Advanced Search (OLGA)

Gene: TCP1 (t-complex 1) Homo sapiens

Subscribe to Updates

Analyze

Symbol:

TCP1

Name:

t-complex 1

RGD ID:

732136

HGNC Page

HGNC:11655

Description:

Enables protein folding chaperone and ubiquitin protein ligase binding activity. Involved in chaperone mediated protein folding independent of cofactor; positive regulation of telomerase RNA localization to Cajal body; and protein stabilization. Acts upstream of with a positive effect on scaRNA localization to Cajal body. Located in centrosome and microtubule. Part of chaperonin-containing T-complex.

Type:

protein-coding

RefSeq Status:

REVIEWED

Previously known as:

CCT-alpha; CCT1; CCTa; chaperonin containing T-complex polypeptide 1 subunit 1; D6S230E; IDDPMGS; t-complex protein 1; T-complex protein 1 subunit alpha; T-complex protein 1, alpha subunit; tailless complex polypeptide 1; TCP-1-alpha

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Mus musculus (house mouse):	Tcp1 (t-complex protein 1)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Rattus norvegicus (Norway rat):	Tcp1 (t-complex 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Chinchilla lanigera (long-tailed chinchilla):	Tcp1 (t-complex 1)	NCBI	Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):	TCP1 (t-complex 1)	NCBI	Ortholog
Canis lupus familiaris (dog):	TCP1 (t-complex 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Tcp1 (t-complex 1)	NCBI	Ortholog
Sus scrofa (pig):	TCP1 (t-complex 1)	HGNC	EggNOG, Ensembl, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Chlorocebus sabaeus (green monkey):	TCP1 (t-complex 1)	NCBI	Ortholog
Heterocephalus glaber (naked mole-rat):	Tcp1 (t-complex 1)	NCBI	Ortholog
Other homologs ²
Rattus norvegicus (Norway rat):	Arid5a (AT-rich interaction domain 5A)	HGNC	OMA
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Tcp1 (t-complex 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Tcp1 (t-complex protein 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	tcp1 (t-complex 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid\|ZFIN)
Drosophila melanogaster (fruit fly):	CCT1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	TCP1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	cct-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus laevis (African clawed frog):	tcp1.L	Alliance	DIOPT (Xenbase)
Xenopus laevis (African clawed frog):	tcp1.S	Alliance	DIOPT (Xenbase)

Related Pseudogenes:

TCP1P1 TCP1P2 TCP1P3

Allele / Splice:

See ClinVar data

Latest Assembly:

GRCh38 - Human Genome Assembly GRCh38

Position:

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	159,778,498 - 159,789,602 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	159,778,498 - 159,789,703 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	6	160,199,530 - 160,210,634 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	160,119,520 - 160,130,725 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	6	160,169,941 - 160,181,146	NCBI
Celera	6	160,845,607 - 160,856,819 (-)	NCBI		Celera
Cytogenetic Map	6	q25.3	NCBI
HuRef	6	157,669,773 - 157,680,978 (-)	NCBI		HuRef
CHM1_1	6	160,461,821 - 160,473,042 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	6	161,024,115 - 161,035,234 (-)	NCBI		T2T-CHM13v2.0

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
TCP1	Human	3-methylglutaconic aciduria with deafness, encephalopathy, and Leigh-like syndrome		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: 3-methylglutaconic aciduria with deafness more ...	ClinVar	PMID:15220921 more ...
TCP1	Human	INTELLECTUAL DEVELOPMENTAL DISORDER WITH POLYMICROGYRIA AND SEIZURES		IAGP	(Homo sapiens) more ...	8554872	ClinVar Annotator: match by term: INTELLECTUAL DEVELOPMENTAL DISORDER WITH POLYMICROGYRIA AND SEIZURES	ClinVar	PMID:39480921

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
TCP1	Human	Prostatic Neoplasms		EXP		11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:17566973

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
TCP1	Human	INTELLECTUAL DEVELOPMENTAL DISORDER WITH POLYMICROGYRIA AND SEIZURES		IAGP		7240710		OMIM

