense mutation (Gly[-63]Glu) of the neurotrophin-3 gene with Alzheimer's disease in Japanese.
Kunugi H, etal., Neurosci Lett 1998 Jan 23;241(1):65-7.
7.
Human and rat brain-derived neurotrophic factor and neurotrophin-3: gene structures, distributions, and chromosomal localizations.
Maisonpierre PC, etal., Genomics 1991 Jul;10(3):558-68.
8.
Chronic exposure to ethanol alters neurotrophin content in the basal forebrain-cortex system in the mature rat: effects on autocrine-paracrine mechanisms.
Miller MW and Mooney SM, J Neurobiol. 2004 Sep 15;60(4):490-8. doi: 10.1002/neu.20059.
9.
Transplants of fibroblasts expressing BDNF and NT-3 promote recovery of bladder and hindlimb function following spinal contusion injury in rats.
Mitsui T, etal., Exp Neurol. 2005 Aug;194(2):410-31.
10.
The influence of inhalative corticosteroids on circulating Nerve Growth Factor, Brain-Derived Neurotrophic Factor and Neurotrophin-3 in allergic asthmatics.
Noga O, etal., Clin Exp Allergy. 2001 Dec;31(12):1906-12.
11.
Environmental enrichment alters neurotrophin levels after fetal alcohol exposure in rats.
Parks EA, etal., Alcohol Clin Exp Res. 2008 Oct;32(10):1741-51. doi: 10.1111/j.1530-0277.2008.00759.x. Epub 2008 Jul 24.
12.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
13.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
14.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
15.
Neurotrophin system activation in bronchoalveolar lavage fluid immune cells in pulmonary sarcoidosis.
Ricci A, etal., Sarcoidosis Vasc Diffuse Lung Dis. 2005 Oct;22(3):186-94.
16.
Neurotrophin-3 mRNA a putative target of miR21 following status epilepticus.
Risbud RM, etal., Brain Res. 2011 Nov 18;1424:53-9. doi: 10.1016/j.brainres.2011.09.039. Epub 2011 Sep 24.
17.
Alcohol-induced cognitive deficits are associated with decreased circulating levels of the neurotrophin BDNF in humans and rats.
Silva-Peña D, etal., Addict Biol. 2019 Sep;24(5):1019-1033. doi: 10.1111/adb.12668. Epub 2018 Sep 12.
18.
Alterations in neurotrophin and neurotrophin receptor gene expression patterns in the rat central nervous system following perinatal Borna disease virus infection.
Zocher M, etal., J Neurovirol. 2000 Dec;6(6):462-77.
NTF3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 5,430,332 - 5,495,299 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 5,432,108 - 5,521,536 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 5,541,274 - 5,604,465 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 5,411,541 - 5,474,726 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 12 5,473,526 - 5,474,725 NCBI Celera 12 7,162,184 - 7,225,194 (+) NCBI Celera Cytogenetic Map 12 p13.31 NCBI HuRef 12 5,455,606 - 5,458,036 (+) NCBI HuRef CHM1_1 12 5,540,527 - 5,604,287 (+) NCBI CHM1_1 T2T-CHM13v2.0 12 5,437,400 - 5,502,089 (+) NCBI T2T-CHM13v2.0
Ntf3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 6 126,078,375 - 126,143,703 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 6 126,078,375 - 126,143,873 (-) Ensembl GRCm39 Ensembl GRCm38 6 126,101,412 - 126,166,772 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 6 126,101,412 - 126,166,910 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 6 126,051,430 - 126,116,762 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 6 126,067,031 - 126,130,540 (-) NCBI MGSCv36 mm8 Celera 6 127,765,447 - 127,832,752 (-) NCBI Celera Cytogenetic Map 6 F3 NCBI cM Map 6 60.45 NCBI