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
TCP1	Human	1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane	increases expression	ISO	Tcp1 (Mus musculus)	6480464	o and p'-DDT results in increased expression of TCP1 mRNA	CTD	PMID:24096037
TCP1	Human	1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane	increases expression	ISO	Tcp1 (Rattus norvegicus)	6480464	o and p'-DDT results in increased expression of TCP1 mRNA	CTD	PMID:24096037
TCP1	Human	1,2-dichloroethane	increases expression	ISO	Tcp1 (Mus musculus)	6480464	ethylene dichloride results in increased expression of TCP1 mRNA	CTD	PMID:28960355
TCP1	Human	1,2-dimethylhydrazine	multiple interactions	ISO	Tcp1 (Mus musculus)	6480464	[1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of TCP1 mRNA	CTD	PMID:22206623
TCP1	Human	17alpha-ethynylestradiol	multiple interactions	ISO	Tcp1 (Mus musculus)	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of TCP1 mRNA	CTD	PMID:17942748
TCP1	Human	17alpha-ethynylestradiol	increases expression	ISO	Tcp1 (Rattus norvegicus)	6480464	Ethinyl Estradiol results in increased expression of TCP1 mRNA	CTD	PMID:16174780 and PMID:24096037
TCP1	Human	17alpha-ethynylestradiol	increases expression	ISO	Tcp1 (Mus musculus)	6480464	Ethinyl Estradiol results in increased expression of TCP1 mRNA	CTD	PMID:16174780 more ...
TCP1	Human	17beta-estradiol	decreases expression	ISO	Tcp1 (Mus musculus)	6480464	Estradiol results in decreased expression of TCP1 mRNA	CTD	PMID:30077407 and PMID:39298647
TCP1	Human	17beta-estradiol	multiple interactions	ISO	Tcp1 (Mus musculus)	6480464	[Polyphenols co-treated with Estradiol] results in increased expression of TCP1 mRNA	CTD	PMID:30077407
TCP1	Human	1H-pyrazole	increases expression	ISO	Tcp1 (Mus musculus)	6480464	pyrazole results in increased expression of TCP1 mRNA	CTD	PMID:17945193
TCP1	Human	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	Tcp1 (Mus musculus)	6480464	[Tetrachlorodibenzodioxin binds to AHR protein] which results in increased expression of TCP1 mRNA and [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of TCP1 mRNA	CTD	PMID:16214954 and PMID:17942748
TCP1	Human	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	Tcp1 (Rattus norvegicus)	6480464	Tetrachlorodibenzodioxin results in decreased expression of TCP1 protein	CTD	PMID:19201780
TCP1	Human	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Tcp1 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of TCP1 mRNA	CTD	PMID:21570461
TCP1	Human	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	Tcp1 (Mus musculus)	6480464	Tetrachlorodibenzodioxin results in decreased expression of TCP1 mRNA	CTD	PMID:19770486
TCP1	Human	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	Tcp1 (Mus musculus)	6480464	Tetrachlorodibenzodioxin results in increased expression of TCP1 mRNA	CTD	PMID:18796159
TCP1	Human	2,4-dinitrotoluene	affects expression	ISO	Tcp1 (Rattus norvegicus)	6480464	2 and 4-dinitrotoluene affects the expression of TCP1 mRNA	CTD	PMID:21346803
TCP1	Human	2,6-dimethoxyphenol	multiple interactions	EXP		6480464	[Sodium Chloride co-treated with pyrogallol 1 and 3-dimethyl ether] results in decreased expression of and affects the localization of TCP1 protein	CTD	PMID:38598786
TCP1	Human	2,6-dinitrotoluene	affects expression	ISO	Tcp1 (Rattus norvegicus)	6480464	2 and 6-dinitrotoluene affects the expression of TCP1 mRNA	CTD	PMID:21346803
TCP1	Human	2-bromohexadecanoic acid	multiple interactions	EXP		6480464	2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of TCP1 protein]	CTD	PMID:38195004
TCP1	Human	3-chloropropane-1,2-diol	decreases expression	ISO	Tcp1 (Rattus norvegicus)	6480464	alpha-Chlorohydrin analog results in decreased expression of TCP1 protein	CTD	PMID:26072098
TCP1	Human	4,4'-diaminodiphenylmethane	increases expression	ISO	Tcp1 (Mus musculus)	6480464	4 and 4'-diaminodiphenylmethane results in increased expression of TCP1 mRNA	CTD	PMID:18648102
TCP1	Human	4,4'-sulfonyldiphenol	increases expression	ISO	Tcp1 (Mus musculus)	6480464	bisphenol S results in increased expression of TCP1 mRNA	CTD	PMID:39298647
TCP1	Human	4,4'-sulfonyldiphenol	increases expression	EXP		6480464	bisphenol S results in increased expression of TCP1 protein	CTD	PMID:34186270
TCP1	Human	4,4'-sulfonyldiphenol	multiple interactions	ISO	Tcp1 (Rattus norvegicus)	6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of TCP1 mRNA	CTD	PMID:36041667
TCP1	Human	4-amino-2,6-dinitrotoluene	affects expression	ISO	Tcp1 (Rattus norvegicus)	6480464	4-amino-2 and 6-dinitrotoluene affects the expression of TCP1 mRNA	CTD	PMID:21346803
TCP1	Human	6-propyl-2-thiouracil	increases expression	ISO	Tcp1 (Rattus norvegicus)	6480464	Propylthiouracil results in increased expression of TCP1 mRNA	CTD	PMID:30047161
TCP1	Human	acrolein	multiple interactions	EXP		6480464	[Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of TCP1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of TCP1 mRNA	CTD	PMID:32699268
TCP1	Human	acrylamide	decreases expression	ISO	Tcp1 (Rattus norvegicus)	6480464	Acrylamide results in decreased expression of TCP1 mRNA	CTD	PMID:28959563
TCP1	Human	acrylamide	increases expression	EXP		6480464	Acrylamide results in increased expression of TCP1 mRNA	CTD	PMID:32763439
TCP1	Human	aflatoxin B1	decreases methylation	EXP		6480464	Aflatoxin B1 results in decreased methylation of TCP1 gene	CTD	PMID:27153756
TCP1	Human	albendazole	multiple interactions	EXP		6480464	[Ivermectin co-treated with Albendazole] results in increased expression of TCP1 mRNA	CTD	PMID:16861626
TCP1	Human	alpha-pinene	multiple interactions	EXP		6480464	[Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of TCP1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of TCP1 mRNA	CTD	PMID:32699268
TCP1	Human	amitrole	increases expression	ISO	Tcp1 (Rattus norvegicus)	6480464	Amitrole results in increased expression of TCP1 mRNA	CTD	PMID:30047161
TCP1	Human	ammonium chloride	affects expression	ISO	Tcp1 (Rattus norvegicus)	6480464	Ammonium Chloride affects the expression of TCP1 mRNA	CTD	PMID:16483693
TCP1	Human	aristolochic acid A	decreases expression	EXP		6480464	aristolochic acid I results in decreased expression of TCP1 mRNA	CTD	PMID:33212167
TCP1	Human	arsenous acid	increases expression	EXP		6480464	Arsenic Trioxide results in increased expression of TCP1 mRNA and Arsenic Trioxide results in increased expression of TCP1 protein	CTD	PMID:20458559 and PMID:25419056
TCP1	Human	benzo[a]pyrene	increases expression	ISO	Tcp1 (Mus musculus)	6480464	Benzo(a)pyrene results in increased expression of TCP1 mRNA	CTD	PMID:20504355 and PMID:22228805
TCP1	Human	benzo[a]pyrene	affects methylation	EXP		6480464	Benzo(a)pyrene affects the methylation of TCP1 promoter	CTD	PMID:27901495
TCP1	Human	beta-lapachone	increases expression	EXP		6480464	beta-lapachone results in increased expression of TCP1 mRNA	CTD	PMID:38218311
TCP1	Human	bis(2-ethylhexyl) phthalate	decreases expression	ISO	Tcp1 (Mus musculus)	6480464	Diethylhexyl Phthalate results in decreased expression of TCP1 mRNA	CTD	PMID:33754040
TCP1	Human	bisphenol A	increases expression	ISO	Tcp1 (Rattus norvegicus)	6480464	bisphenol A results in increased expression of TCP1 mRNA	CTD	PMID:25181051
TCP1	Human	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of TCP1 protein	CTD	PMID:34186270
TCP1	Human	bisphenol A	multiple interactions	ISO	Tcp1 (Rattus norvegicus)	6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of TCP1 mRNA	CTD	PMID:36041667
TCP1	Human	bisphenol A	affects expression	EXP		6480464	bisphenol A affects the expression of TCP1 mRNA	CTD	PMID:30903817
TCP1	Human	bisphenol A	decreases expression	ISO	Tcp1 (Rattus norvegicus)	6480464	bisphenol A results in decreased expression of TCP1 mRNA	CTD	PMID:30816183 and PMID:34947998
TCP1	Human	bisphenol AF	increases expression	EXP		6480464	bisphenol AF results in increased expression of TCP1 protein	CTD	PMID:34186270
TCP1	Human	Bisphenol B	increases expression	EXP		6480464	bisphenol B results in increased expression of TCP1 protein	CTD	PMID:34186270
TCP1	Human	bisphenol F	multiple interactions	ISO	Tcp1 (Rattus norvegicus)	6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of TCP1 mRNA	CTD	PMID:36041667
TCP1	Human	bisphenol F	increases expression	EXP		6480464	bisphenol F results in increased expression of TCP1 protein	CTD	PMID:34186270
TCP1	Human	bleomycin A2	multiple interactions	ISO	Tcp1 (Mus musculus)	6480464	[Etoposide co-treated with Cisplatin co-treated with Bleomycin] results in decreased expression of TCP1 protein	CTD	PMID:29733421
TCP1	Human	bleomycin A5	decreases expression	EXP		6480464	bleomycetin results in decreased expression of TCP1 mRNA	CTD	PMID:21040473
TCP1	Human	bufalin	decreases expression	EXP		6480464	bufalin results in decreased expression of TCP1 protein	CTD	PMID:23091618
TCP1	Human	cadmium atom	multiple interactions	EXP		6480464	2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of TCP1 protein] more ...	CTD	PMID:33040242 and PMID:38195004
TCP1	Human	cadmium atom	increases oxidation	ISO	Tcp1 (Mus musculus)	6480464	Cadmium results in increased oxidation of TCP1 protein	CTD	PMID:24077948
TCP1	Human	cadmium dichloride	increases methylation	ISO	Tcp1 (Rattus norvegicus)	6480464	Cadmium Chloride results in increased methylation of TCP1 promoter	CTD	PMID:22457795
TCP1	Human	cadmium dichloride	multiple interactions	EXP		6480464	2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of TCP1 protein] more ...	CTD	PMID:33040242 and PMID:38195004
TCP1	Human	caffeine	increases expression	EXP		6480464	Caffeine results in increased expression of TCP1 protein	CTD	PMID:31195006
TCP1	Human	caffeine	affects phosphorylation	EXP		6480464	Caffeine affects the phosphorylation of TCP1 protein	CTD	PMID:35688186
TCP1	Human	carbon nanotube	affects expression	ISO	Tcp1 (Mus musculus)	6480464	Nanotubes and Carbon affects the expression of TCP1 protein	CTD	PMID:21135415
TCP1	Human	carbon nanotube	increases expression	ISO	Tcp1 (Mus musculus)	6480464	Nanotubes more ...	CTD	PMID:25554681 and PMID:25620056
TCP1	Human	chlorpyrifos	decreases expression	ISO	Tcp1 (Mus musculus)	6480464	Chlorpyrifos results in decreased expression of TCP1 mRNA	CTD	PMID:37019170
TCP1	Human	chromium(6+)	affects expression	ISO	Tcp1 (Mus musculus)	6480464	chromium hexavalent ion affects the expression of TCP1 mRNA	CTD	PMID:28472532
TCP1	Human	chromium(6+)	increases expression	EXP		6480464	chromium hexavalent ion results in increased expression of TCP1 mRNA	CTD	PMID:30690063
TCP1	Human	chromium(6+)	increases expression	ISO	Tcp1 (Rattus norvegicus)	6480464	chromium hexavalent ion results in increased expression of TCP1 mRNA	CTD	PMID:30690063
TCP1	Human	cisplatin	multiple interactions	ISO	Tcp1 (Mus musculus)	6480464	[Etoposide co-treated with Cisplatin co-treated with Bleomycin] results in decreased expression of TCP1 protein	CTD	PMID:29733421
TCP1	Human	copper atom	multiple interactions	EXP		6480464	[Disulfiram binds to Copper] which results in decreased expression of TCP1 mRNA	CTD	PMID:24690739
TCP1	Human	copper(0)	multiple interactions	EXP		6480464	[Disulfiram binds to Copper] which results in decreased expression of TCP1 mRNA	CTD	PMID:24690739
TCP1	Human	copper(II) sulfate	increases expression	EXP		6480464	Copper Sulfate results in increased expression of TCP1 mRNA	CTD	PMID:19549813
TCP1	Human	corticosterone	decreases expression	ISO	Tcp1 (Rattus norvegicus)	6480464	Corticosterone results in decreased expression of TCP1 mRNA	CTD	PMID:15755911
TCP1	Human	coumarin	decreases phosphorylation	EXP		6480464	coumarin results in decreased phosphorylation of TCP1 protein	CTD	PMID:35688186
TCP1	Human	cyclophosphamide	decreases expression	ISO	Tcp1 (Rattus norvegicus)	6480464	Cyclophosphamide results in decreased expression of TCP1 mRNA	CTD	PMID:11906922
TCP1	Human	cyclophosphamide	increases expression	ISO	Tcp1 (Rattus norvegicus)	6480464	Cyclophosphamide results in increased expression of TCP1 mRNA	CTD	PMID:11599041
TCP1	Human	cyclosporin A	decreases expression	EXP		6480464	Cyclosporine results in decreased expression of TCP1 mRNA	CTD	PMID:21163907 and PMID:22147139
TCP1	Human	diarsenic trioxide	increases expression	EXP		6480464	Arsenic Trioxide results in increased expression of TCP1 mRNA and Arsenic Trioxide results in increased expression of TCP1 protein	CTD	PMID:20458559 and PMID:25419056
TCP1	Human	dibutyl phthalate	decreases expression	ISO	Tcp1 (Mus musculus)	6480464	Dibutyl Phthalate results in decreased expression of TCP1 mRNA	CTD	PMID:17361019
TCP1	Human	dinophysistoxin 1	increases expression	EXP		6480464	dinophysistoxin 1 results in increased expression of TCP1 mRNA	CTD	PMID:28939011
TCP1	Human	dioxygen	increases expression	ISO	Tcp1 (Mus musculus)	6480464	Oxygen deficiency results in increased expression of TCP1 mRNA	CTD	PMID:24205000
TCP1	Human	disulfiram	multiple interactions	EXP		6480464	[Disulfiram binds to Copper] which results in decreased expression of TCP1 mRNA	CTD	PMID:24690739
TCP1	Human	elemental selenium	multiple interactions	ISO	Tcp1 (Rattus norvegicus)	6480464	[Selenium deficiency co-treated with Vitamin E deficiency] results in decreased expression of TCP1 mRNA	CTD	PMID:11444866
TCP1	Human	enzyme inhibitor	multiple interactions	EXP		6480464	[Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of TCP1 protein	CTD	PMID:23301498
TCP1	Human	epoxiconazole	decreases expression	ISO	Tcp1 (Mus musculus)	6480464	epoxiconazole results in decreased expression of TCP1 mRNA	CTD	PMID:35436446
TCP1	Human	ethanol	multiple interactions	ISO	Tcp1 (Rattus norvegicus)	6480464	[Fish Oils co-treated with Ethanol] results in increased expression of TCP1 mRNA	CTD	PMID:17347304
TCP1	Human	ethanol	affects splicing	ISO	Tcp1 (Mus musculus)	6480464	Ethanol affects the splicing of TCP1 mRNA	CTD	PMID:30319688
TCP1	Human	etoposide	multiple interactions	ISO	Tcp1 (Mus musculus)	6480464	[Etoposide co-treated with Cisplatin co-treated with Bleomycin] results in decreased expression of TCP1 protein	CTD	PMID:29733421
TCP1	Human	fenofibrate	multiple interactions	ISO	Tcp1 (Rattus norvegicus)	6480464	[Fenofibrate co-treated with Diethylnitrosamine] results in decreased expression of TCP1 mRNA	CTD	PMID:18253720
TCP1	Human	finasteride	increases expression	ISO	Tcp1 (Rattus norvegicus)	6480464	Finasteride results in increased expression of TCP1 mRNA	CTD	PMID:24136188
TCP1	Human	flavonoids	decreases expression	ISO	Tcp1 (Rattus norvegicus)	6480464	Flavonoids results in decreased expression of TCP1 mRNA	CTD	PMID:18035473
TCP1	Human	flutamide	increases expression	ISO	Tcp1 (Rattus norvegicus)	6480464	Flutamide results in increased expression of TCP1 mRNA	CTD	PMID:24136188
TCP1	Human	folic acid	multiple interactions	ISO	Tcp1 (Mus musculus)	6480464	[1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of TCP1 mRNA	CTD	PMID:22206623
TCP1	Human	folpet	increases expression	ISO	Tcp1 (Mus musculus)	6480464	folpet results in increased expression of TCP1 mRNA	CTD	PMID:31558096
TCP1	Human	FR900359	affects phosphorylation	EXP		6480464	FR900359 affects the phosphorylation of TCP1 protein	CTD	PMID:37730182
TCP1	Human	furfural	multiple interactions	EXP		6480464	[Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of TCP1 protein	CTD	PMID:38598786
TCP1	Human	gentamycin	increases expression	ISO	Tcp1 (Rattus norvegicus)	6480464	Gentamicins results in increased expression of TCP1 mRNA	CTD	PMID:22061828
TCP1	Human	hyaluronic acid	multiple interactions	ISO	Tcp1 (Rattus norvegicus)	6480464	Hyaluronic Acid analog inhibits the reaction [Hydrogen Peroxide results in decreased expression of TCP1 protein]	CTD	PMID:23178681
TCP1	Human	hydrogen peroxide	affects expression	EXP		6480464	Hydrogen Peroxide affects the expression of TCP1 mRNA	CTD	PMID:21179406
TCP1	Human	hydrogen peroxide	decreases expression	ISO	Tcp1 (Rattus norvegicus)	6480464	Hydrogen Peroxide results in decreased expression of TCP1 protein	CTD	PMID:23178681
TCP1	Human	hydrogen peroxide	multiple interactions	ISO	Tcp1 (Rattus norvegicus)	6480464	Hyaluronic Acid analog inhibits the reaction [Hydrogen Peroxide results in decreased expression of TCP1 protein]	CTD	PMID:23178681
TCP1	Human	ivermectin	multiple interactions	EXP		6480464	[Ivermectin co-treated with Albendazole] results in increased expression of TCP1 mRNA	CTD	PMID:16861626
TCP1	Human	ivermectin	decreases expression	EXP		6480464	Ivermectin results in decreased expression of TCP1 protein	CTD	PMID:32959892
TCP1	Human	lead(0)	affects splicing	EXP		6480464	Lead affects the splicing of TCP1 mRNA	CTD	PMID:28903495
TCP1	Human	lovastatin	increases expression	ISO	Tcp1 (Mus musculus)	6480464	Lovastatin results in increased expression of TCP1 mRNA	CTD	PMID:20493250
TCP1	Human	methimazole	increases expression	ISO	Tcp1 (Rattus norvegicus)	6480464	Methimazole results in increased expression of TCP1 mRNA	CTD	PMID:30047161
TCP1	Human	methotrexate	affects expression	ISO	Tcp1 (Mus musculus)	6480464	Methotrexate affects the expression of TCP1 mRNA	CTD	PMID:18502557
TCP1	Human	Monobutylphthalate	decreases expression	ISO	Tcp1 (Mus musculus)	6480464	monobutyl phthalate results in decreased expression of TCP1 protein	CTD	PMID:20553848
TCP1	Human	N-methyl-4-phenylpyridinium	decreases expression	ISO	Tcp1 (Rattus norvegicus)	6480464	1-Methyl-4-phenylpyridinium results in decreased expression of TCP1 mRNA	CTD	PMID:16026605
TCP1	Human	N-nitrosodiethylamine	multiple interactions	ISO	Tcp1 (Rattus norvegicus)	6480464	[Fenofibrate co-treated with Diethylnitrosamine] results in decreased expression of TCP1 mRNA	CTD	PMID:18253720
TCP1	Human	N-nitrosodiethylamine	decreases expression	ISO	Tcp1 (Rattus norvegicus)	6480464	Diethylnitrosamine results in decreased expression of TCP1 mRNA	CTD	PMID:17602206
TCP1	Human	naphthalene	multiple interactions	ISO	Tcp1 (Mus musculus)	6480464	[naphthalene co-treated with CFTR gene mutant form] results in decreased expression of TCP1 protein	CTD	PMID:19438287
TCP1	Human	nefazodone	increases expression	ISO	Tcp1 (Rattus norvegicus)	6480464	nefazodone results in increased expression of TCP1 mRNA	CTD	PMID:24136188
TCP1	Human	nimesulide	increases expression	ISO	Tcp1 (Rattus norvegicus)	6480464	nimesulide results in increased expression of TCP1 mRNA	CTD	PMID:24136188
TCP1	Human	Nonylphenol	increases expression	ISO	Tcp1 (Rattus norvegicus)	6480464	nonylphenol results in increased expression of TCP1 protein	CTD	PMID:19260726
TCP1	Human	okadaic acid	increases expression	EXP		6480464	Okadaic Acid results in increased expression of TCP1 mRNA	CTD	PMID:28939011
TCP1	Human	ozone	multiple interactions	EXP		6480464	[Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of TCP1 mRNA more ...	CTD	PMID:32699268 and PMID:35430440
TCP1	Human	ozone	multiple interactions	ISO	Tcp1 (Mus musculus)	6480464	[Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of TCP1 mRNA	CTD	PMID:34911549
TCP1	Human	paracetamol	decreases expression	EXP		6480464	Acetaminophen results in decreased expression of TCP1 mRNA	CTD	PMID:21163907
TCP1	Human	paracetamol	decreases expression	ISO	Tcp1 (Rattus norvegicus)	6480464	Acetaminophen results in decreased expression of TCP1 mRNA	CTD	PMID:33387578
TCP1	Human	parathion	increases expression	ISO	Tcp1 (Mus musculus)	6480464	Parathion results in increased expression of TCP1 mRNA	CTD	PMID:34813904
TCP1	Human	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	Tcp1 (Mus musculus)	6480464	[Dietary Fats co-treated with perfluorooctane sulfonic acid] results in decreased expression of TCP1 mRNA	CTD	PMID:33483757
TCP1	Human	PhIP	increases expression	ISO	Tcp1 (Rattus norvegicus)	6480464	2-amino-1-methyl-6-phenylimidazo(4 and 5-b)pyridine results in increased expression of TCP1 mRNA	CTD	PMID:15215175
TCP1	Human	pirinixic acid	increases expression	ISO	Tcp1 (Rattus norvegicus)	6480464	pirinixic acid results in increased expression of TCP1 mRNA	CTD	PMID:12832660
TCP1	Human	pirinixic acid	increases expression	ISO	Tcp1 (Mus musculus)	6480464	pirinixic acid results in increased expression of TCP1 mRNA	CTD	PMID:23811191
TCP1	Human	pirinixic acid	decreases expression	ISO	Tcp1 (Mus musculus)	6480464	pirinixic acid results in decreased expression of TCP1 mRNA	CTD	PMID:20813756 and PMID:23811191
TCP1	Human	quartz	affects expression	EXP		6480464	Quartz affects the expression of TCP1 protein	CTD	PMID:27917503
TCP1	Human	raloxifene	affects expression	ISO	Tcp1 (Rattus norvegicus)	6480464	Raloxifene Hydrochloride affects the expression of TCP1 mRNA	CTD	PMID:16079270
TCP1	Human	selenium atom	multiple interactions	ISO	Tcp1 (Rattus norvegicus)	6480464	[Selenium deficiency co-treated with Vitamin E deficiency] results in decreased expression of TCP1 mRNA	CTD	PMID:11444866
TCP1	Human	silicon dioxide	affects secretion	EXP		6480464	Silicon Dioxide analog affects the secretion of TCP1 protein	CTD	PMID:25895662
TCP1	Human	silicon dioxide	affects expression	EXP		6480464	Silicon Dioxide affects the expression of TCP1 protein	CTD	PMID:27917503
TCP1	Human	silver atom	increases expression	EXP		6480464	Silver results in increased expression of TCP1 mRNA	CTD	PMID:26014281
TCP1	Human	silver(0)	increases expression	EXP		6480464	Silver results in increased expression of TCP1 mRNA	CTD	PMID:26014281
TCP1	Human	sodium arsenite	decreases expression	EXP		6480464	sodium arsenite results in decreased expression of TCP1 protein	CTD	PMID:30528433
TCP1	Human	sodium chloride	multiple interactions	EXP		6480464	[Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of TCP1 protein more ...	CTD	PMID:38598786
TCP1	Human	sodium dichromate	increases expression	ISO	Tcp1 (Rattus norvegicus)	6480464	sodium bichromate results in increased expression of TCP1 mRNA	CTD	PMID:12325037
TCP1	Human	T-2 toxin	affects expression	ISO	Tcp1 (Rattus norvegicus)	6480464	T-2 Toxin affects the expression of TCP1 protein	CTD	PMID:26141394
TCP1	Human	T-2 toxin	increases expression	EXP		6480464	T-2 Toxin results in increased expression of TCP1 protein	CTD	PMID:34581912
TCP1	Human	tetrachloromethane	increases expression	ISO	Tcp1 (Mus musculus)	6480464	Carbon Tetrachloride results in increased expression of TCP1 mRNA	CTD	PMID:27339419 and PMID:31919559
TCP1	Human	tetrachloromethane	increases expression	ISO	Tcp1 (Rattus norvegicus)	6480464	Carbon Tetrachloride results in increased expression of TCP1 mRNA	CTD	PMID:31150632
TCP1	Human	thioacetamide	increases expression	ISO	Tcp1 (Rattus norvegicus)	6480464	Thioacetamide results in increased expression of TCP1 mRNA	CTD	PMID:23411599
TCP1	Human	thiram	increases expression	EXP		6480464	Thiram results in increased expression of TCP1 mRNA	CTD	PMID:38568856
TCP1	Human	Tributyltin oxide	decreases expression	ISO	Tcp1 (Mus musculus)	6480464	bis(tri-n-butyltin)oxide results in decreased expression of TCP1 protein	CTD	PMID:19552622
TCP1	Human	trichloroethene	multiple interactions	ISO	Tcp1 (Mus musculus)	6480464	PPARA protein inhibits the reaction [Trichloroethylene results in increased expression of TCP1 protein]	CTD	PMID:15363585
TCP1	Human	trichloroethene	decreases expression	ISO	Tcp1 (Rattus norvegicus)	6480464	Trichloroethylene results in decreased expression of TCP1 mRNA	CTD	PMID:33387578
TCP1	Human	trichloroethene	increases methylation	ISO	Tcp1 (Rattus norvegicus)	6480464	Trichloroethylene results in increased methylation of TCP1 gene	CTD	PMID:27618143
TCP1	Human	trichloroethene	increases expression	ISO	Tcp1 (Mus musculus)	6480464	Trichloroethylene results in increased expression of TCP1 mRNA	CTD	PMID:15363585
TCP1	Human	trimellitic anhydride	increases expression	ISO	Tcp1 (Mus musculus)	6480464	trimellitic anhydride results in increased expression of TCP1 mRNA	CTD	PMID:19042947
TCP1	Human	valdecoxib	increases expression	ISO	Tcp1 (Rattus norvegicus)	6480464	valdecoxib results in increased expression of TCP1 mRNA	CTD	PMID:24136188
TCP1	Human	valproic acid	affects expression	EXP		6480464	Valproic Acid affects the expression of TCP1 mRNA	CTD	PMID:25979313
TCP1	Human	vitamin E	multiple interactions	ISO	Tcp1 (Rattus norvegicus)	6480464	[Selenium deficiency co-treated with Vitamin E deficiency] results in decreased expression of TCP1 mRNA	CTD	PMID:11444866
TCP1	Human	warfarin	increases expression	ISO	Tcp1 (Mus musculus)	6480464	Warfarin results in increased expression of TCP1 mRNA	CTD	PMID:20493250
TCP1	Human	zinc atom	multiple interactions	EXP		6480464	[PCI 5002 co-treated with Zinc] results in increased expression of TCP1 mRNA	CTD	PMID:18593933
TCP1	Human	zinc(0)	multiple interactions	EXP		6480464	[PCI 5002 co-treated with Zinc] results in increased expression of TCP1 mRNA	CTD	PMID:18593933
TCP1	Human	zoledronic acid	decreases expression	EXP		6480464	zoledronic acid results in decreased expression of TCP1 mRNA	CTD	PMID:24714768

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
TCP1	Human	binding of sperm to zona pellucida	acts_upstream_of_or_within	IEA	UniProtKB:P11983 and ensembl:ENSMUSP00000116108	150520179		Ensembl	GO_REF:0000107
TCP1	Human	chaperone-mediated protein folding	involved_in	IDA		150520179	PMID:22133715	ComplexPortal	PMID:22133715
TCP1	Human	positive regulation of establishment of protein localization to telomere	acts_upstream_of	IMP		150520179	PMID:25467444	BHF-UCL	PMID:25467444
TCP1	Human	positive regulation of protein localization to Cajal body	involved_in	HMP		150520179	PMID:25467444	BHF-UCL	PMID:25467444
TCP1	Human	positive regulation of telomerase RNA localization to Cajal body	involved_in	IMP		150520179	PMID:25467444	BHF-UCL	PMID:25467444
TCP1	Human	positive regulation of telomere maintenance via telomerase	involved_in	IEA	ARBA:ARBA00047236	150520179		UniProt	GO_REF:0000117
TCP1	Human	positive regulation of telomere maintenance via telomerase	acts_upstream_of	IMP		150520179	PMID:25467444	BHF-UCL	PMID:25467444
TCP1	Human	protein folding	involved_in	IDA		150520179	PMID:30955883	FlyBase	PMID:30955883
TCP1	Human	protein folding	involved_in	IMP		150520179	PMID:25467444	BHF-UCL	PMID:25467444
TCP1	Human	protein folding	involved_in	IBA	PANTHER:PTN004253040 more ...	150520179		GO_Central	GO_REF:0000033
TCP1	Human	protein folding	involved_in	IEA	GO:0140662	150520179		GOC	GO_REF:0000108
TCP1	Human	protein folding	involved_in	TAS		150520179	PMID:1630491	PINC	PMID:1630491
TCP1	Human	protein folding	involved_in	IEA	InterPro:IPR002194 and InterPro:IPR012715	150520179		InterPro	GO_REF:0000002
TCP1	Human	protein stabilization	involved_in	IMP		150520179	PMID:25467444	BHF-UCL	PMID:25467444
TCP1	Human	protein stabilization	involved_in	IEA	ARBA:ARBA00033884	150520179		UniProt	GO_REF:0000117
TCP1	Human	scaRNA localization to Cajal body	acts_upstream_of_positive_effect	IMP		150520179	PMID:25467444	BHF-UCL	PMID:25467444
TCP1	Human	tubulin complex assembly	involved_in	NAS		150520179	PMID:11532003	UniProt	PMID:11532003