Ntf3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 160,601,161 - 160,670,623 (-) NCBI GRCr8 mRatBN7.2 4 158,914,984 - 158,984,453 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 158,914,957 - 158,984,596 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 165,144,795 - 165,214,257 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 160,927,698 - 160,997,163 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 159,561,745 - 159,631,144 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 158,636,883 - 158,705,886 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 158,636,884 - 158,705,886 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 225,638,801 - 225,707,719 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 162,435,781 - 162,506,961 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 162,680,717 - 162,751,897 (-) NCBI Celera 4 147,640,921 - 147,710,546 (-) NCBI Celera Cytogenetic Map 4 q42 NCBI
Ntf3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955413 3,207,123 - 3,273,491 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955413 3,207,669 - 3,273,371 (+) NCBI ChiLan1.0 ChiLan1.0
NTF3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 10 10,982,176 - 11,046,479 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 12 10,978,933 - 11,043,237 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 12 5,551,734 - 5,615,981 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 12 5,470,093 - 5,534,300 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 12 5,530,508 - 5,533,989 (+) Ensembl panpan1.1 panPan2
NTF3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 27 39,383,017 - 39,454,613 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 27 39,383,152 - 39,454,601 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 27 7,231,693 - 7,233,370 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 27 39,739,752 - 39,811,227 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 27 39,739,747 - 39,811,226 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 27 39,608,720 - 39,679,940 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 27 39,650,338 - 39,721,747 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 27 6,639,885 - 6,711,187 (+) NCBI UU_Cfam_GSD_1.0
Ntf3 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404945 103,495,858 - 103,555,782 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936709 2,163,334 - 2,223,552 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936709 2,163,510 - 2,223,429 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
NTF3 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 5 65,052,519 - 65,123,788 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 5 65,052,608 - 65,122,645 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 5 67,204,186 - 67,204,959 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
NTF3
Ntf3
.
Confirmed Target Of
MIR200C hsa-miR-200c-3p Mirtarbase external_info Luciferase reporter assay Functional MTI 23185507
Predicted Target Of
Count of predictions: 1209 Count of miRNA genes: 685 Interacting mature miRNAs: 806 Transcripts: ENST00000331010, ENST00000423158, ENST00000535299, ENST00000541234, ENST00000543548, ENST00000544836 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
597077799 GWAS1173873_H blood protein measurement QTL GWAS1173873 (human) 0.000009 blood protein amount (VT:0005416) blood protein measurement (CMO:0000028) 12 5441572 5441573 Human 597161316 GWAS1257390_H gut microbiome measurement QTL GWAS1257390 (human) 1e-08 gut microbiome measurement 12 5491159 5491160 Human 597105184 GWAS1201258_H cytokine measurement QTL GWAS1201258 (human) 0.000003 cytokine measurement blood cytokine measurement (CMO:0001924) 12 5443895 5443896 Human 597324034 GWAS1420108_H colonic neoplasm QTL GWAS1420108 (human) 0.0000002 colonic neoplasm 12 5463044 5463045 Human 597277698 GWAS1373772_H Alzheimer disease QTL GWAS1373772 (human) 4e-08 Alzheimer disease 12 5456966 5456967 Human
D12S99
Human Assembly Chr Position (strand) Source JBrowse GRCh37 12 5,564,600 - 5,564,819 UniSTS GRCh37 GRCh37 8 139,570,228 - 139,571,337 UniSTS GRCh37 GRCh37 12 5,564,771 - 5,564,899 UniSTS GRCh37 Build 36 12 5,435,032 - 5,435,160 RGD NCBI36 Celera 12 7,185,663 - 7,185,791 RGD Celera 8 135,739,169 - 135,740,278 UniSTS Celera 12 7,185,492 - 7,185,711 UniSTS Cytogenetic Map 12 p13 UniSTS HuRef 12 5,420,614 - 5,420,825 UniSTS HuRef 12 5,420,777 - 5,420,905 UniSTS Marshfield Genetic Map 12 12.6 RGD Genethon Genetic Map 12 13.9 UniSTS deCODE Assembly Map 12 15.2 UniSTS Stanford-G3 RH Map 12 282.0 UniSTS GeneMap99-GB4 RH Map 12 31.56 UniSTS Whitehead-YAC Contig Map 12 UniSTS NCBI RH Map 12 81.6 UniSTS GeneMap99-G3 RH Map 12 282.0 UniSTS
G42645
Human Assembly Chr Position (strand) Source JBrowse GRCh37 12 5,577,944 - 5,578,377 UniSTS GRCh37 Build 36 12 5,448,205 - 5,448,638 RGD NCBI36 Celera 12 7,198,834 - 7,199,267 RGD Cytogenetic Map 12 p13 UniSTS HuRef 12 5,433,944 - 5,434,377 UniSTS
GDB:210011
Human Assembly Chr Position (strand) Source JBrowse GRCh37 12 5,541,654 - 5,541,804 UniSTS GRCh37 Build 36 12 5,411,915 - 5,412,065 RGD NCBI36 Celera 12 7,162,558 - 7,162,708 RGD Cytogenetic Map 12 p13 UniSTS HuRef 12 5,397,680 - 5,397,824 UniSTS
GDB:214846
Human Assembly Chr Position (strand) Source JBrowse GRCh37 12 5,603,299 - 5,603,818 UniSTS GRCh37 Build 36 12 5,473,560 - 5,474,079 RGD NCBI36 Celera 12 7,224,028 - 7,224,547 RGD Cytogenetic Map 12 p13 UniSTS HuRef 12 5,456,870 - 5,457,389 UniSTS
SHGC-142535
Human Assembly Chr Position (strand) Source JBrowse GRCh37 12 5,596,504 - 5,596,775 UniSTS GRCh37 Build 36 12 5,466,765 - 5,467,036 RGD NCBI36 Celera 12 7,217,233 - 7,217,504 RGD Cytogenetic Map 12 p13 UniSTS HuRef 12 5,450,076 - 5,450,347 UniSTS TNG Radiation Hybrid Map 12 3340.0 UniSTS
SHGC-943
Human Assembly Chr Position (strand) Source JBrowse GRCh37 12 5,564,640 - 5,564,899 UniSTS GRCh37 Build 36 12 5,434,901 - 5,435,160 RGD NCBI36 Celera 12 7,185,532 - 7,185,791 RGD Cytogenetic Map 12 p13 UniSTS HuRef 12 5,420,654 - 5,420,905 UniSTS TNG Radiation Hybrid Map 12 3337.0 UniSTS
SHGC-149817
Human Assembly Chr Position (strand) Source JBrowse GRCh37 12 5,598,360 - 5,598,642 UniSTS GRCh37 Build 36 12 5,468,621 - 5,468,903 RGD NCBI36 Celera 12 7,219,089 - 7,219,371 RGD Cytogenetic Map 12 p13 UniSTS HuRef 12 5,451,932 - 5,452,214 UniSTS TNG Radiation Hybrid Map 12 3343.0 UniSTS
UniSTS:225313