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
TCP1	Human	acrosomal vesicle	located_in	IEA	UniProtKB:P11983 and ensembl:ENSMUSP00000116108	150520179		Ensembl	GO_REF:0000107
TCP1	Human	cell body	located_in	IEA	UniProtKB:P11983 and ensembl:ENSMUSP00000116108	150520179		Ensembl	GO_REF:0000107
TCP1	Human	centrosome	located_in	IEA	UniProtKB-SubCell:SL-0048	150520179		UniProt	GO_REF:0000044
TCP1	Human	centrosome	located_in	IDA		150520179	PMID:20080638	MGI	PMID:20080638
TCP1	Human	chaperonin-containing T-complex	part_of	IPI		150520179	PMID:22133715	ComplexPortal	PMID:22133715
TCP1	Human	chaperonin-containing T-complex	part_of	IBA	MGI:98535 more ...	150520179		GO_Central	GO_REF:0000033
TCP1	Human	chaperonin-containing T-complex	part_of	IEA	UniProtKB:P11983 and ensembl:ENSMUSP00000116108	150520179		Ensembl	GO_REF:0000107
TCP1	Human	chaperonin-containing T-complex	part_of	IDA		150520179	PMID:23011926 more ...	FlyBase	PMID:23011926 more ...
TCP1	Human	cytoplasm	located_in	IEA	UniProtKB-KW:KW-0963	150520179		UniProt	GO_REF:0000043
TCP1	Human	cytoplasm	located_in	IEA	UniProtKB-SubCell:SL-0086	150520179		UniProt	GO_REF:0000044
TCP1	Human	cytoskeleton	located_in	IEA	UniProtKB-KW:KW-0206	150520179		UniProt	GO_REF:0000043
TCP1	Human	cytosol	located_in	IEA	UniProtKB-SubCell:SL-0091	150520179		UniProt	GO_REF:0000044
TCP1	Human	cytosol	located_in	TAS		150520179	PMID:1630491	Reactome	PMID:1630491 more ...
TCP1	Human	extracellular exosome	located_in	HDA		150520179	PMID:19056867 more ...	UniProt	PMID:19056867 more ...
TCP1	Human	Golgi apparatus	located_in	IEA	UniProtKB:P11983 and ensembl:ENSMUSP00000116108	150520179		Ensembl	GO_REF:0000107
TCP1	Human	heterochromatin		ISO	Tcp1 (Rattus norvegicus)	9068941		RGD	PMID:12915127 and REF_RGD_ID:1304423
TCP1	Human	heterochromatin	located_in	IEA	UniProtKB:P11983 and ensembl:ENSMUSP00000116108	150520179		Ensembl	GO_REF:0000107
TCP1	Human	intracellular protein-containing complex	part_of	IEA	ARBA:ARBA00027614	150520179		UniProt	GO_REF:0000117
TCP1	Human	microtubule	located_in	IEA	ARBA:ARBA00033576	150520179		UniProt	GO_REF:0000117
TCP1	Human	microtubule	located_in	IDA		150520179	PMID:21525035	UniProt	PMID:21525035
TCP1	Human	microtubule organizing center	located_in	IEA	UniProtKB:P11983 and ensembl:ENSMUSP00000116108	150520179		Ensembl	GO_REF:0000107
TCP1	Human	pericentriolar material	located_in	IEA	UniProtKB:P11983 and ensembl:ENSMUSP00000116108	150520179		Ensembl	GO_REF:0000107
TCP1	Human	zona pellucida receptor complex	part_of	IEA	UniProtKB:P11983 and ensembl:ENSMUSP00000116108	150520179		Ensembl	GO_REF:0000107

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
TCP1	Human	ATP binding	enables	IEA	UniProtKB-KW:KW-0067	150520179		UniProt	GO_REF:0000043
TCP1	Human	ATP binding	enables	IEA	InterPro:IPR002194 more ...	150520179		InterPro	GO_REF:0000002
TCP1	Human	ATP hydrolysis activity	enables	IEA	InterPro:IPR002194 and InterPro:IPR012715	150520179		InterPro	GO_REF:0000002
TCP1	Human	ATP-dependent protein folding chaperone	enables	IEA	InterPro:IPR017998	150520179		InterPro	GO_REF:0000002
TCP1	Human	nucleotide binding	enables	IEA	UniProtKB-KW:KW-0547	150520179		UniProt	GO_REF:0000043
TCP1	Human	protein binding	enables	IPI	UniProtKB:Q96M98	150520179	PMID:14532270	ParkinsonsUK-UCL	PMID:14532270
TCP1	Human	protein binding	enables	IPI	UniProtKB:P83110 more ...	150520179	PMID:29477555	IntAct	PMID:29477555
TCP1	Human	protein binding	enables	IPI	UniProtKB:P83105	150520179	PMID:31470122	IntAct	PMID:31470122
TCP1	Human	protein binding	enables	IPI	UniProtKB:Q9BUR4	150520179	PMID:25467444	BHF-UCL	PMID:25467444
TCP1	Human	protein binding	enables	IPI	UniProtKB:O43439	150520179	PMID:25416956	IntAct	PMID:25416956
TCP1	Human	protein binding	enables	IPI	UniProtKB:P42858 more ...	150520179	PMID:32814053	IntAct	PMID:32814053
TCP1	Human	protein binding	enables	IPI	UniProtKB:P78380	150520179	PMID:24846140	IntAct	PMID:24846140
TCP1	Human	protein binding	enables	IPI	UniProtKB:P50990 more ...	150520179	PMID:16085932 more ...	IntAct	PMID:16085932 more ...
TCP1	Human	protein binding	enables	IPI	UniProtKB:Q9Y238	150520179	PMID:33144677	UniProt	PMID:33144677
TCP1	Human	protein binding	enables	IPI	UniProtKB:P04062	150520179	PMID:21098288	IntAct	PMID:21098288
TCP1	Human	protein binding	enables	IPI	UniProtKB:P78371	150520179	PMID:16097032 and PMID:33961781	IntAct	PMID:16097032 and PMID:33961781
TCP1	Human	protein folding chaperone	enables	IEA	ARBA:ARBA00029119	150520179		UniProt	GO_REF:0000117
TCP1	Human	protein folding chaperone	enables	IDA		150520179	PMID:25467444 and PMID:30955883	BHF-UCL	PMID:25467444 and PMID:30955883
TCP1	Human	RNA binding	enables	HDA		150520179	PMID:22681889	UniProt	PMID:22681889
TCP1	Human	ubiquitin protein ligase binding	enables	IPI	UniProtKB:O60260	150520179	PMID:21753002	ParkinsonsUK-UCL	PMID:21753002
TCP1	Human	unfolded protein binding	enables	TAS		150520179	PMID:1630491	PINC	PMID:1630491
TCP1	Human	unfolded protein binding	enables	IBA	PANTHER:PTN004253040 more ...	150520179		GO_Central	GO_REF:0000033
TCP1	Human	unfolded protein binding	enables	IEA	InterPro:IPR002194 and InterPro:IPR012715	150520179		InterPro	GO_REF:0000002

#	Reference Title	Reference Citation
1.	GOAs Human GO annotations	GOA_HUMAN data from the GO Consortium
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:1572657	PMID:1602151	PMID:1630491	PMID:1630492	PMID:1901944	PMID:2377466	PMID:3476253	PMID:3653076	PMID:7615668	PMID:7904580	PMID:7908441	PMID:7916460
PMID:7953530	PMID:8098536	PMID:8633246	PMID:8718679	PMID:8733136	PMID:8812443	PMID:8889548	PMID:8982604	PMID:9189717	PMID:9250675	PMID:9337846	PMID:9885248
PMID:10353914	PMID:10524223	PMID:10791973	PMID:10978337	PMID:11018062	PMID:11532003	PMID:11771755	PMID:11933046	PMID:12060742	PMID:12215766	PMID:12477932	PMID:12502735
PMID:12665801	PMID:12887895	PMID:14499622	PMID:14532270	PMID:14574404	PMID:14636579	PMID:14744259	PMID:15161933	PMID:15251459	PMID:15489334	PMID:15745879	PMID:15923617
PMID:15967112	PMID:16085932	PMID:16097032	PMID:16263121	PMID:16341674	PMID:16465465	PMID:16497536	PMID:16916647	PMID:17081983	PMID:17314511	PMID:17339318	PMID:17643375
PMID:17939680	PMID:18029348	PMID:18654987	PMID:18715871	PMID:18729074	PMID:18775504	PMID:18782753	PMID:19056867	PMID:19132087	PMID:19156129	PMID:19188445	PMID:19380743
PMID:19684306	PMID:19738201	PMID:19913121	PMID:20080638	PMID:20193073	PMID:20458337	PMID:20467437	PMID:20473970	PMID:20516061	PMID:20585571	PMID:20628086	PMID:20890123
PMID:21081503	PMID:21081666	PMID:21098288	PMID:21145461	PMID:21319273	PMID:21343306	PMID:21525035	PMID:21639856	PMID:21726808	PMID:21753002	PMID:21873635	PMID:21942715
PMID:21946088	PMID:22133715	PMID:22160715	PMID:22268729	PMID:22304920	PMID:22360420	PMID:22623428	PMID:22681889	PMID:22810585	PMID:22863883	PMID:22939629	PMID:23011926
PMID:23125841	PMID:23184937	PMID:23318261	PMID:23349634	PMID:23383273	PMID:23398456	PMID:23402259	PMID:23438482	PMID:23443559	PMID:23455922	PMID:23508102	PMID:23533145
PMID:23658844	PMID:23686814	PMID:23703321	PMID:23752268	PMID:24169447	PMID:24244333	PMID:24298020	PMID:24366813	PMID:24711643	PMID:24846140	PMID:24862099	PMID:24927568
PMID:24980433	PMID:24981860	PMID:25144556	PMID:25147182	PMID:25192599	PMID:25224486	PMID:25306918	PMID:25315684	PMID:25324306	PMID:25342745	PMID:25416956	PMID:25437307
PMID:25467444	PMID:25670202	PMID:25678563	PMID:25704758	PMID:25737280	PMID:25756610	PMID:25798074	PMID:25852190	PMID:25921289	PMID:25940091	PMID:25944111	PMID:25959826
PMID:25963833	PMID:26186194	PMID:26217791	PMID:26344197	PMID:26414014	PMID:26460568	PMID:26472760	PMID:26496610	PMID:26549023	PMID:26556873	PMID:26598607	PMID:26638075
PMID:26687479	PMID:26706127	PMID:26777405	PMID:26811472	PMID:26816005	PMID:26831064	PMID:26912792	PMID:26949251	PMID:26972000	PMID:26990986	PMID:27025967	PMID:27182664
PMID:27342126	PMID:27375898	PMID:27377895	PMID:27462432	PMID:27503909	PMID:27545878	PMID:27591049	PMID:27609421	PMID:27637333	PMID:27684187	PMID:27705803	PMID:27880917
PMID:27929117	PMID:28027390	PMID:28065597	PMID:28102321	PMID:28137758	PMID:28186131	PMID:28302793	PMID:28330616	PMID:28443643	PMID:28514442	PMID:28515276	PMID:28524877
PMID:28561026	PMID:28581483	PMID:28685749	PMID:28718761	PMID:28902428	PMID:28927264	PMID:28986522	PMID:29229926	PMID:29331416	PMID:29395067	PMID:29467282	PMID:29477555
PMID:29507755	PMID:29509190	PMID:29511261	PMID:29531219	PMID:29564676	PMID:29568061	PMID:29676528	PMID:29845934	PMID:29955894	PMID:29991511	PMID:30021884	PMID:30194290
PMID:30196744	PMID:30209976	PMID:30258100	PMID:30442662	PMID:30455355	PMID:30462309	PMID:30463901	PMID:30575818	PMID:30699358	PMID:30711629	PMID:30737378	PMID:30745168
PMID:30833792	PMID:30884312	PMID:30890647	PMID:30940648	PMID:30948266	PMID:30955883	PMID:31067453	PMID:31091453	PMID:31239290	PMID:31300519	PMID:31353912	PMID:31409639
PMID:31436131	PMID:31470122	PMID:31501420	PMID:31553912	PMID:31586073	PMID:31620119	PMID:31665637	PMID:31685992	PMID:31732153	PMID:31792442	PMID:31839598	PMID:31980649
PMID:32129710	PMID:32149426	PMID:32176628	PMID:32239614	PMID:32416067	PMID:32529326	PMID:32552912	PMID:32665654	PMID:32687490	PMID:32698014	PMID:32707033	PMID:32786267
PMID:32807901	PMID:32814053	PMID:32814769	PMID:32843620	PMID:32850835	PMID:32877691	PMID:32929329	PMID:32939012	PMID:32994395	PMID:33022573	PMID:33024031	PMID:33087562
PMID:33137104	PMID:33144677	PMID:33194618	PMID:33226137	PMID:33239621	PMID:33301849	PMID:33545068	PMID:33567341	PMID:33658012	PMID:33762435	PMID:33766124	PMID:33777788
PMID:33863777	PMID:33916271	PMID:33961781	PMID:34004371	PMID:34079125	PMID:34158536	PMID:34162426	PMID:34185411	PMID:34189442	PMID:34349018	PMID:34373451	PMID:34428256
PMID:34462429	PMID:34535262	PMID:34537242	PMID:34581821	PMID:34612770	PMID:34645483	PMID:34687317	PMID:34728620	PMID:34732716	PMID:35013218	PMID:35016035	PMID:35102251
PMID:35140242	PMID:35235311	PMID:35253629	PMID:35256949	PMID:35271311	PMID:35338135	PMID:35366418	PMID:35411049	PMID:35446349	PMID:35449157	PMID:35509820	PMID:35530310
PMID:35546148	PMID:35563538	PMID:35652658	PMID:35654790	PMID:35676659	PMID:35681168	PMID:35776542	PMID:35777956	PMID:35831314	PMID:35844135	PMID:35944360	PMID:35973513
PMID:35973989	PMID:36055981	PMID:36057605	PMID:36114006	PMID:36180527	PMID:36180891	PMID:36215168	PMID:36244648	PMID:36282215	PMID:36398662	PMID:36414381	PMID:36424410
PMID:36517590	PMID:36526897	PMID:36574265	PMID:36584595	PMID:36652389	PMID:36762613	PMID:36912080	PMID:36929488	PMID:37001908	PMID:37059091	PMID:37071682	PMID:37105989
PMID:37120454	PMID:37132043	PMID:37167062	PMID:37223481	PMID:37314180	PMID:37314216	PMID:37317656	PMID:37424823	PMID:37448957	PMID:37667382	PMID:37689310	PMID:37705046
PMID:37788672	PMID:37820061	PMID:37827155	PMID:37866880	PMID:37929963	PMID:38113892	PMID:38172120	PMID:38177924	PMID:38245532	PMID:38280479	PMID:38334954	PMID:38387902
PMID:38777146	PMID:39033992	PMID:39231216	PMID:39238192	PMID:39358380	PMID:39422127	PMID:39501047