Human Assembly Chr Position (strand) Source JBrowse GRCh37 12 5,604,329 - 5,604,480 UniSTS GRCh37 Build 36 12 5,474,590 - 5,474,741 RGD NCBI36 Celera 12 7,225,058 - 7,225,209 RGD HuRef 12 5,457,900 - 5,458,051 UniSTS
G19257
Human Assembly Chr Position (strand) Source JBrowse GRCh37 12 5,570,613 - 5,570,765 UniSTS GRCh37 Build 36 12 5,440,874 - 5,441,026 RGD NCBI36 Celera 12 7,191,505 - 7,191,657 RGD Cytogenetic Map 12 p13 UniSTS HuRef 12 5,426,619 - 5,426,771 UniSTS
RH48860
Human Assembly Chr Position (strand) Source JBrowse GRCh37 12 5,558,635 - 5,558,759 UniSTS GRCh37 Build 36 12 5,428,896 - 5,429,020 RGD NCBI36 Celera 12 7,179,529 - 7,179,653 RGD Cytogenetic Map 12 p13 UniSTS HuRef 12 5,414,651 - 5,414,775 UniSTS GeneMap99-GB4 RH Map 12 31.56 UniSTS NCBI RH Map 12 81.6 UniSTS
Ntf3
Human Assembly Chr Position (strand) Source JBrowse GRCh37 12 5,603,412 - 5,604,432 UniSTS GRCh37 Celera 12 7,224,141 - 7,225,161 UniSTS HuRef 12 5,456,983 - 5,458,003 UniSTS
UniSTS:483844
Human Assembly Chr Position (strand) Source JBrowse GRCh37 12 5,603,314 - 5,604,344 UniSTS GRCh37 Celera 12 7,224,043 - 7,225,073 UniSTS HuRef 12 5,456,885 - 5,457,915 UniSTS
D12S99
Human Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 12 p13 UniSTS Marshfield Genetic Map 12 12.6 UniSTS Genethon Genetic Map 12 13.9 UniSTS deCODE Assembly Map 12 15.2 UniSTS GeneMap99-GB4 RH Map 12 31.56 UniSTS Whitehead-YAC Contig Map 12 UniSTS NCBI RH Map 12 81.6 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
entire extraembryonic component
1204
2364
2787
2238
4538
1682
2196
4
599
922
439
2222
6176
5441
25
3337
1
817
1693
1491
173
1
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENST00000331010 ⟹ ENSP00000328738
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 12 5,494,132 - 5,495,159 (+) Ensembl
Ensembl Acc Id:
ENST00000423158 ⟹ ENSP00000397297
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 12 5,432,108 - 5,495,299 (+) Ensembl
Ensembl Acc Id:
ENST00000535299
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 12 5,432,112 - 5,521,536 (+) Ensembl
Ensembl Acc Id:
ENST00000541234
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 12 5,511,657 - 5,513,393 (+) Ensembl
Ensembl Acc Id:
ENST00000543548
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 12 5,433,125 - 5,494,501 (+) Ensembl
Ensembl Acc Id:
ENST00000544836
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 12 5,511,609 - 5,513,076 (+) Ensembl
RefSeq Acc Id:
NM_001102654 ⟹ NP_001096124
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 12 5,432,108 - 5,495,299 (+) NCBI GRCh37 12 5,541,280 - 5,604,465 (+) NCBI Build 36 12 5,411,541 - 5,474,726 (+) NCBI Archive HuRef 12 5,455,606 - 5,458,036 (+) ENTREZGENE CHM1_1 12 5,540,527 - 5,604,287 (+) NCBI T2T-CHM13v2.0 12 5,438,342 - 5,502,089 (+) NCBI
Sequence:
ACTCAGAGTTGAAGCTCCTCTCCCTTCCGAACAGCTCCGCGCACCGCCCCGCGACGCAGCCCGGCGCAACTACTTTCTTCTCTCTCCTTTCTTTCTTCCTCTCCTTTTTCCCCTGCTGGGTAGTGGCT
hide sequence
RefSeq Acc Id:
NM_002527 ⟹ NP_002518
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 12 5,494,132 - 5,495,299 (+) NCBI GRCh37 12 5,541,280 - 5,604,465 (+) ENTREZGENE Build 36 12 5,473,559 - 5,474,726 (+) NCBI Archive HuRef 12 5,455,606 - 5,458,036 (+) ENTREZGENE CHM1_1 12 5,603,120 - 5,604,287 (+) NCBI T2T-CHM13v2.0 12 5,500,922 - 5,502,089 (+) NCBI