TCP1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	159,778,498 - 159,789,602 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	159,778,498 - 159,789,703 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	6	160,199,530 - 160,210,634 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	160,119,520 - 160,130,725 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	6	160,169,941 - 160,181,146	NCBI
Celera	6	160,845,607 - 160,856,819 (-)	NCBI		Celera
Cytogenetic Map	6	q25.3	NCBI
HuRef	6	157,669,773 - 157,680,978 (-)	NCBI		HuRef
CHM1_1	6	160,461,821 - 160,473,042 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	6	161,024,115 - 161,035,234 (-)	NCBI		T2T-CHM13v2.0

Tcp1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	17	13,135,216 - 13,143,954 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	17	13,134,588 - 13,143,954 (+)	Ensembl		GRCm39 Ensembl
GRCm38	17	12,916,329 - 12,925,067 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	17	12,915,701 - 12,925,067 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	17	13,109,331 - 13,117,933 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	17	12,759,446 - 12,767,497 (+)	NCBI		MGSCv36	mm8
Celera	17	12,948,013 - 12,956,616 (+)	NCBI		Celera
Cytogenetic Map	17	A1	NCBI
cM Map	17	8.72	NCBI

Tcp1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	50,376,848 - 50,384,527 (-)	NCBI		GRCr8
mRatBN7.2	1	47,829,061 - 47,836,809 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	47,828,652 - 47,836,839 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	48,520,703 - 48,528,382 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	54,506,599 - 54,514,346 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	48,596,232 - 48,603,911 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	48,025,664 - 48,033,343 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	48,025,663 - 48,033,396 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	51,719,055 - 51,726,734 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	42,103,543 - 42,111,222 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	42,106,487 - 42,114,167 (-)	NCBI
Celera	1	43,629,524 - 43,637,203 (-)	NCBI		Celera
RH 3.4 Map	1	537.31	RGD
Cytogenetic Map	1	q11	NCBI

Tcp1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955439	21,114,038 - 21,124,379 (+)	NCBI	ChiLan1.0	ChiLan1.0

TCP1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	5	179,877,363 - 179,888,668 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	6	177,781,864 - 177,793,622 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	157,661,409 - 157,672,581 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	162,673,050 - 162,684,261 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	162,673,596 - 162,683,985 (-)	Ensembl	panpan1.1		panPan2

TCP1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	49,029,260 - 49,038,023 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	49,029,282 - 49,038,020 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	49,871,249 - 49,879,992 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	49,213,974 - 49,222,681 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	49,213,961 - 49,222,697 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	49,096,311 - 49,105,058 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	48,967,408 - 48,976,160 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	49,582,581 - 49,591,336 (-)	NCBI		UU_Cfam_GSD_1.0

Tcp1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	144,021,338 - 144,030,784 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936489	11,273,335 - 11,282,811 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TCP1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	7,590,140 - 7,601,795 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	7,590,140 - 7,600,709 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	9,389,098 - 9,399,667 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TCP1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	13	87,377,452 - 87,388,692 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	13	87,377,996 - 87,388,568 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666040	59,776,464 - 59,787,759 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Tcp1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624855	3,121,274 - 3,133,640 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in TCP1
44 total Variants

Name	Type	Condition(s)	Position(s)	Clinical significance
GRCh38/hg38 6q24.1-27(chr6:141132990-169339571)x3	copy number gain	See cases [RCV000050604]	Chr6:141132990..169339571 [GRCh38] Chr6:141454127..169739666 [GRCh37] Chr6:141495820..169481591 [NCBI36] Chr6:6q24.1-27	pathogenic
GRCh38/hg38 6q25.2-27(chr6:152376338-170583214)x3	copy number gain	Developmental Delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000051902]\|Developmental delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000051902]\|See cases [RCV000051902]	Chr6:152376338..170583214 [GRCh38] Chr6:152697473..170892302 [GRCh37] Chr6:152739166..170734227 [NCBI36] Chr6:6q25.2-27	pathogenic
GRCh38/hg38 6q25.3-27(chr6:158664768-170612001)x3	copy number gain	Developmental Delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000051904]\|Developmental delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000051904]\|See cases [RCV000051904]	Chr6:158664768..170612001 [GRCh38] Chr6:159085800..170921089 [GRCh37] Chr6:159005788..170763014 [NCBI36] Chr6:6q25.3-27	pathogenic
GRCh38/hg38 6q25.2-27(chr6:154118058-170602152)x1	copy number loss	See cases [RCV000052207]	Chr6:154118058..170602152 [GRCh38] Chr6:154439193..170911240 [GRCh37] Chr6:154480885..170753165 [NCBI36] Chr6:6q25.2-27	pathogenic
GRCh38/hg38 6q25.3-27(chr6:159454639-170612001)x1	copy number loss	See cases [RCV000052209]	Chr6:159454639..170612001 [GRCh38] Chr6:159875671..170921089 [GRCh37] Chr6:159795661..170763014 [NCBI36] Chr6:6q25.3-27	pathogenic
GRCh38/hg38 6q25.2-27(chr6:154539655-170714507)x1	copy number loss	See cases [RCV000137381]	Chr6:154539655..170714507 [GRCh38] Chr6:154860789..171023595 [GRCh37] Chr6:154902481..170865520 [NCBI36] Chr6:6q25.2-27	pathogenic
GRCh38/hg38 6q25.3-26(chr6:155378049-163133499)x1	copy number loss	See cases [RCV000137831]	Chr6:155378049..163133499 [GRCh38] Chr6:155699183..163554531 [GRCh37] Chr6:155740875..163474521 [NCBI36] Chr6:6q25.3-26	pathogenic
GRCh38/hg38 6q25.2-27(chr6:152793402-170610394)x1	copy number loss	See cases [RCV000141880]	Chr6:152793402..170610394 [GRCh38] Chr6:153114537..170919482 [GRCh37] Chr6:153156230..170761407 [NCBI36] Chr6:6q25.2-27	pathogenic
GRCh38/hg38 6q25.2-27(chr6:152376338-170612001)x3	copy number gain	See cases [RCV000142594]	Chr6:152376338..170612001 [GRCh38] Chr6:152697473..170921089 [GRCh37] Chr6:152739166..170763014 [NCBI36] Chr6:6q25.2-27	pathogenic
GRCh38/hg38 6q23.2-27(chr6:133537271-165875545)x3	copy number gain	See cases [RCV000143444]	Chr6:133537271..165875545 [GRCh38] Chr6:133858409..166289033 [GRCh37] Chr6:133900102..166209023 [NCBI36] Chr6:6q23.2-27	pathogenic
GRCh38/hg38 6q25.3-26(chr6:158585724-160899783)x3	copy number gain	See cases [RCV000143618]	Chr6:158585724..160899783 [GRCh38] Chr6:159006756..161320815 [GRCh37] Chr6:158926744..161240805 [NCBI36] Chr6:6q25.3-26	uncertain significance
GRCh37/hg19 6q25.1-27(chr6:151214792-170892243)x3	copy number gain	See cases [RCV000449011]	Chr6:151214792..170892243 [GRCh37] Chr6:6q25.1-27	pathogenic
GRCh37/hg19 6q25.3-27(chr6:159006336-170713678)x3	copy number gain	not provided [RCV003312672]	Chr6:159006336..170713678 [GRCh37] Chr6:6q25.3-27	uncertain significance
NM_030752.3(TCP1):c.1109G>C (p.Arg370Pro)	single nucleotide variant	not specified [RCV004314999]	Chr6:159780076 [GRCh38] Chr6:160201108 [GRCh37] Chr6:6q25.3	uncertain significance
GRCh37/hg19 6p25.3-q27(chr6:156975-170919482)x3	copy number gain	See cases [RCV000512067]	Chr6:156975..170919482 [GRCh37] Chr6:6p25.3-q27	pathogenic
GRCh37/hg19 6p25.3-q27(chr6:156975-170919482)	copy number gain	See cases [RCV000510595]	Chr6:156975..170919482 [GRCh37] Chr6:6p25.3-q27	pathogenic
NM_030752.3(TCP1):c.918G>A (p.Met306Ile)	single nucleotide variant	not specified [RCV004314413]	Chr6:159780990 [GRCh38] Chr6:160202022 [GRCh37] Chr6:6q25.3	uncertain significance
NM_030752.3(TCP1):c.1436A>G (p.Glu479Gly)	single nucleotide variant	not specified [RCV004299051]	Chr6:159779645 [GRCh38] Chr6:160200677 [GRCh37] Chr6:6q25.3	uncertain significance
GRCh37/hg19 6q25.3-27(chr6:159844762-170919482)x3	copy number gain	not provided [RCV000682734]	Chr6:159844762..170919482 [GRCh37] Chr6:6q25.3-27	pathogenic
46,XX,der(6)(q25.1,q28)dn.seq[GRCh37/hg19]der(6)(6pter->6q25.2(+)(154768571)::q25.2(+)(154778901),q25.2(+)154778992::q25.2(-)(154774048),q25.2(-)(154768571)::q25.2(-)(154768571),q25.1(-)(~151443183-151443483))dn	complex	Coffin-Siris syndrome 1 [RCV000714957]	Chr6:151443333..171115067 [GRCh37] Chr6:6q25.1-27	pathogenic
GRCh37/hg19 6p25.3-q27(chr6:60107-171054786)x3	copy number gain	not provided [RCV000745400]	Chr6:60107..171054786 [GRCh37] Chr6:6p25.3-q27	pathogenic
GRCh37/hg19 6p25.3-q27(chr6:108666-170980171)x3	copy number gain	not provided [RCV000745403]	Chr6:108666..170980171 [GRCh37] Chr6:6p25.3-q27	pathogenic
GRCh37/hg19 6p25.3-q27(chr6:165632-170919470)x3	copy number gain	not provided [RCV000745404]	Chr6:165632..170919470 [GRCh37] Chr6:6p25.3-q27	pathogenic
GRCh37/hg19 6q25.1-27(chr6:150284435-170919470)x3	copy number gain	not provided [RCV000746100]	Chr6:150284435..170919470 [GRCh37] Chr6:6q25.1-27	pathogenic
NM_005891.3(ACAT2):c.1024-5G>A	single nucleotide variant	not provided [RCV000900609]	Chr6:159778654 [GRCh38] Chr6:160199686 [GRCh37] Chr6:6q25.3	likely benign
GRCh37/hg19 6q25.3(chr6:157262571-160992289)x3	copy number gain	not provided [RCV000848057]	Chr6:157262571..160992289 [GRCh37] Chr6:6q25.3	uncertain significance
GRCh37/hg19 6q25.3(chr6:160025206-160271483)x1	copy number loss	not provided [RCV000846782]	Chr6:160025206..160271483 [GRCh37] Chr6:6q25.3	uncertain significance
GRCh37/hg19 6q25.3(chr6:159998877-160413982)x3	copy number gain	not provided [RCV001258756]	Chr6:159998877..160413982 [GRCh37] Chr6:6q25.3	uncertain significance
GRCh37/hg19 6q25.2-26(chr6:153207930-164322346)	copy number loss	not specified [RCV002053640]	Chr6:153207930..164322346 [GRCh37] Chr6:6q25.2-26	pathogenic
NC_000006.11:g.(?_158532398)_(162868359_?)del	deletion	3-methylglutaconic aciduria with deafness, encephalopathy, and Leigh-like syndrome [RCV003122912]\|not provided [RCV003122911]	Chr6:158532398..162868359 [GRCh37] Chr6:6q25.3-26	pathogenic\|no classifications from unflagged records
GRCh37/hg19 6q25.3-27(chr6:159121459-170919482)	copy number loss	Hydrocephalus [RCV002280751]	Chr6:159121459..170919482 [GRCh37] Chr6:6q25.3-27	pathogenic
GRCh37/hg19 6q25.3-27(chr6:157318401-165233548)x1	copy number loss	See cases [RCV002287557]	Chr6:157318401..165233548 [GRCh37] Chr6:6q25.3-27	pathogenic
NM_030752.3(TCP1):c.1641T>A (p.Asp547Glu)	single nucleotide variant	not specified [RCV004313411]	Chr6:159779075 [GRCh38] Chr6:160200107 [GRCh37] Chr6:6q25.3	uncertain significance
NM_030752.3(TCP1):c.1462C>T (p.Leu488Phe)	single nucleotide variant	not specified [RCV004144749]	Chr6:159779254 [GRCh38] Chr6:160200286 [GRCh37] Chr6:6q25.3	uncertain significance
NM_005891.3(ACAT2):c.1070C>G (p.Ala357Gly)	single nucleotide variant	not specified [RCV004137674]	Chr6:159778705 [GRCh38] Chr6:160199737 [GRCh37] Chr6:6q25.3	uncertain significance
NM_030752.3(TCP1):c.952C>T (p.Arg318Cys)	single nucleotide variant	not specified [RCV004235662]	Chr6:159780956 [GRCh38] Chr6:160201988 [GRCh37] Chr6:6q25.3	uncertain significance
NM_030752.3(TCP1):c.731C>A (p.Thr244Lys)	single nucleotide variant	not specified [RCV004236735]	Chr6:159784007 [GRCh38] Chr6:160205039 [GRCh37] Chr6:6q25.3	uncertain significance
NM_005891.3(ACAT2):c.1042G>T (p.Ala348Ser)	single nucleotide variant	not specified [RCV004209238]	Chr6:159778677 [GRCh38] Chr6:160199709 [GRCh37] Chr6:6q25.3	uncertain significance
NM_030752.3(TCP1):c.1275C>G (p.Asn425Lys)	single nucleotide variant	not specified [RCV004134982]	Chr6:159779910 [GRCh38] Chr6:160200942 [GRCh37] Chr6:6q25.3	uncertain significance
NM_030752.3(TCP1):c.1096A>C (p.Asn366His)	single nucleotide variant	not specified [RCV004167439]	Chr6:159780444 [GRCh38] Chr6:160201476 [GRCh37] Chr6:6q25.3	uncertain significance
NM_005891.3(ACAT2):c.1118T>C (p.Met373Thr)	single nucleotide variant	not specified [RCV004185403]	Chr6:159778753 [GRCh38] Chr6:160199785 [GRCh37] Chr6:6q25.3	likely benign
NM_030752.3(TCP1):c.511A>G (p.Met171Val)	single nucleotide variant	not specified [RCV004225013]	Chr6:159784825 [GRCh38] Chr6:160205857 [GRCh37] Chr6:6q25.3	uncertain significance
NM_030752.3(TCP1):c.1112C>T (p.Thr371Met)	single nucleotide variant	not specified [RCV004231039]	Chr6:159780073 [GRCh38] Chr6:160201105 [GRCh37] Chr6:6q25.3	uncertain significance
NM_005891.3(ACAT2):c.1105A>G (p.Thr369Ala)	single nucleotide variant	not specified [RCV004276400]	Chr6:159778740 [GRCh38] Chr6:160199772 [GRCh37] Chr6:6q25.3	likely benign
NM_005891.3(ACAT2):c.1126A>G (p.Ser376Gly)	single nucleotide variant	not specified [RCV004311134]	Chr6:159778761 [GRCh38] Chr6:160199793 [GRCh37] Chr6:6q25.3	uncertain significance
NM_030752.3(TCP1):c.1450A>C (p.Lys484Gln)	single nucleotide variant	not specified [RCV004264785]	Chr6:159779631 [GRCh38] Chr6:160200663 [GRCh37] Chr6:6q25.3	uncertain significance
NM_030752.3(TCP1):c.257T>C (p.Val86Ala)	single nucleotide variant	not specified [RCV004281020]	Chr6:159787765 [GRCh38] Chr6:160208797 [GRCh37] Chr6:6q25.3	uncertain significance
NM_030752.3(TCP1):c.388C>T (p.Arg130Cys)	single nucleotide variant	not specified [RCV004290626]	Chr6:159785486 [GRCh38] Chr6:160206518 [GRCh37] Chr6:6q25.3	uncertain significance
NM_030752.3(TCP1):c.250A>G (p.Lys84Glu)	single nucleotide variant	not specified [RCV004335558]	Chr6:159787772 [GRCh38] Chr6:160208804 [GRCh37] Chr6:6q25.3	uncertain significance
NM_030752.3(TCP1):c.1049A>T (p.Glu350Val)	single nucleotide variant	not specified [RCV004347896]	Chr6:159780491 [GRCh38] Chr6:160201523 [GRCh37] Chr6:6q25.3	uncertain significance
NM_030752.3(TCP1):c.688G>A (p.Val230Ile)	single nucleotide variant	not specified [RCV004338864]	Chr6:159784050 [GRCh38] Chr6:160205082 [GRCh37] Chr6:6q25.3	uncertain significance
NM_030752.3(TCP1):c.178A>G (p.Thr60Ala)	single nucleotide variant	not specified [RCV004342244]	Chr6:159787844 [GRCh38] Chr6:160208876 [GRCh37] Chr6:6q25.3	uncertain significance
GRCh37/hg19 6q25.2-27(chr6:152853218-170914297)x1	copy number loss	See cases [RCV004442824]	Chr6:152853218..170914297 [GRCh37] Chr6:6q25.2-27	pathogenic
NM_030752.3(TCP1):c.1075G>C (p.Asp359His)	single nucleotide variant	not specified [RCV004466657]	Chr6:159780465 [GRCh38] Chr6:160201497 [GRCh37] Chr6:6q25.3	uncertain significance
NM_030752.3(TCP1):c.365G>A (p.Arg122Gln)	single nucleotide variant	not specified [RCV004466658]	Chr6:159785912 [GRCh38] Chr6:160206944 [GRCh37] Chr6:6q25.3	uncertain significance
NM_030752.3(TCP1):c.68T>C (p.Met23Thr)	single nucleotide variant	not specified [RCV004466661]	Chr6:159788140 [GRCh38] Chr6:160209172 [GRCh37] Chr6:6q25.3	uncertain significance
NM_030752.3(TCP1):c.769C>T (p.Pro257Ser)	single nucleotide variant	not specified [RCV004675666]	Chr6:159783969 [GRCh38] Chr6:160205001 [GRCh37] Chr6:6q25.3	uncertain significance
NM_030752.3(TCP1):c.183C>G (p.Ile61Met)	single nucleotide variant	not specified [RCV004682108]	Chr6:159787839 [GRCh38] Chr6:160208871 [GRCh37] Chr6:6q25.3	uncertain significance
NM_030752.3(TCP1):c.398A>G (p.Asn133Ser)	single nucleotide variant	not specified [RCV004682109]	Chr6:159785476 [GRCh38] Chr6:160206508 [GRCh37] Chr6:6q25.3	likely benign
NM_030752.3(TCP1):c.826C>G (p.Gln276Glu)	single nucleotide variant	not specified [RCV004675663]	Chr6:159781082 [GRCh38] Chr6:160202114 [GRCh37] Chr6:6q25.3	uncertain significance
NM_030752.3(TCP1):c.112C>G (p.Pro38Ala)	single nucleotide variant	not specified [RCV004675665]	Chr6:159788096 [GRCh38] Chr6:160209128 [GRCh37] Chr6:6q25.3	uncertain significance
NM_030752.3(TCP1):c.809T>C (p.Ile270Thr)	single nucleotide variant	not specified [RCV004675667]	Chr6:159781099 [GRCh38] Chr6:160202131 [GRCh37] Chr6:6q25.3	uncertain significance
NM_005891.3(ACAT2):c.1096C>G (p.Leu366Val)	single nucleotide variant	not specified [RCV004886013]	Chr6:159778731 [GRCh38] Chr6:160199763 [GRCh37] Chr6:6q25.3	uncertain significance
NM_030752.3(TCP1):c.793_796del (p.Gln265fs) AND INTELLECTUAL DEVELOPMENTAL DISORDER WITH POLYMICROGYRIA	deletion	INTELLECTUAL DEVELOPMENTAL DISORDER WITH POLYMICROGYRIA AND SEIZURES [RCV005000610]	Chr6:159783942..159783945 [GRCh38] Chr6:160204974..160204977 [GRCh37] Chr6:6q25.3	pathogenic
GRCh37/hg19 6q25.2-27(chr6:153777725-170919482)x1	copy number loss	not provided [RCV004819349]	Chr6:153777725..170919482 [GRCh37] Chr6:6q25.2-27	pathogenic
NM_030752.3(TCP1):c.583_584del (p.Ser194_Val195insTer) AND INTELLECTUAL DEVELOPMENTAL DISORDER WITH POLYMICROGYRIA	deletion	INTELLECTUAL DEVELOPMENTAL DISORDER WITH POLYMICROGYRIA AND SEIZURES [RCV005000607]	Chr6:159784752..159784753 [GRCh38] Chr6:160205784..160205785 [GRCh37] Chr6:6q25.3	pathogenic
GRCh37/hg19 6q25.3-27(chr6:158471960-170919482)x1	copy number loss	not provided [RCV004819350]	Chr6:158471960..170919482 [GRCh37] Chr6:6q25.3-27	pathogenic
NM_030752.3(TCP1):c.1502dup (p.Gly502fs) AND INTELLECTUAL DEVELOPMENTAL DISORDER WITH POLYMICROGYRIA	duplication	INTELLECTUAL DEVELOPMENTAL DISORDER WITH POLYMICROGYRIA AND SEIZURES [RCV005000609]	Chr6:159779213..159779214 [GRCh38] Chr6:160200245..160200246 [GRCh37] Chr6:6q25.3	pathogenic
GRCh37/hg19 6q24.2-27(chr6:144561123-170919482)x3	copy number gain	not provided [RCV004819303]	Chr6:144561123..170919482 [GRCh37] Chr6:6q24.2-27	pathogenic
NM_030752.3(TCP1):c.252_255del (p.Glu85fs) AND INTELLECTUAL DEVELOPMENTAL DISORDER WITH POLYMICROGYRIA	deletion	INTELLECTUAL DEVELOPMENTAL DISORDER WITH POLYMICROGYRIA AND SEIZURES [RCV005000608]	Chr6:159787767..159787770 [GRCh38] Chr6:160208799..160208802 [GRCh37] Chr6:6q25.3	pathogenic
NM_030752.3(TCP1):c.466A>G (p.Met156Val)	single nucleotide variant	not specified [RCV004871938]	Chr6:159785408 [GRCh38] Chr6:160206440 [GRCh37] Chr6:6q25.3	uncertain significance
NM_030752.3(TCP1):c.1493A>G (p.Asn498Ser)	single nucleotide variant	not specified [RCV004871939]	Chr6:159779223 [GRCh38] Chr6:160200255 [GRCh37] Chr6:6q25.3	uncertain significance
NM_030752.3(TCP1):c.707G>T (p.Cys236Phe)	single nucleotide variant	not specified [RCV004871940]	Chr6:159784031 [GRCh38] Chr6:160205063 [GRCh37] Chr6:6q25.3	uncertain significance
NM_030752.3(TCP1):c.1639G>A (p.Asp547Asn)	single nucleotide variant	not specified [RCV004675664]	Chr6:159779077 [GRCh38] Chr6:160200109 [GRCh37] Chr6:6q25.3	uncertain significance
GRCh37/hg19 6q25.3-27(chr6:159155998-171054786)x3	copy number gain	not provided [RCV000746132]	Chr6:159155998..171054786 [GRCh37] Chr6:6q25.3-27	pathogenic
NM_030752.3(TCP1):c.51C>G (p.Ile17Met)	single nucleotide variant	not specified [RCV004466659]	Chr6:159789418 [GRCh38] Chr6:160210450 [GRCh37] Chr6:6q25.3	uncertain significance