Sequence:
TGCCAGAATAACACAGACTCAGCTGCCAGAGCCTGCTCTTAACACCTGTGTTTCCTTTTCAGAT
hide sequence
RefSeq Acc Id:
XM_011520963 ⟹ XP_011519265
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 12 5,433,269 - 5,495,299 (+) NCBI
Sequence:
GTTGGAGTTCCCCGAAAGGGTTTTTTCAGAAAAGACCTCGCGCCCCGGGCTCCTCTTGGCCAGCGCCCACCCGGTGGCCACCCCACCCTGGGCCTTTGCGCAGATGTTGGAGCTCCGTACGCAGCCCG
hide sequence
RefSeq Acc Id:
XM_047428901 ⟹ XP_047284857
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 12 5,430,332 - 5,495,299 (+) NCBI
RefSeq Acc Id:
XM_054372132 ⟹ XP_054228107
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 12 5,437,400 - 5,502,089 (+) NCBI
RefSeq Acc Id:
XM_054372133 ⟹ XP_054228108
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 12 5,439,493 - 5,502,089 (+) NCBI
RefSeq Acc Id:
NP_001096124 ⟸ NM_001102654
- Peptide Label:
isoform 1 preproprotein
- UniProtKB:
P20783 (UniProtKB/Swiss-Prot)
- Sequence:
MVTFATILQVNKVMSILFYVIFLAYLRGIQGNNMDQRSLPEDSLNSLIIKLIQADILKNKLSKQMVDVKENYQSTLPKAEAPREPERGGPAKSAFQPVIAMDTELLRQQRRYNSPRVLLSDSTPLEPP
hide sequence
RefSeq Acc Id:
NP_002518 ⟸ NM_002527
- Peptide Label:
isoform 2 preproprotein
- UniProtKB:
B7Z1T5 (UniProtKB/Swiss-Prot), Q6FH50 (UniProtKB/Swiss-Prot), P20783 (UniProtKB/Swiss-Prot)
- Sequence:
MSILFYVIFLAYLRGIQGNNMDQRSLPEDSLNSLIIKLIQADILKNKLSKQMVDVKENYQSTLP
hide sequence
RefSeq Acc Id:
XP_011519265 ⟸ XM_011520963
- Peptide Label:
isoform X1
- UniProtKB:
B7Z1T5 (UniProtKB/Swiss-Prot), Q6FH50 (UniProtKB/Swiss-Prot), P20783 (UniProtKB/Swiss-Prot)
- Sequence:
MSILFYVIFLAYLRGIQGNNMDQRSLPEDSLNSLIIKLIQADILKNKLSKQMVDVKENYQSTLPKAEAPREPERGGPAKSAFQPVIAMDTELLRQQRRYNSPRVLLSDSTPLEPPPLYLMEDYVGSPV
hide sequence
Ensembl Acc Id:
ENSP00000397297 ⟸ ENST00000423158
Ensembl Acc Id:
ENSP00000328738 ⟸ ENST00000331010
RefSeq Acc Id:
XP_047284857 ⟸ XM_047428901
- Peptide Label:
isoform X1
- UniProtKB:
P20783 (UniProtKB/Swiss-Prot), B7Z1T5 (UniProtKB/Swiss-Prot), Q6FH50 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_054228107 ⟸ XM_054372132
- Peptide Label:
isoform X1
- UniProtKB:
Q6FH50 (UniProtKB/Swiss-Prot), P20783 (UniProtKB/Swiss-Prot), B7Z1T5 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_054228108 ⟸ XM_054372133
- Peptide Label:
isoform X1
- UniProtKB:
Q6FH50 (UniProtKB/Swiss-Prot), P20783 (UniProtKB/Swiss-Prot), B7Z1T5 (UniProtKB/Swiss-Prot)
RGD ID: 7222825 Promoter ID: EPDNEW_H17158 Type: initiation region Name: NTF3_2 Description: neurotrophin 3 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_H17160 EPDNEW_H17159 Experiment Methods: Single-end sequencing.; Paired-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 12 5,430,332 - 5,430,392 EPDNEW
RGD ID: 7222833 Promoter ID: EPDNEW_H17159 Type: multiple initiation site Name: NTF3_3 Description: neurotrophin 3 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_H17158 EPDNEW_H17160 Experiment Methods: Single-end sequencing.; Paired-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 12 5,431,199 - 5,431,259 EPDNEW
RGD ID: 7222827 Promoter ID: EPDNEW_H17160 Type: initiation region Name: NTF3_1 Description: neurotrophin 3 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_H17158 EPDNEW_H17159 Experiment Methods: Single-end sequencing.; Paired-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 12 5,432,112 - 5,432,172 EPDNEW