Predicted Target Of

	Summary Value
Count of predictions:	1883
Count of miRNA genes:	944
Interacting mature miRNAs:	1114
Transcripts:	ENST00000321394, ENST00000392168, ENST00000420894, ENST00000467544, ENST00000536394, ENST00000536607, ENST00000536807, ENST00000537390, ENST00000538128, ENST00000538530, ENST00000539756, ENST00000539948, ENST00000543517, ENST00000543532, ENST00000544255, ENST00000545764, ENST00000546023, ENST00000546204
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1643404	BMD3_H	Bone mineral density QTL 3 (human)	2.42	0.0005	Bone mineral density		6	157563614	170805979	Human
1643367	BW323_H	Body weight QTL 323 (human)	2.42	0.0005	Body fat amount		6	157563614	170805979	Human
597240038	GWAS1336112_H	lipoprotein A measurement QTL GWAS1336112 (human)		4e-74	lipoprotein A measurement		6	159786813	159786814	Human

SHGC-36020

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	12	20,095,903 - 20,096,010	UniSTS	GRCh37
GRCh37	6	160,200,019 - 160,200,126	UniSTS	GRCh37
Build 36	6	160,120,009 - 160,120,116	RGD	NCBI36
Celera	12	25,251,034 - 25,251,141	UniSTS
Celera	6	160,846,096 - 160,846,203	RGD
Cytogenetic Map	6	q25.3	UniSTS
Cytogenetic Map	12	p12.2	UniSTS
Cytogenetic Map	6	q25.3-q26	UniSTS
HuRef	12	19,867,573 - 19,867,680	UniSTS
HuRef	6	157,670,262 - 157,670,369	UniSTS
GeneMap99-G3 RH Map	12	1096.0	UniSTS

G06897

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	6	160,200,674 - 160,200,959	UniSTS	GRCh37
Build 36	6	160,120,664 - 160,120,949	RGD	NCBI36
Celera	6	160,846,751 - 160,847,036	RGD
Cytogenetic Map	6	q25.3-q26	UniSTS
HuRef	6	157,670,917 - 157,671,202	UniSTS

D6S1840

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	6	160,199,843 - 160,199,974	UniSTS	GRCh37
Build 36	6	160,119,833 - 160,119,964	RGD	NCBI36
Celera	6	160,845,920 - 160,846,051	RGD
Cytogenetic Map	6	q25.3	UniSTS
Cytogenetic Map	6	q25.3-q26	UniSTS
HuRef	6	157,670,086 - 157,670,217	UniSTS
Stanford-G3 RH Map	6	6368.0	UniSTS
GeneMap99-GB4 RH Map	6	622.06	UniSTS
NCBI RH Map	6	1631.6	UniSTS
GeneMap99-G3 RH Map	6	6671.0	UniSTS

GDB:451649

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	6	160,201,507 - 160,202,102	UniSTS	GRCh37
Celera	6	160,847,584 - 160,848,179	UniSTS
Cytogenetic Map	6	q25.3	UniSTS
Cytogenetic Map	6	q25.3-q26	UniSTS
HuRef	6	157,671,750 - 157,672,345	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

adipose tissue	alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	entire extraembryonic component	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	pharyngeal arch	renal system	reproductive system	respiratory system	sensory system	visual system
1204	2439	2788	2253	4974	1726	2351	6	624	1951	465	2270	7306	6472	53	3734	1	852	1744	1617	175	1


RefSeq Transcripts	NM_001008897	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_030752	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AA810047	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AH003003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK308551	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK312604	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AL135914	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC000665	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BM697304	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BM827784	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BT006969	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH471051	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CP068272	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X14986	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X52882	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENST00000321394 ⟹ ENSP00000317334

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	6	159,778,498 - 159,789,602 (-)	Ensembl

Ensembl Acc Id:

ENST00000392168 ⟹ ENSP00000376008

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	6	159,778,987 - 159,789,703 (-)	Ensembl

Ensembl Acc Id:

ENST00000420894 ⟹ ENSP00000390159

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	6	159,778,985 - 159,789,572 (-)	Ensembl

Ensembl Acc Id:

ENST00000467544

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	6	159,784,676 - 159,785,871 (-)	Ensembl

Ensembl Acc Id:

ENST00000536394 ⟹ ENSP00000442856

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	6	159,785,937 - 159,788,868 (-)	Ensembl

Ensembl Acc Id:

ENST00000536607

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	6	159,787,744 - 159,789,576 (-)	Ensembl

Ensembl Acc Id:

ENST00000536807

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	6	159,781,025 - 159,785,325 (-)	Ensembl

Ensembl Acc Id:

ENST00000537390 ⟹ ENSP00000437840

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	6	159,785,474 - 159,789,672 (-)	Ensembl

Ensembl Acc Id:

ENST00000538128 ⟹ ENSP00000442185

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	6	159,784,799 - 159,789,672 (-)	Ensembl

Ensembl Acc Id:

ENST00000538530 ⟹ ENSP00000440617

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	6	159,783,990 - 159,789,584 (-)	Ensembl

Ensembl Acc Id:

ENST00000539756 ⟹ ENSP00000441345

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	6	159,779,916 - 159,789,585 (-)	Ensembl

Ensembl Acc Id:

ENST00000539948 ⟹ ENSP00000439671

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	6	159,785,400 - 159,788,439 (-)	Ensembl

Ensembl Acc Id:

ENST00000543517 ⟹ ENSP00000444423

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	6	159,784,811 - 159,789,602 (-)	Ensembl

Ensembl Acc Id:

ENST00000543532

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	6	159,783,990 - 159,789,672 (-)	Ensembl

Ensembl Acc Id:

ENST00000544255 ⟹ ENSP00000439447

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	6	159,778,964 - 159,789,596 (-)	Ensembl

Ensembl Acc Id:

ENST00000545764

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	6	159,785,418 - 159,788,274 (-)	Ensembl

Ensembl Acc Id:

ENST00000546023

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	6	159,788,437 - 159,789,673 (-)	Ensembl

Ensembl Acc Id:

ENST00000546204

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	6	159,779,592 - 159,780,261 (-)	Ensembl

RefSeq Acc Id:

NM_001008897 ⟹ NP_001008897

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	6	159,778,498 - 159,789,602 (-)	NCBI
GRCh37	6	160,199,530 - 160,212,135 (-)	NCBI
Build 36	6	160,119,520 - 160,130,725 (-)	NCBI Archive
HuRef	6	157,669,773 - 157,680,978 (-)	ENTREZGENE
CHM1_1	6	160,461,821 - 160,473,042 (-)	NCBI
T2T-CHM13v2.0	6	161,024,115 - 161,035,234 (-)	NCBI

Sequence:

show sequence

AGTAGCTCCTGGGACATCGCTCGGGTACGCTCCACGCCGTCGCAGCCACTGCTGTGGTCGCCGGTCGGCCGAGGGGCCGCGATACTGGTTGCCCGCGGTGTAAGCAGAATTCGACGTGTATCGCTGCC
GTCAAGATGGAGGGGCCTTTGTCCGTGTTCGGTGACCGCAGCACTGGGGAAACGATCCGCTCCCAAAACGGATGTAACCATTACTAACGATGGTGCAACCATCCTGAAGTTACTGGAGGTAGAACATC
CTGCAGCTAAAGTTCTTTGTGAGCTGGCTGATCTGCAAGACAAAGAAGTTGGAGATGGAACTACTTCAGTGGTTATTATTGCAGCAGAACTCCTAAAAAATGCAGATGAATTAGTCAAACAGAAAATT
CATCCCACATCAGTTATTAGTGGCTATCGACTTGCTTGCAAGGAAGCAGTGCGTTATATCAATGAAAACCTAATTGTTAACACAGATGAACTGGGAAGAGATTGCCTGATTAATGCTGCTAAGACATC
CATGTCTTCCAAAATCATTGGAATAAATGGTGATTTCTTTGCTAACATGGTAGTAGATGCTGTACTTGCTATTAAATACACAGACATAAGAGGCCAGCCACGCTATCCAGTCAACTCTGTTAATATTT
TGAAAGCCCATGGGAGAAGTCAAATGGAGAGTATGCTCATCAGTGGCTATGCACTCAACTGTGTGGTGGGATCCCAGGGCATGCCCAAGAGAATCGTAAATGCAAAAATTGCTTGCCTTGACTTCAGC
CTGCAAAAAACAAAAATGAAGCTTGGTGTACAGGTGGTCATTACAGACCCTGAAAAACTGGACCAAATTAGACAGAGAGAATCAGATATCACCAAGGAGAGAATTCAGAAGATCCTGGCAACTGGTGC
CAATGTTATTCTAACCACTGGTGGAATTGATGATATGTGTCTGAAGTATTTTGTGGAGGCTGGTGCTATGGCAGTTAGAAGAGTTTTAAAAAGGGACCTTAAACGCATTGCCAAAGCTTCTGGAGCAA
CTATTCTGTCAACCCTGGCCAATTTGGAAGGTGAAGAAACTTTTGAAGCTGCAATGTTGGGACAGGCAGAAGAAGTGGTACAGGAGAGAATTTGTGATGATGAGCTGATCTTAATCAAAAATACTAAG
GCTCGTACGTCTGCATCGATTATCTTACGTGGGGCAAATGATTTCATGTGTGATGAGATGGAGCGCTCTTTACATGATGCACTTTGTGTAGTGAAGAGAGTTTTGGAGTCAAAATCTGTGGTTCCCGG
TGGGGGTGCTGTAGAAGCAGCCCTTTCCATATACCTTGAAAACTATGCAACCAGCATGGGGTCTCGGGAACAGCTTGCGATTGCAGAGTTTGCAAGATCACTTCTTGTTATTCCCAATACACTAGCAG
TTAATGCTGCCCAGGACTCCACAGATCTGGTTGCAAAATTAAGAGCTTTTCATAATGAGGCCCAGGTTAACCCAGAACGTAAAAATCTAAAATGGATTGGTCTTGATTTGAGCAATGGTAAACCTCGA
GACAACAAACAAGCAGGGGTGTTTGAACCAACCATAGTTAAAGTTAAGAGTTTGAAATTTGCAACAGAAGCTGCAATCACCATTCTTCGAATTGATGATCTTATTAAATTACATCCAGAAAGTAAAGA
TGATAAACATGGAAGTTATGAAGATGCTGTTCACTCTGGAGCCCTTAATGATTGATCTGATGTTCCTTTTATTTATAACAATGTTAAATGCAATTGTCTTGTACCTTGAGTTGAGTATTACACATTAA
AGTAAAGTACAAGCTGTAAACTTGGGTTTTTGTGATGTAGGAAATGGTTTCCATCTGTACTTTGGTCCTCTGATTTCACATATTGCAACCTAGTACTTTATTAGTTTAAAAAGAAATTGAGGTTGTTC
AAAGTTTAAGCAATTCATTCTCTCTGAACACACATTGCTATTCCCATCCCACCCCCAATGCACAGGGCTGCAACACCACGACTTCTGCCCATTCTCTCCAGTGTGTGTAACAGGGTCACAAGAATTCG
ACAGCCAGATGCTCCAAGAGGGTGGCCCAAGGCTATAGCCCCTCCTTCAATATTGACCTAACGGGGGAGAAAAGATTTAGATTGTTTATTCTTCTGTGGACACAGTTTAAAATCTTAAACTTGTCTTT
TTCCTCTTAATGTATCAGCATGCTACCCTTTCAAACTCAAATTTTCATTTTAACTGCTTAGGAATAAATTTACACCTTTGTGAAAATTCA

hide sequence

RefSeq Acc Id:

NM_030752 ⟹ NP_110379

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	6	159,778,498 - 159,789,602 (-)	NCBI
GRCh37	6	160,199,530 - 160,212,135 (-)	NCBI
Build 36	6	160,119,520 - 160,130,725 (-)	NCBI Archive
HuRef	6	157,669,773 - 157,680,978 (-)	ENTREZGENE
CHM1_1	6	160,461,821 - 160,473,042 (-)	NCBI
T2T-CHM13v2.0	6	161,024,115 - 161,035,234 (-)	NCBI

Sequence:

show sequence

AGTAGCTCCTGGGACATCGCTCGGGTACGCTCCACGCCGTCGCAGCCACTGCTGTGGTCGCCGGTCGGCCGAGGGGCCGCGATACTGGTTGCCCGCGGTGTAAGCAGAATTCGACGTGTATCGCTGCC
GTCAAGATGGAGGGGCCTTTGTCCGTGTTCGGTGACCGCAGCACTGGGGAAACGATCCGCTCCCAAAACGTTATGGCTGCAGCTTCGATTGCCAATATTGTAAAAAGTTCTCTTGGTCCAGTTGGCTT
GGATAAAATGTTGGTGGATGATATTGGTGATGTAACCATTACTAACGATGGTGCAACCATCCTGAAGTTACTGGAGGTAGAACATCCTGCAGCTAAAGTTCTTTGTGAGCTGGCTGATCTGCAAGACA
AAGAAGTTGGAGATGGAACTACTTCAGTGGTTATTATTGCAGCAGAACTCCTAAAAAATGCAGATGAATTAGTCAAACAGAAAATTCATCCCACATCAGTTATTAGTGGCTATCGACTTGCTTGCAAG
GAAGCAGTGCGTTATATCAATGAAAACCTAATTGTTAACACAGATGAACTGGGAAGAGATTGCCTGATTAATGCTGCTAAGACATCCATGTCTTCCAAAATCATTGGAATAAATGGTGATTTCTTTGC
TAACATGGTAGTAGATGCTGTACTTGCTATTAAATACACAGACATAAGAGGCCAGCCACGCTATCCAGTCAACTCTGTTAATATTTTGAAAGCCCATGGGAGAAGTCAAATGGAGAGTATGCTCATCA
GTGGCTATGCACTCAACTGTGTGGTGGGATCCCAGGGCATGCCCAAGAGAATCGTAAATGCAAAAATTGCTTGCCTTGACTTCAGCCTGCAAAAAACAAAAATGAAGCTTGGTGTACAGGTGGTCATT
ACAGACCCTGAAAAACTGGACCAAATTAGACAGAGAGAATCAGATATCACCAAGGAGAGAATTCAGAAGATCCTGGCAACTGGTGCCAATGTTATTCTAACCACTGGTGGAATTGATGATATGTGTCT
GAAGTATTTTGTGGAGGCTGGTGCTATGGCAGTTAGAAGAGTTTTAAAAAGGGACCTTAAACGCATTGCCAAAGCTTCTGGAGCAACTATTCTGTCAACCCTGGCCAATTTGGAAGGTGAAGAAACTT
TTGAAGCTGCAATGTTGGGACAGGCAGAAGAAGTGGTACAGGAGAGAATTTGTGATGATGAGCTGATCTTAATCAAAAATACTAAGGCTCGTACGTCTGCATCGATTATCTTACGTGGGGCAAATGAT
TTCATGTGTGATGAGATGGAGCGCTCTTTACATGATGCACTTTGTGTAGTGAAGAGAGTTTTGGAGTCAAAATCTGTGGTTCCCGGTGGGGGTGCTGTAGAAGCAGCCCTTTCCATATACCTTGAAAA
CTATGCAACCAGCATGGGGTCTCGGGAACAGCTTGCGATTGCAGAGTTTGCAAGATCACTTCTTGTTATTCCCAATACACTAGCAGTTAATGCTGCCCAGGACTCCACAGATCTGGTTGCAAAATTAA
GAGCTTTTCATAATGAGGCCCAGGTTAACCCAGAACGTAAAAATCTAAAATGGATTGGTCTTGATTTGAGCAATGGTAAACCTCGAGACAACAAACAAGCAGGGGTGTTTGAACCAACCATAGTTAAA
GTTAAGAGTTTGAAATTTGCAACAGAAGCTGCAATCACCATTCTTCGAATTGATGATCTTATTAAATTACATCCAGAAAGTAAAGATGATAAACATGGAAGTTATGAAGATGCTGTTCACTCTGGAGC
CCTTAATGATTGATCTGATGTTCCTTTTATTTATAACAATGTTAAATGCAATTGTCTTGTACCTTGAGTTGAGTATTACACATTAAAGTAAAGTACAAGCTGTAAACTTGGGTTTTTGTGATGTAGGA
AATGGTTTCCATCTGTACTTTGGTCCTCTGATTTCACATATTGCAACCTAGTACTTTATTAGTTTAAAAAGAAATTGAGGTTGTTCAAAGTTTAAGCAATTCATTCTCTCTGAACACACATTGCTATT
CCCATCCCACCCCCAATGCACAGGGCTGCAACACCACGACTTCTGCCCATTCTCTCCAGTGTGTGTAACAGGGTCACAAGAATTCGACAGCCAGATGCTCCAAGAGGGTGGCCCAAGGCTATAGCCCC
TCCTTCAATATTGACCTAACGGGGGAGAAAAGATTTAGATTGTTTATTCTTCTGTGGACACAGTTTAAAATCTTAAACTTGTCTTTTTCCTCTTAATGTATCAGCATGCTACCCTTTCAAACTCAAAT
TTTCATTTTAACTGCTTAGGAATAAATTTACACCTTTGTGAAAATTCA

hide sequence


Protein RefSeqs	NP_001008897	(Get FASTA)	NCBI Sequence Viewer
	NP_110379	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA61059	(Get FASTA)	NCBI Sequence Viewer
	AAA61060	(Get FASTA)	NCBI Sequence Viewer
	AAH00665	(Get FASTA)	NCBI Sequence Viewer
	AAP35615	(Get FASTA)	NCBI Sequence Viewer
	CAA37064	(Get FASTA)	NCBI Sequence Viewer
	EAW47616	(Get FASTA)	NCBI Sequence Viewer
	EAW47617	(Get FASTA)	NCBI Sequence Viewer
	EAW47618	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSP00000317334
	ENSP00000317334.7
	ENSP00000376008
GenBank Protein	P17987	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001008897 ⟸ NM_001008897
- Peptide Label:	isoform b
- UniProtKB:	E7EQR6 (UniProtKB/TrEMBL), F5H282 (UniProtKB/TrEMBL)
- Sequence:	show sequence MSSKIIGINGDFFANMVVDAVLAIKYTDIRGQPRYPVNSVNILKAHGRSQMESMLISGYALNCVVGSQGMPKRIVNAKIACLDFSLQKTKMKLGVQVVITDPEKLDQIRQRESDITKERIQKILATGA NVILTTGGIDDMCLKYFVEAGAMAVRRVLKRDLKRIAKASGATILSTLANLEGEETFEAAMLGQAEEVVQERICDDELILIKNTKARTSASIILRGANDFMCDEMERSLHDALCVVKRVLESKSVVPG GGAVEAALSIYLENYATSMGSREQLAIAEFARSLLVIPNTLAVNAAQDSTDLVAKLRAFHNEAQVNPERKNLKWIGLDLSNGKPRDNKQAGVFEPTIVKVKSLKFATEAAITILRIDDLIKLHPESKD DKHGSYEDAVHSGALND hide sequence

RefSeq Acc Id:	NP_110379 ⟸ NM_030752
- Peptide Label:	isoform a
- UniProtKB:	Q15556 (UniProtKB/Swiss-Prot), E1P5B2 (UniProtKB/Swiss-Prot), Q5TCM3 (UniProtKB/Swiss-Prot), P17987 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MEGPLSVFGDRSTGETIRSQNVMAAASIANIVKSSLGPVGLDKMLVDDIGDVTITNDGATILKL LEVEHPAAKVLCELADLQDKEVGDGTTSVVIIAAELLKNADELVKQKIHPTSVISGYRLACKEAVRYINENLIVNTDELGRDCLINAAKTSMSSKIIGINGDFFANMVVDAVLAIKYTDIRGQPRYPV NSVNILKAHGRSQMESMLISGYALNCVVGSQGMPKRIVNAKIACLDFSLQKTKMKLGVQVVITDPEKLDQIRQRESDITKERIQKILATGANVILTTGGIDDMCLKYFVEAGAMAVRRVLKRDLKRIA KASGATILSTLANLEGEETFEAAMLGQAEEVVQERICDDELILIKNTKARTSASIILRGANDFMCDEMERSLHDALCVVKRVLESKSVVPGGGAVEAALSIYLENYATSMGSREQLAIAEFARSLLVI PNTLAVNAAQDSTDLVAKLRAFHNEAQVNPERKNLKWIGLDLSNGKPRDNKQAGVFEPTIVKVKSLKFATEAAITILRIDDLIKLHPESKDDKHGSYEDAVHSGALND hide sequence

Ensembl Acc Id:

ENSP00000444423 ⟸ ENST00000543517

Ensembl Acc Id:

ENSP00000439447 ⟸ ENST00000544255

Ensembl Acc Id:

ENSP00000317334 ⟸ ENST00000321394

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P17987-F1-model_v2	AlphaFold	P17987	1-556	view protein structure

RGD ID:

7209593

Promoter ID:

EPDNEW_H10541

Type:

initiation region

Name:

TCP1_1

Description:

t-complex 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	6	159,789,602 - 159,789,662	EPDNEW

RGD ID:

6804846

Promoter ID:

HG_KWN:55659

Type:

Non-CpG

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

Jurkat

Transcripts:

OTTHUMT00000042918

Position:

Human Assembly	Chr	Position (strand)	Source
Build 36	6	160,127,311 - 160,127,862 (-)	MPROMDB

RGD ID:

6803939

Promoter ID:

HG_KWN:55660

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

CD4+TCell, CD4+TCell_12Hour, CD4+TCell_2Hour, HeLa_S3, Jurkat, K562, Lymphoblastoid, NB4

Transcripts:

NM_001008897, OTTHUMT00000042917, OTTHUMT00000042925, OTTHUMT00000042926, OTTHUMT00000042927, OTTHUMT00000042928, UC003QST.1, UC010KJZ.1, UC010KKA.1, UC010KKB.1

Position:

Human Assembly	Chr	Position (strand)	Source
Build 36	6	160,129,661 - 160,131,702 (+)	MPROMDB

Database	Acc Id	Source(s)
COSMIC	TCP1	COSMIC
Ensembl Genes	ENSG00000120438	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENST00000321394	ENTREZGENE
	ENST00000321394.12	UniProtKB/Swiss-Prot
	ENST00000392168	ENTREZGENE
Gene3D-CATH	1.10.560.10	UniProtKB/Swiss-Prot
	3.30.260.10	UniProtKB/Swiss-Prot
	3.50.7.10	UniProtKB/Swiss-Prot
GTEx	ENSG00000120438	GTEx
HGNC ID	HGNC:11655	ENTREZGENE
Human Proteome Map	TCP1	Human Proteome Map
InterPro	Chap_CCT_alpha	UniProtKB/Swiss-Prot
	Chaperone_TCP-1	UniProtKB/Swiss-Prot
	Chaperonin_TCP-1_CS	UniProtKB/Swiss-Prot
	Cpn60/TCP-1	UniProtKB/Swiss-Prot
	GroEL-like_apical_dom_sf	UniProtKB/Swiss-Prot
	GROEL-like_equatorial_sf	UniProtKB/Swiss-Prot
	TCP-1-like_intermed_sf	UniProtKB/Swiss-Prot
	TCP-1_chaperonin	UniProtKB/Swiss-Prot
	thermosome_alpha	UniProtKB/Swiss-Prot
KEGG Report	hsa:6950	UniProtKB/Swiss-Prot
NCBI Gene	6950	ENTREZGENE
OMIM	186980	OMIM
PANTHER	PTHR11353	UniProtKB/Swiss-Prot
Pfam	Cpn60_TCP1	UniProtKB/Swiss-Prot
PharmGKB	PA36406	PharmGKB
PRINTS	TCOMPLEXTCP1	UniProtKB/Swiss-Prot
PROSITE	TCP1_1	UniProtKB/Swiss-Prot
	TCP1_2	UniProtKB/Swiss-Prot
	TCP1_3	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF48592	UniProtKB/Swiss-Prot
	SSF52029	UniProtKB/Swiss-Prot
	SSF54849	UniProtKB/Swiss-Prot
UniProt	E1P5B2	ENTREZGENE
	E7EQR6	ENTREZGENE, UniProtKB/TrEMBL
	E7ERF2_HUMAN	UniProtKB/TrEMBL
	F5GYL4_HUMAN	UniProtKB/TrEMBL
	F5GZ03_HUMAN	UniProtKB/TrEMBL
	F5GZI8_HUMAN	UniProtKB/TrEMBL
	F5H136_HUMAN	UniProtKB/TrEMBL
	F5H282	ENTREZGENE, UniProtKB/TrEMBL
	F5H676_HUMAN	UniProtKB/TrEMBL
	F5H726_HUMAN	UniProtKB/TrEMBL
	F5H7Y1_HUMAN	UniProtKB/TrEMBL
	P17987	ENTREZGENE
	Q15556	ENTREZGENE
	Q5TCM3	ENTREZGENE
	TCPA_HUMAN	UniProtKB/Swiss-Prot
UniProt Secondary	E1P5B2	UniProtKB/Swiss-Prot
	Q15556	UniProtKB/Swiss-Prot
	Q5TCM3	UniProtKB/Swiss-Prot

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM