Gene: Slc5a5 (solute carrier family 5 (sodium iodide symporter), member 5) Mus musculus
Analyze
Symbol:
Slc5a5
Name:
solute carrier family 5 (sodium iodide symporter), member 5
RGD ID:
731752
MGI Page
MGI
Description:
Enables sodium:iodide symporter activity. Predicted to be involved in several processes, including cellular response to Thyroid stimulating hormone; cellular response to forskolin; and iodide transmembrane transport. Located in cytoplasm and plasma membrane. Is expressed in axial skeleton tail region; stomach; testis; and thyroid gland. Human ortholog(s) of this gene implicated in congenital hypothyroidism and thyroid dyshormonogenesis 1. Orthologous to human SLC5A5 (solute carrier family 5 member 5).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
Na(+)/I(-) cotransporter; Na(+)/I(-) symporter; Na(+)/I(-)-symporter; NIS; sodium-iodide symporter; sodium/iodide cotransporter; solute carrier family 5 member 5
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
SLC5A5 (solute carrier family 5 member 5) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Rattus norvegicus (Norway rat):
Slc5a5 (solute carrier family 5 member 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Slc5a5 (solute carrier family 5 member 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
SLC5A5 (solute carrier family 5 member 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
SLC5A5 (solute carrier family 5 member 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Slc5a5 (solute carrier family 5 member 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
SLC5A5 (solute carrier family 5 member 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
SLC5A5 (solute carrier family 5 member 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Slc5a5 (solute carrier family 5 member 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Slc5a5 (solute carrier family 5 member 5)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
SLC5A5 (solute carrier family 5 member 5)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
slc5a5 (solute carrier family 5 member 5)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Drosophila melanogaster (fruit fly):
CG10444
Alliance
DIOPT (Hieranoid|InParanoid|OrthoFinder|OrthoInspector|SonicParanoid)
Caenorhabditis elegans (roundworm):
ZK822.5
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG2187
Alliance
DIOPT (Ensembl Compara|Hieranoid|PANTHER)
Saccharomyces cerevisiae (baker's yeast):
DUR3
Alliance
DIOPT (Ensembl Compara|InParanoid)
Drosophila melanogaster (fruit fly):
CG31262
Alliance
DIOPT (Ensembl Compara|Hieranoid|PANTHER)
Drosophila melanogaster (fruit fly):
CG31668
Alliance
DIOPT (Ensembl Compara|Hieranoid|PANTHER)
Drosophila melanogaster (fruit fly):
CG32669
Alliance
DIOPT (Hieranoid|InParanoid|OrthoFinder|OrthoInspector|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG33124
Alliance
DIOPT (Ensembl Compara|Hieranoid|PANTHER)
Drosophila melanogaster (fruit fly):
CG42235
Alliance
DIOPT (Ensembl Compara|Hieranoid|PANTHER)
Drosophila melanogaster (fruit fly):
CG5687
Alliance
DIOPT (Ensembl Compara|Hieranoid|PANTHER)
Drosophila melanogaster (fruit fly):
CG6723
Alliance
DIOPT (Ensembl Compara|Hieranoid|PANTHER)
Drosophila melanogaster (fruit fly):
CG9657
Alliance
DIOPT (Ensembl Compara|Hieranoid|PANTHER)
Drosophila melanogaster (fruit fly):
SLC5A11
Alliance
DIOPT (Ensembl Compara|Hieranoid|PANTHER)
Drosophila melanogaster (fruit fly):
Smvt
Alliance
DIOPT (Ensembl Compara|Hieranoid|PANTHER)
Drosophila melanogaster (fruit fly):
salt
Alliance
DIOPT (Ensembl Compara|Hieranoid|PANTHER)
Xenopus tropicalis (tropical clawed frog):
slc5a5
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 71,335,529 - 71,345,429 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 71,335,533 - 71,345,401 (-) Ensembl GRCm39 Ensembl GRCm38 8 70,882,885 - 70,892,785 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 70,882,889 - 70,892,757 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 73,406,788 - 73,416,656 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 73,812,491 - 73,821,713 (-) NCBI MGSCv36 mm8 Celera 8 73,444,192 - 73,454,060 (-) NCBI Celera Cytogenetic Map 8 B3.3 NCBI cM Map 8 34.36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Imported Disease Annotations - ClinVar
Slc5a5 Mouse amenorrhea ISO RGD:731751 8554872 ClinVar Annotator: match by term: Primary amenorrhea ClinVar PMID:21681106 Slc5a5 Mouse congenital hypothyroidism ISO RGD:731751 8554872 ClinVar Annotator: match by term: Congenital hypothyroidism ClinVar PMID:10487695|PMID:25741868|PMID:28492532|PMID:30240412|PMID:33692749|PMID:3998954 Slc5a5 Mouse familial thyroid dyshormonogenesis ISO RGD:731751 8554872 ClinVar Annotator: match by term: Thyroid Hormonogenesis Defect ClinVar PMID:25741868 Slc5a5 Mouse genetic disease ISO RGD:731751 8554872 ClinVar Annotator: match by term: Inborn genetic diseases ClinVar PMID:25741868|PMID:28492532 Slc5a5 Mouse Megalencephaly-Polymicrogyria-Polydactyly-Hydrocephalus Syndrome 1 ISO RGD:731751 8554872 ClinVar Annotator: match by term: Megalencephaly-polymicrogyria-polydactyly-hydrocephalus syndrome 1 ClinVar PMID:28492532 Slc5a5 Mouse severe combined immunodeficiency, autosomal recessive, T cell-negative, B cell-negative, NK cell-positive ISO RGD:731751 8554872 ClinVar Annotator: match by term: Severe combined immunodeficiency, autosomal recessive, T cell-negative, B cell-positive, NK more ... ClinVar PMID:28492532 Slc5a5 Mouse Severe Combined Immunodeficiency, Autosomal Recessive, T Cell-Negative, B Cell-Positive, NK Cell-Negative ISO RGD:731751 8554872 ClinVar Annotator: match by term: SCID, autosomal recessive, T-negative/B-positive type ClinVar PMID:28492532 Slc5a5 Mouse thyroid dyshormonogenesis 1 ISO RGD:731751 8554872 ClinVar Annotator: match by term: SLC5A5-related condition | ClinVar Annotator: match by term: Thyroid dyshormonogenesis more ... ClinVar PMID:10487695|PMID:10902780|PMID:10907989|PMID:16418213|PMID:18339708|PMID:21054210|PMID:21565787|PMID:23690546|PMID:25525159|PMID:25741868|PMID:26204134|PMID:28492532|PMID:30240412|PMID:32805706|PMID:33692749|PMID:35276235|PMID:3998954|PMID:9171822|PMID:9388506|PMID:9398697|PMID:9486973|PMID:9657379|PMID:9709973|PMID:9745458|PMID:9814502
Imported Disease Annotations - CTD
Imported Disease Annotations - OMIM
Only show annotations with direct experimental evidence (0 objects hidden)
Slc5a5 Mouse 1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene multiple interactions EXP 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Slc5a5 Mouse 1,3-benzothiazole-2-thiol multiple interactions ISO RGD:731751 6480464 captax inhibits the reaction [SLC5A5 protein results in increased uptake of Iodine] CTD PMID:27979590 Slc5a5 Mouse 17beta-estradiol multiple interactions ISO RGD:69267 6480464 [Estradiol co-treated with OXT protein] results in increased expression of SLC5A5 mRNA CTD PMID:16954431 Slc5a5 Mouse 17beta-estradiol increases expression ISO RGD:69267 6480464 Estradiol results in increased expression of SLC5A5 protein CTD PMID:16954431 Slc5a5 Mouse 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions EXP 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Slc5a5 Mouse 2,2',4,4'-Tetrabromodiphenyl ether decreases activity ISO RGD:69267 6480464 2,2',4,4'-tetrabromodiphenyl ether results in decreased activity of SLC5A5 protein CTD PMID:26827900 Slc5a5 Mouse 2,2',4,4'-Tetrabromodiphenyl ether multiple interactions ISO RGD:731751 6480464 2,2',4,4'-tetrabromodiphenyl ether inhibits the reaction [SLC5A5 protein results in increased uptake of Iodine] CTD PMID:27979590 Slc5a5 Mouse 2,2',5,5'-tetrachlorobiphenyl multiple interactions EXP 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Slc5a5 Mouse 2,3',4,4',5-Pentachlorobiphenyl decreases expression ISO RGD:69267 6480464 2,3',4,4',5-pentachlorobiphenyl results in decreased expression of SLC5A5 protein CTD PMID:26519956|PMID:36450500 Slc5a5 Mouse 2,3',4,4',5-Pentachlorobiphenyl decreases expression ISO RGD:731751 6480464 2,3',4,4',5-pentachlorobiphenyl results in decreased expression of SLC5A5 mRNA; 2,3',4,4',5-pentachlorobiphenyl results in decreased expression of SLC5A5 more ... CTD PMID:25644787 Slc5a5 Mouse 2,3',4,4',5-Pentachlorobiphenyl multiple interactions ISO RGD:731751 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [2,3',4,4',5-pentachlorobiphenyl results in decreased expression of SLC5A5 protein] CTD PMID:25644787 Slc5a5 Mouse 2,3',4,4',5-Pentachlorobiphenyl multiple interactions ISO RGD:69267 6480464 alpha-naphthoflavone inhibits the reaction [2,3',4,4',5-pentachlorobiphenyl results in decreased expression of SLC5A5 protein] CTD PMID:26519956 Slc5a5 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of SLC5A5 mRNA CTD PMID:21570461 Slc5a5 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:69267 6480464 Tetrachlorodibenzodioxin results in decreased expression of SLC5A5 mRNA CTD PMID:33387578 Slc5a5 Mouse 2,4,4'-trichlorobiphenyl multiple interactions EXP 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Slc5a5 Mouse 3,3',5,5'-tetrabromobisphenol A decreases expression EXP 6480464 tetrabromobisphenol A results in decreased expression of SLC5A5 protein CTD PMID:37487893 Slc5a5 Mouse 3,3',5-triiodo-L-thyronine decreases expression EXP 6480464 Triiodothyronine results in decreased expression of SLC5A5 protein CTD PMID:37487893 Slc5a5 Mouse 3,7-dihydropurine-6-thione decreases expression ISO RGD:69267 6480464 Mercaptopurine results in decreased expression of SLC5A5 mRNA CTD PMID:23358152 Slc5a5 Mouse 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO RGD:731751 6480464 1-Methyl-3-isobutylxanthine promotes the reaction [[Tretinoin co-treated with Hydrocortisone] affects the localization of SLC5A5 protein]; 1-Methyl-3-isobutylxanthine more ... CTD PMID:16439463 Slc5a5 Mouse 4,4'-diisothiocyano-trans-stilbene-2,2'-disulfonic acid multiple interactions ISO RGD:731751 6480464 4,4'-Diisothiocyanostilbene-2,2'-Disulfonic Acid promotes the reaction [SLC5A5 protein results in increased uptake of Sodium Iodide] CTD PMID:12541134 Slc5a5 Mouse 4,4'-sulfonyldiphenol decreases expression EXP 6480464 bisphenol S results in decreased expression of SLC5A5 protein CTD PMID:37487893 Slc5a5 Mouse 5-aza-2'-deoxycytidine multiple interactions ISO RGD:731751 6480464 [[Butyrates co-treated with Decitabine] results in increased expression of SLC5A5 mRNA] which results in increased more ... CTD PMID:17967635|PMID:19524134 Slc5a5 Mouse 5-aza-2'-deoxycytidine increases expression ISO RGD:731751 6480464 Decitabine results in increased expression of SLC5A5 mRNA CTD PMID:17967635 Slc5a5 Mouse 5-azacytidine multiple interactions ISO RGD:731751 6480464 [Azacitidine co-treated with Butyrates] affects the expression of SLC5A5 mRNA CTD PMID:17164311 Slc5a5 Mouse 5-azacytidine increases expression ISO RGD:731751 6480464 Azacitidine results in increased expression of SLC5A5 mRNA CTD PMID:16954431 Slc5a5 Mouse 5-Nitro-2-(3-phenylpropylamino)benzoic acid multiple interactions ISO RGD:731751 6480464 5-nitro-2-(3-phenylpropylamino)benzoic acid inhibits the reaction [SLC5A5 protein results in increased uptake of Iodine] CTD PMID:27979590 Slc5a5 Mouse 6-propyl-2-thiouracil increases expression ISO RGD:69267 6480464 Propylthiouracil results in increased expression of SLC5A5 mRNA CTD PMID:22342233|PMID:39441382 Slc5a5 Mouse 6-propyl-2-thiouracil decreases expression ISO RGD:69267 6480464 Propylthiouracil results in decreased expression of SLC5A5 mRNA CTD PMID:36843608 Slc5a5 Mouse 9-cis-retinoic acid increases expression ISO RGD:731751 6480464 Alitretinoin results in increased expression of SLC5A5 mRNA CTD PMID:16954431 Slc5a5 Mouse acrylamide increases expression ISO RGD:69267 6480464 Acrylamide results in increased expression of SLC5A5 mRNA CTD PMID:28959563 Slc5a5 Mouse adenosine increases expression ISO RGD:69267 6480464 Adenosine results in increased expression of SLC5A5 mRNA; Adenosine results in increased expression of SLC5A5 more ... CTD PMID:16954431 Slc5a5 Mouse aflatoxin B1 decreases methylation ISO RGD:731751 6480464 Aflatoxin B1 results in decreased methylation of SLC5A5 intron CTD PMID:30157460 Slc5a5 Mouse all-trans-retinoic acid multiple interactions ISO RGD:731751 6480464 1-Methyl-3-isobutylxanthine promotes the reaction [[Tretinoin co-treated with Hydrocortisone] affects the localization of SLC5A5 protein]; 1-Methyl-3-isobutylxanthine more ... CTD PMID:16234306|PMID:16439463|PMID:16730657|PMID:16954431|PMID:19524134|PMID:20300827 Slc5a5 Mouse all-trans-retinoic acid decreases expression ISO RGD:731751 6480464 Tretinoin results in decreased expression of SLC5A5 mRNA CTD PMID:21924320 Slc5a5 Mouse all-trans-retinoic acid increases expression ISO RGD:731751 6480464 Tretinoin results in increased expression of SLC5A5 mRNA; Tretinoin results in increased expression of SLC5A5 more ... CTD PMID:16234306|PMID:16439463|PMID:16954431|PMID:17045167|PMID:17332617|PMID:20300827 Slc5a5 Mouse all-trans-retinoic acid affects localization ISO RGD:731751 6480464 Tretinoin affects the localization of SLC5A5 protein CTD PMID:16439463 Slc5a5 Mouse alpha-naphthoflavone multiple interactions ISO RGD:69267 6480464 alpha-naphthoflavone inhibits the reaction [2,3',4,4',5-pentachlorobiphenyl results in decreased expression of SLC5A5 protein] CTD PMID:26519956 Slc5a5 Mouse amiodarone decreases expression ISO RGD:731751 6480464 Amiodarone results in decreased expression of SLC5A5 mRNA CTD PMID:18020914 Slc5a5 Mouse ammonium chloride affects expression ISO RGD:69267 6480464 Ammonium Chloride affects the expression of SLC5A5 mRNA CTD PMID:16483693 Slc5a5 Mouse ATP multiple interactions ISO RGD:731751 6480464 Adenosine Triphosphate inhibits the reaction [TSHB protein results in increased expression of SLC5A5 protein] CTD PMID:16439463 Slc5a5 Mouse benzo[a]pyrene decreases methylation ISO RGD:731751 6480464 Benzo(a)pyrene results in decreased methylation of SLC5A5 exon CTD PMID:27901495 Slc5a5 Mouse benzo[a]pyrene affects methylation ISO RGD:731751 6480464 Benzo(a)pyrene affects the methylation of SLC5A5 promoter CTD PMID:27901495 Slc5a5 Mouse benzo[a]pyrene increases methylation ISO RGD:731751 6480464 Benzo(a)pyrene results in increased methylation of SLC5A5 3' UTR CTD PMID:27901495 Slc5a5 Mouse benzo[a]pyrene diol epoxide I increases expression ISO RGD:731751 6480464 7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in increased expression of SLC5A5 mRNA CTD PMID:19150397 Slc5a5 Mouse Benzo[ghi]perylene increases expression EXP 6480464 1,12-benzoperylene results in increased expression of SLC5A5 mRNA CTD PMID:26377693 Slc5a5 Mouse bis(2-ethylhexyl) phthalate decreases expression ISO RGD:69267 6480464 Diethylhexyl Phthalate results in decreased expression of SLC5A5 mRNA CTD PMID:36714560 Slc5a5 Mouse bis(2-ethylhexyl) phthalate increases expression ISO RGD:69267 6480464 Diethylhexyl Phthalate results in increased expression of NIS mRNA; Diethylhexyl Phthalate results in increased expression more ... CTD PMID:30716676|PMID:33649816|PMID:33789034 Slc5a5 Mouse bisphenol A decreases expression ISO RGD:69267 6480464 bisphenol A results in decreased expression of SLC5A5 mRNA CTD PMID:26827900|PMID:30352396|PMID:30816183|PMID:34947998 Slc5a5 Mouse bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of SLC5A5 protein CTD PMID:37487893 Slc5a5 Mouse bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of SLC5A5 mRNA CTD PMID:34585602 Slc5a5 Mouse bisphenol A multiple interactions ISO RGD:69267 6480464 Acetylcysteine inhibits the reaction [bisphenol A results in decreased expression of SLC5A5 mRNA] CTD PMID:30352396 Slc5a5 Mouse bisphenol A increases expression ISO RGD:69267 6480464 bisphenol A results in increased expression of SLC5A5 mRNA CTD PMID:23238275|PMID:25181051|PMID:26982218 Slc5a5 Mouse bisphenol A decreases activity ISO RGD:69267 6480464 bisphenol A results in decreased activity of SLC5A5 protein CTD PMID:26827900 Slc5a5 Mouse Butylbenzyl phthalate increases expression ISO RGD:731751 6480464 butylbenzyl phthalate results in increased expression of SLC5A5 mRNA CTD PMID:16257484 Slc5a5 Mouse Butylbenzyl phthalate increases expression ISO RGD:69267 6480464 butylbenzyl phthalate results in increased expression of SLC5A5 mRNA CTD PMID:16257484 Slc5a5 Mouse carbamazepine multiple interactions ISO RGD:731751 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [Carbamazepine promotes the reaction [Tretinoin results in increased expression of SLC5A5 more ... CTD PMID:20300827 Slc5a5 Mouse chlorpyrifos increases expression EXP 6480464 Chlorpyrifos results in increased expression of SLC5A5 mRNA CTD PMID:37019170 Slc5a5 Mouse cisplatin increases phosphorylation EXP 6480464 Cisplatin results in increased phosphorylation of SLC5A5 protein CTD PMID:22006019 Slc5a5 Mouse cobalt dichloride decreases expression ISO RGD:69267 6480464 cobaltous chloride results in decreased expression of SLC5A5 mRNA CTD PMID:24386269 Slc5a5 Mouse colforsin daropate hydrochloride multiple interactions ISO RGD:731751 6480464 Colforsin inhibits the reaction [[Tretinoin co-treated with Hydrocortisone] results in increased activity of SLC5A5 protein] CTD PMID:16439463 Slc5a5 Mouse colforsin daropate hydrochloride increases expression ISO RGD:69267 6480464 Colforsin results in increased expression of SLC5A5 mRNA; Colforsin results in increased expression of SLC5A5 more ... CTD PMID:16954431 Slc5a5 Mouse colforsin daropate hydrochloride increases expression ISO RGD:731751 6480464 Colforsin results in increased expression of SLC5A5 mRNA; Colforsin results in increased expression of SLC5A5 more ... CTD PMID:16954431 Slc5a5 Mouse cortisol multiple interactions ISO RGD:731751 6480464 1-Methyl-3-isobutylxanthine promotes the reaction [[Tretinoin co-treated with Hydrocortisone] affects the localization of SLC5A5 protein]; 1-Methyl-3-isobutylxanthine more ... CTD PMID:16439463 Slc5a5 Mouse Cuprizon increases expression ISO RGD:69267 6480464 Cuprizone results in increased expression of SLC5A5 mRNA CTD PMID:26577399 Slc5a5 Mouse cycloheximide increases expression ISO RGD:731751 6480464 Cycloheximide results in increased expression of SLC5A5 mRNA CTD PMID:17164311 Slc5a5 Mouse cyclosporin A decreases expression ISO RGD:69267 6480464 Cyclosporine results in decreased expression of SLC5A5 mRNA CTD PMID:21865292 Slc5a5 Mouse cypermethrin multiple interactions ISO RGD:731751 6480464 cypermethrin inhibits the reaction [SLC5A5 protein results in increased uptake of Iodine] CTD PMID:27979590 Slc5a5 Mouse decabromodiphenyl ether decreases expression ISO RGD:69267 6480464 decabromobiphenyl ether results in decreased expression of SLC5A5 mRNA CTD PMID:30844666 Slc5a5 Mouse depsipeptide increases expression ISO RGD:731751 6480464 Depsipeptides results in increased expression of SLC5A5 mRNA; Depsipeptides results in increased expression of SLC5A5 more ... CTD PMID:16954431 Slc5a5 Mouse dexamethasone multiple interactions ISO RGD:731751 6480464 [Dexamethasone co-treated with Tretinoin] results in increased expression of SLC5A5 mRNA; Dexamethasone promotes the reaction more ... CTD PMID:16234306|PMID:16954431 Slc5a5 Mouse dexamethasone decreases expression EXP 6480464 Dexamethasone results in decreased expression of SLC5A5 mRNA CTD PMID:22733784 Slc5a5 Mouse Di-n-octyl phthalate increases expression ISO RGD:69267 6480464 di-n-octyl phthalate results in increased expression of SLC5A5 mRNA CTD PMID:16257484 Slc5a5 Mouse Di-n-octyl phthalate increases expression ISO RGD:731751 6480464 di-n-octyl phthalate results in increased expression of SLC5A5 mRNA CTD PMID:16257484 Slc5a5 Mouse Dibutyl phosphate affects expression ISO RGD:731751 6480464 di-n-butylphosphoric acid affects the expression of SLC5A5 mRNA CTD PMID:37042841 Slc5a5 Mouse dibutyl phthalate decreases expression ISO RGD:731751 6480464 Dibutyl Phthalate results in decreased expression of SLC5A5 mRNA CTD PMID:16257484 Slc5a5 Mouse dibutyl phthalate multiple interactions ISO RGD:731751 6480464 Dibutyl Phthalate inhibits the reaction [SLC5A5 protein results in increased uptake of Iodine] CTD PMID:27979590 Slc5a5 Mouse diiodine multiple interactions ISO RGD:731751 6480464 2,2',4,4'-tetrabromodiphenyl ether inhibits the reaction [SLC5A5 protein results in increased uptake of Iodine]; 5-nitro-2-(3-phenylpropylamino)benzoic acid more ... CTD PMID:17967635|PMID:27979590 Slc5a5 Mouse diiodine increases uptake ISO RGD:731751 6480464 SLC5A5 protein results in increased uptake of Iodine CTD PMID:17332617|PMID:27979590 Slc5a5 Mouse diiodine increases uptake ISO RGD:69267 6480464 SLC5A5 protein results in increased uptake of Iodine CTD PMID:17408651 Slc5a5 Mouse diiodine affects transport ISO RGD:731751 6480464 SLC5A5 protein affects the transport of Iodine CTD PMID:12602914 Slc5a5 Mouse Diisodecyl phthalate increases expression ISO RGD:69267 6480464 diisodecyl phthalate results in increased expression of SLC5A5 mRNA CTD PMID:16257484 Slc5a5 Mouse Diisodecyl phthalate increases expression ISO RGD:731751 6480464 diisodecyl phthalate results in increased expression of SLC5A5 mRNA CTD PMID:16257484 Slc5a5 Mouse doxorubicin multiple interactions ISO RGD:731751 6480464 SLC5A5 protein promotes the reaction [Doxorubicin results in increased uptake of Sodium Pertechnetate Tc 99m] CTD PMID:15671536 Slc5a5 Mouse dysidenin multiple interactions ISO RGD:731751 6480464 dysidenin inhibits the reaction [SLC5A5 protein results in increased uptake of perrhenate analog]; dysidenin inhibits more ... CTD PMID:12488351 Slc5a5 Mouse efavirenz multiple interactions ISO RGD:731751 6480464 [efavirenz co-treated with TSHB protein] results in increased expression of SLC5A5 mRNA; [efavirenz co-treated with more ... CTD PMID:16030158 Slc5a5 Mouse elemental selenium increases expression ISO RGD:69267 6480464 Selenium results in increased expression of SLC5A5 mRNA CTD PMID:38013145 Slc5a5 Mouse elemental selenium multiple interactions ISO RGD:69267 6480464 Selenium inhibits the reaction [Potassium Iodide results in decreased expression of SLC5A5 mRNA] CTD PMID:38013145 Slc5a5 Mouse ethylparaben decreases expression ISO RGD:731751 6480464 ethyl-p-hydroxybenzoate results in decreased expression of SLC5A5 mRNA CTD PMID:37690743 Slc5a5 Mouse etoxazole multiple interactions ISO RGD:731751 6480464 etoxazole inhibits the reaction [SLC5A5 protein results in increased uptake of Iodides] CTD PMID:32065294 Slc5a5 Mouse etoxazole multiple interactions ISO RGD:69267 6480464 etoxazole inhibits the reaction [SLC5A5 protein results in increased uptake of Iodides] CTD PMID:32065294 Slc5a5 Mouse fipronil decreases expression ISO RGD:69267 6480464 fipronil results in decreased expression of SLC5A5 mRNA CTD PMID:23962444 Slc5a5 Mouse fipronil increases expression ISO RGD:69267 6480464 fipronil results in increased expression of SLC5A5 mRNA CTD PMID:31881178 Slc5a5 Mouse furan increases expression ISO RGD:69267 6480464 furan results in increased expression of SLC5A5 mRNA CTD PMID:25539665 Slc5a5 Mouse genistein increases expression ISO RGD:731751 6480464 Genistein results in increased expression of SLC5A5 mRNA CTD PMID:21738342 Slc5a5 Mouse glyphosate multiple interactions EXP 6480464 Melatonin inhibits the reaction [Glyphosate results in decreased expression of NIS mRNA] CTD PMID:33159990 Slc5a5 Mouse glyphosate increases expression ISO RGD:69267 6480464 Glyphosate results in increased expression of SLC5A5 mRNA CTD PMID:36462676 Slc5a5 Mouse glyphosate decreases expression EXP 6480464 Glyphosate results in decreased expression of NIS mRNA CTD PMID:33159990 Slc5a5 Mouse indometacin multiple interactions ISO RGD:731751 6480464 Indomethacin inhibits the reaction [SLC5A5 protein results in increased uptake of Iodine] CTD PMID:27979590 Slc5a5 Mouse iodide salt multiple interactions ISO RGD:731751 6480464 Dexamethasone promotes the reaction [SLC5A5 protein results in increased uptake of Iodides]; etoxazole inhibits the more ... CTD PMID:15671536|PMID:15850642|PMID:15941870|PMID:16234306|PMID:32065294 Slc5a5 Mouse iodide salt multiple interactions ISO RGD:69267 6480464 etoxazole inhibits the reaction [SLC5A5 protein results in increased uptake of Iodides]; mepanipyrim inhibits the more ... CTD PMID:32065294 Slc5a5 Mouse iodide salt increases uptake ISO RGD:69267 6480464 SLC5A5 protein results in increased uptake of Iodides CTD PMID:32065294 Slc5a5 Mouse iodide salt affects expression ISO RGD:69267 6480464 Iodides deficiency affects the expression of SLC5A5 mRNA CTD PMID:21623536 Slc5a5 Mouse iodide salt increases uptake ISO RGD:731751 6480464 SLC5A5 protein results in increased uptake of Iodides CTD PMID:15671536|PMID:15850642|PMID:15941870|PMID:16234306|PMID:32065294 Slc5a5 Mouse lead diacetate affects expression ISO RGD:69267 6480464 lead acetate affects the expression of SLC5A5 mRNA CTD PMID:21864555 Slc5a5 Mouse lead(0) decreases expression ISO RGD:69267 6480464 Lead results in decreased expression of SLC5A5 protein CTD PMID:33223335 Slc5a5 Mouse Licochalcone B increases expression ISO RGD:731751 6480464 licochalcone B results in increased expression of SLC5A5 mRNA CTD PMID:33647349 Slc5a5 Mouse LY294002 multiple interactions ISO RGD:731751 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [2,3',4,4',5-pentachlorobiphenyl results in decreased expression of SLC5A5 protein]; 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the more ... CTD PMID:20300827|PMID:25644787 Slc5a5 Mouse LY294002 increases expression ISO RGD:69267 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one results in increased expression of SLC5A5 mRNA CTD PMID:38013145 Slc5a5 Mouse LY294002 multiple interactions ISO RGD:69267 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [2-iodohexadecanal results in decreased expression of SLC5A5 mRNA]; 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the more ... CTD PMID:38013145 Slc5a5 Mouse mancozeb multiple interactions ISO RGD:731751 6480464 mancozeb inhibits the reaction [SLC5A5 protein results in increased uptake of Iodine] CTD PMID:27979590 Slc5a5 Mouse masoprocol multiple interactions ISO RGD:69267 6480464 Masoprocol inhibits the reaction [TSHB protein results in increased expression of SLC5A5 mRNA] CTD PMID:17962351 Slc5a5 Mouse melatonin multiple interactions EXP 6480464 Melatonin inhibits the reaction [Glyphosate results in decreased expression of NIS mRNA] CTD PMID:33159990 Slc5a5 Mouse mepanipyrim multiple interactions ISO RGD:731751 6480464 mepanipyrim inhibits the reaction [SLC5A5 protein results in increased uptake of Iodides] CTD PMID:32065294 Slc5a5 Mouse mepanipyrim multiple interactions ISO RGD:69267 6480464 mepanipyrim inhibits the reaction [SLC5A5 protein results in increased uptake of Iodides] CTD PMID:32065294 Slc5a5 Mouse mercaptopurine decreases expression ISO RGD:69267 6480464 Mercaptopurine results in decreased expression of SLC5A5 mRNA CTD PMID:23358152 Slc5a5 Mouse methimazole increases expression EXP 6480464 Methimazole results in increased expression of SLC5A5 protein CTD PMID:17332529 Slc5a5 Mouse methimazole increases expression ISO RGD:731751 6480464 Methimazole results in increased expression of SLC5A5 mRNA CTD PMID:22342233 Slc5a5 Mouse methimazole increases expression ISO RGD:69267 6480464 Methimazole results in increased expression of SLC5A5 mRNA CTD PMID:22342233 Slc5a5 Mouse methoxyfenozide multiple interactions ISO RGD:69267 6480464 methoxyfenozide inhibits the reaction [SLC5A5 protein results in increased uptake of Iodides] CTD PMID:32065294 Slc5a5 Mouse methoxyfenozide multiple interactions ISO RGD:731751 6480464 methoxyfenozide inhibits the reaction [SLC5A5 protein results in increased uptake of Iodides] CTD PMID:32065294 Slc5a5 Mouse metiram multiple interactions ISO RGD:731751 6480464 polymarcine inhibits the reaction [SLC5A5 protein results in increased uptake of Iodine] CTD PMID:27979590 Slc5a5 Mouse mibolerone multiple interactions ISO RGD:731751 6480464 mibolerone promotes the reaction [SLC5A5 protein results in increased uptake of Sodium Iodide]; perchlorate inhibits more ... CTD PMID:14633711 Slc5a5 Mouse mono(2-ethylhexyl) phthalate decreases expression ISO RGD:731751 6480464 mono-(2-ethylhexyl)phthalate results in decreased expression of SLC5A5 protein CTD PMID:36005737 Slc5a5 Mouse N-acetyl-L-cysteine multiple interactions ISO RGD:69267 6480464 Acetylcysteine inhibits the reaction [bisphenol A results in decreased expression of SLC5A5 mRNA] CTD PMID:30352396 Slc5a5 Mouse N-Vinyl-2-pyrrolidone multiple interactions ISO RGD:69267 6480464 [N-vinyl-2-pyrrolidinone binds to N-vinyl-2-pyrrolidinone] which affects the expression of SLC5A5 mRNA CTD PMID:22037397 Slc5a5 Mouse nevirapine multiple interactions ISO RGD:731751 6480464 [Nevirapine co-treated with TSHB protein] results in increased expression of SLC5A5 mRNA; [Nevirapine co-treated with more ... CTD PMID:16030158 Slc5a5 Mouse niclosamide multiple interactions ISO RGD:731751 6480464 Niclosamide inhibits the reaction [SLC5A5 protein results in increased uptake of Iodides] CTD PMID:32065294 Slc5a5 Mouse niclosamide multiple interactions ISO RGD:69267 6480464 Niclosamide inhibits the reaction [SLC5A5 protein results in increased uptake of Iodides] CTD PMID:32065294 Slc5a5 Mouse ouabain multiple interactions ISO RGD:731751 6480464 Ouabain inhibits the reaction [SLC5A5 protein results in increased uptake of Sodium Iodide] CTD PMID:12541134 Slc5a5 Mouse Oxyfluorfen multiple interactions ISO RGD:731751 6480464 oxyfluorofen inhibits the reaction [SLC5A5 protein results in increased uptake of Iodides] CTD PMID:32065294 Slc5a5 Mouse Oxyfluorfen multiple interactions ISO RGD:69267 6480464 oxyfluorofen inhibits the reaction [SLC5A5 protein results in increased uptake of Iodides] CTD PMID:32065294 Slc5a5 Mouse PCB138 multiple interactions EXP 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Slc5a5 Mouse perchlorate multiple interactions ISO RGD:731751 6480464 perchlorate inhibits the reaction [mibolerone promotes the reaction [SLC5A5 protein results in increased uptake of more ... CTD PMID:12601449|PMID:14633711|PMID:15347726|PMID:15850642|PMID:15941870 Slc5a5 Mouse perchlorate increases expression ISO RGD:69267 6480464 perchlorate results in increased expression of SLC5A5 mRNA CTD PMID:35385113 Slc5a5 Mouse perchlorate affects expression ISO RGD:69267 6480464 perchlorate affects the expression of SLC5A5 mRNA CTD PMID:21623536 Slc5a5 Mouse perchlorate decreases activity ISO RGD:69267 6480464 perchlorate results in decreased activity of SLC5A5 protein CTD PMID:16987991|PMID:35385113 Slc5a5 Mouse perchlorate increases expression EXP 6480464 perchlorate results in increased expression of SLC5A5 protein CTD PMID:17332529 Slc5a5 Mouse perfluorohexanesulfonic acid multiple interactions ISO RGD:69267 6480464 perfluorohexanesulfonic acid inhibits the reaction [SLC5A5 protein results in increased uptake of Iodides] CTD PMID:32065294 Slc5a5 Mouse perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:69267 6480464 perfluorooctane sulfonic acid inhibits the reaction [SLC5A5 protein results in increased uptake of Iodides] CTD PMID:32065294 Slc5a5 Mouse phenobarbital increases expression ISO RGD:69267 6480464 Phenobarbital results in increased expression of SLC5A5 mRNA CTD PMID:22037397 Slc5a5 Mouse potassium iodide decreases expression ISO RGD:69267 6480464 Potassium Iodide results in decreased expression of SLC5A5 mRNA CTD PMID:38013145 Slc5a5 Mouse potassium iodide multiple interactions ISO RGD:69267 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [Potassium Iodide results in decreased expression of SLC5A5 mRNA]; 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide inhibits more ... CTD PMID:27568464|PMID:38013145 Slc5a5 Mouse purine-6-thiol decreases expression ISO RGD:69267 6480464 Mercaptopurine results in decreased expression of SLC5A5 mRNA CTD PMID:23358152 Slc5a5 Mouse quercetin affects expression ISO RGD:731751 6480464 Quercetin affects the expression of SLC5A5 mRNA CTD PMID:21738342 Slc5a5 Mouse quercetin decreases expression ISO RGD:69267 6480464 Quercetin results in decreased expression of SLC5A5 mRNA; Quercetin results in decreased expression of SLC5A5 more ... CTD PMID:24447974 Slc5a5 Mouse quercetin multiple interactions ISO RGD:69267 6480464 Quercetin inhibits the reaction [TSHB protein results in increased expression of SLC5A5 mRNA] CTD PMID:17962351 Slc5a5 Mouse resveratrol decreases expression ISO RGD:69267 6480464 resveratrol results in decreased expression of SLC5A5; resveratrol results in decreased expression of SLC5A5 protein CTD PMID:28668442 Slc5a5 Mouse resveratrol increases expression ISO RGD:731751 6480464 resveratrol results in increased expression of SLC5A5 mRNA CTD PMID:21738342|PMID:23594881 Slc5a5 Mouse resveratrol multiple interactions ISO RGD:731751 6480464 NOTCH1 mutant form inhibits the reaction [resveratrol results in increased expression of SLC5A5 mRNA] CTD PMID:23594881 Slc5a5 Mouse SB 431542 multiple interactions ISO RGD:69267 6480464 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide inhibits the reaction [Potassium Iodide results in decreased expression of SLC5A5 mRNA] CTD PMID:38013145 Slc5a5 Mouse selenium atom increases expression ISO RGD:69267 6480464 Selenium results in increased expression of SLC5A5 mRNA CTD PMID:38013145 Slc5a5 Mouse selenium atom multiple interactions ISO RGD:69267 6480464 Selenium inhibits the reaction [Potassium Iodide results in decreased expression of SLC5A5 mRNA] CTD PMID:38013145 Slc5a5 Mouse sodium bromide multiple interactions ISO RGD:731751 6480464 sodium bromide inhibits the reaction [SLC5A5 protein results in increased uptake of perrhenate analog]; sodium more ... CTD PMID:12488351 Slc5a5 Mouse sodium chlorate multiple interactions ISO RGD:731751 6480464 sodium chlorate inhibits the reaction [SLC5A5 protein results in increased uptake of perrhenate analog]; sodium more ... CTD PMID:12488351 Slc5a5 Mouse sodium iodide decreases export ISO RGD:731751 6480464 SLC5A5 protein results in decreased export of Sodium Iodide CTD PMID:15347726|PMID:15522214 Slc5a5 Mouse sodium iodide increases uptake ISO RGD:731751 6480464 SLC5A5 protein results in increased uptake of Sodium Iodide CTD PMID:12488351|PMID:12489024|PMID:12541134|PMID:12601449|PMID:14633711|PMID:15522214|PMID:17611400 Slc5a5 Mouse sodium iodide increases uptake ISO RGD:69267 6480464 SLC5A5 protein results in increased uptake of Sodium Iodide CTD PMID:12489024|PMID:15520214 Slc5a5 Mouse sodium iodide multiple interactions ISO RGD:731751 6480464 4,4'-Diisothiocyanostilbene-2,2'-Disulfonic Acid promotes the reaction [SLC5A5 protein results in increased uptake of Sodium Iodide]; dysidenin more ... CTD PMID:12488351|PMID:12489024|PMID:12541134|PMID:12601449|PMID:14633711|PMID:15347726|PMID:15522214|PMID:17611400 Slc5a5 Mouse sodium iodide multiple interactions ISO RGD:69267 6480464 sodium perchlorate inhibits the reaction [SLC5A5 protein results in increased uptake of Sodium Iodide] CTD PMID:12489024|PMID:15520214 Slc5a5 Mouse sodium iodide increases activity ISO RGD:69267 6480464 Sodium Iodide results in increased activity of SLC5A5 protein CTD PMID:16987991 Slc5a5 Mouse sodium iodide increases abundance ISO RGD:731751 6480464 SLC5A5 protein results in increased abundance of Sodium Iodide CTD PMID:15347726 Slc5a5 Mouse sodium perchlorate decreases activity ISO RGD:69267 6480464 sodium perchlorate results in decreased activity of SLC5A5 protein CTD PMID:26827900 Slc5a5 Mouse sodium perchlorate increases expression ISO RGD:69267 6480464 sodium perchlorate results in increased expression of SLC5A5 mRNA; sodium perchlorate results in increased expression more ... CTD PMID:29139221 Slc5a5 Mouse sodium perchlorate multiple interactions ISO RGD:69267 6480464 sodium perchlorate inhibits the reaction [SLC5A5 protein results in increased uptake of Sodium Iodide] CTD PMID:12489024|PMID:15520214 Slc5a5 Mouse sodium perchlorate multiple interactions ISO RGD:731751 6480464 sodium perchlorate inhibits the reaction [SLC5A5 protein results in increased uptake of Iodine]; sodium perchlorate more ... CTD PMID:12488351|PMID:12489024|PMID:12541134|PMID:15221289|PMID:27979590 Slc5a5 Mouse sodium thiocyanate multiple interactions ISO RGD:731751 6480464 sodium thiocyanate inhibits the reaction [SLC5A5 protein results in increased uptake of Iodine]; sodium thiocyanate more ... CTD PMID:12488351|PMID:27979590 Slc5a5 Mouse tazarotene increases expression ISO RGD:731751 6480464 tazarotene results in increased expression of SLC5A5 mRNA CTD PMID:16954431 Slc5a5 Mouse tebuconazole decreases expression ISO RGD:731751 6480464 tebuconazole results in decreased expression of SLC5A5 mRNA CTD PMID:30458266 Slc5a5 Mouse technetium atom increases uptake ISO RGD:731751 6480464 SLC5A5 protein results in increased uptake of Technetium CTD PMID:15221289 Slc5a5 Mouse technetium atom multiple interactions ISO RGD:731751 6480464 sodium perchlorate inhibits the reaction [SLC5A5 protein results in increased uptake of Technetium] CTD PMID:15221289 Slc5a5 Mouse tetraoxorhenate(1-) multiple interactions ISO RGD:731751 6480464 dysidenin inhibits the reaction [SLC5A5 protein results in increased uptake of perrhenate analog]; perrhenate inhibits more ... CTD PMID:12488351 Slc5a5 Mouse tetraoxorhenate(1-) increases uptake ISO RGD:731751 6480464 SLC5A5 protein results in increased uptake of perrhenate; SLC5A5 protein results in increased uptake of more ... CTD PMID:12488351|PMID:15347726 Slc5a5 Mouse theophylline increases expression ISO RGD:731751 6480464 Theophylline results in increased expression of SLC5A5 protein CTD PMID:19409042 Slc5a5 Mouse thioacetamide increases expression ISO RGD:69267 6480464 Thioacetamide results in increased expression of SLC5A5 mRNA CTD PMID:34492290 Slc5a5 Mouse thiocyanate multiple interactions ISO RGD:731751 6480464 thiocyanate inhibits the reaction [SLC5A5 protein results in increased uptake of Iodides] CTD PMID:15850642 Slc5a5 Mouse thiocyanate affects transport ISO RGD:731751 6480464 SLC5A5 protein affects the transport of thiocyanate CTD PMID:15345749 Slc5a5 Mouse thiram increases expression ISO RGD:731751 6480464 Thiram results in increased expression of SLC5A5 mRNA CTD PMID:38568856 Slc5a5 Mouse thyroxine decreases expression EXP 6480464 Thyroxine results in decreased expression of SLC5A5 protein CTD PMID:17332529 Slc5a5 Mouse trichloroethene decreases expression ISO RGD:69267 6480464 Trichloroethylene results in decreased expression of SLC5A5 mRNA CTD PMID:33387578 Slc5a5 Mouse trichostatin A increases expression ISO RGD:731751 6480464 trichostatin A results in increased expression of SLC5A5 mRNA; trichostatin A results in increased expression more ... CTD PMID:16954431 Slc5a5 Mouse triclocarban decreases activity ISO RGD:69267 6480464 triclocarban results in decreased activity of SLC5A5 protein CTD PMID:26827900 Slc5a5 Mouse triclocarban multiple interactions ISO RGD:69267 6480464 triclocarban inhibits the reaction [SLC5A5 protein results in increased uptake of Iodides] CTD PMID:32065294 Slc5a5 Mouse triclocarban multiple interactions ISO RGD:731751 6480464 triclocarban inhibits the reaction [SLC5A5 protein results in increased uptake of Iodides]; triclocarban inhibits the more ... CTD PMID:27979590|PMID:32065294 Slc5a5 Mouse triclosan decreases activity ISO RGD:69267 6480464 Triclosan results in decreased activity of SLC5A5 protein CTD PMID:26827900 Slc5a5 Mouse triphenyl phosphate increases expression ISO RGD:69267 6480464 triphenyl phosphate results in increased expression of SLC5A5 mRNA CTD PMID:25646720 Slc5a5 Mouse triptonide increases expression EXP 6480464 triptonide results in increased expression of SLC5A5 mRNA CTD PMID:33045310 Slc5a5 Mouse troglitazone multiple interactions ISO RGD:731751 6480464 [troglitazone co-treated with Tretinoin] results in increased expression of SLC5A5 mRNA CTD PMID:16954431 Slc5a5 Mouse troglitazone increases expression ISO RGD:731751 6480464 troglitazone results in increased expression of SLC5A5 mRNA CTD PMID:15785241|PMID:16954431 Slc5a5 Mouse valproic acid increases expression ISO RGD:731751 6480464 Valproic Acid results in increased expression of SLC5A5 mRNA; Valproic Acid results in increased expression more ... CTD PMID:16954431 Slc5a5 Mouse valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of SLC5A5 mRNA CTD PMID:19136453|PMID:21427059 Slc5a5 Mouse vemurafenib multiple interactions ISO RGD:731751 6480464 [BRAF protein mutant form affects the susceptibility to vemurafenib] which affects the expression of SLC5A5 more ... CTD PMID:26751190 Slc5a5 Mouse vorinostat increases expression ISO RGD:731751 6480464 vorinostat results in increased expression of SLC5A5 mRNA CTD PMID:26751190 Slc5a5 Mouse vorinostat multiple interactions ISO RGD:731751 6480464 [vemurafenib co-treated with vorinostat] results in increased expression of SLC5A5 protein; BRAF protein mutant form more ... CTD PMID:26751190 Slc5a5 Mouse wortmannin multiple interactions ISO RGD:731751 6480464 wortmannin inhibits the reaction [Carbamazepine promotes the reaction [Tretinoin results in increased expression of SLC5A5 more ... CTD PMID:20300827
Imported Annotations - SMPDB
1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (EXP) 1,3-benzothiazole-2-thiol (ISO) 17beta-estradiol (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (EXP) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,2',5,5'-tetrachlorobiphenyl (EXP) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,4'-trichlorobiphenyl (EXP) 3,3',5,5'-tetrabromobisphenol A (EXP) 3,3',5-triiodo-L-thyronine (EXP) 3,7-dihydropurine-6-thione (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-diisothiocyano-trans-stilbene-2,2'-disulfonic acid (ISO) 4,4'-sulfonyldiphenol (EXP) 5-aza-2'-deoxycytidine (ISO) 5-azacytidine (ISO) 5-Nitro-2-(3-phenylpropylamino)benzoic acid (ISO) 6-propyl-2-thiouracil (ISO) 9-cis-retinoic acid (ISO) acrylamide (ISO) adenosine (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) alpha-naphthoflavone (ISO) amiodarone (ISO) ammonium chloride (ISO) ATP (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) Benzo[ghi]perylene (EXP) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) Butylbenzyl phthalate (ISO) carbamazepine (ISO) chlorpyrifos (EXP) cisplatin (EXP) cobalt dichloride (ISO) colforsin daropate hydrochloride (ISO) cortisol (ISO) Cuprizon (ISO) cycloheximide (ISO) cyclosporin A (ISO) cypermethrin (ISO) decabromodiphenyl ether (ISO) depsipeptide (ISO) dexamethasone (EXP,ISO) Di-n-octyl phthalate (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (ISO) diiodine (ISO) Diisodecyl phthalate (ISO) doxorubicin (ISO) dysidenin (ISO) efavirenz (ISO) elemental selenium (ISO) ethylparaben (ISO) etoxazole (ISO) fipronil (ISO) furan (ISO) genistein (ISO) glyphosate (EXP,ISO) indometacin (ISO) iodide salt (ISO) lead diacetate (ISO) lead(0) (ISO) Licochalcone B (ISO) LY294002 (ISO) mancozeb (ISO) masoprocol (ISO) melatonin (EXP) mepanipyrim (ISO) mercaptopurine (ISO) methimazole (EXP,ISO) methoxyfenozide (ISO) metiram (ISO) mibolerone (ISO) mono(2-ethylhexyl) phthalate (ISO) N-acetyl-L-cysteine (ISO) N-Vinyl-2-pyrrolidone (ISO) nevirapine (ISO) niclosamide (ISO) ouabain (ISO) Oxyfluorfen (ISO) PCB138 (EXP) perchlorate (EXP,ISO) perfluorohexanesulfonic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (ISO) potassium iodide (ISO) purine-6-thiol (ISO) quercetin (ISO) resveratrol (ISO) SB 431542 (ISO) selenium atom (ISO) sodium bromide (ISO) sodium chlorate (ISO) sodium iodide (ISO) sodium perchlorate (ISO) sodium thiocyanate (ISO) tazarotene (ISO) tebuconazole (ISO) technetium atom (ISO) tetraoxorhenate(1-) (ISO) theophylline (ISO) thioacetamide (ISO) thiocyanate (ISO) thiram (ISO) thyroxine (EXP) trichloroethene (ISO) trichostatin A (ISO) triclocarban (ISO) triclosan (ISO) triphenyl phosphate (ISO) triptonide (EXP) troglitazone (ISO) valproic acid (EXP,ISO) vemurafenib (ISO) vorinostat (ISO) wortmannin (ISO)
References
Additional References at PubMed
Genomics
Comparative Map Data
Slc5a5 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 71,335,529 - 71,345,429 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 71,335,533 - 71,345,401 (-) Ensembl GRCm39 Ensembl GRCm38 8 70,882,885 - 70,892,785 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 70,882,889 - 70,892,757 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 73,406,788 - 73,416,656 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 73,812,491 - 73,821,713 (-) NCBI MGSCv36 mm8 Celera 8 73,444,192 - 73,454,060 (-) NCBI Celera Cytogenetic Map 8 B3.3 NCBI cM Map 8 34.36 NCBI
SLC5A5 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 19 17,871,945 - 17,895,174 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 19 17,871,945 - 17,895,174 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 19 17,982,754 - 18,005,983 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 19 17,843,782 - 17,865,897 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 19 17,843,781 - 17,865,897 NCBI Celera 19 17,884,497 - 17,907,699 (+) NCBI Celera Cytogenetic Map 19 p13.11 NCBI HuRef 19 17,548,153 - 17,571,202 (+) NCBI HuRef CHM1_1 19 17,982,521 - 18,005,714 (+) NCBI CHM1_1 T2T-CHM13v2.0 19 18,005,850 - 18,029,260 (+) NCBI T2T-CHM13v2.0
Slc5a5 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 16 18,580,705 - 18,590,692 (+) NCBI GRCr8 mRatBN7.2 16 18,546,709 - 18,556,698 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 16 18,546,709 - 18,556,697 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 16 18,588,940 - 18,598,864 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 16 19,721,618 - 19,731,542 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 16 18,641,881 - 18,651,805 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 16 20,297,414 - 20,307,401 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 16 20,297,414 - 20,307,400 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 16 20,154,958 - 20,164,945 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 16 19,046,200 - 19,056,281 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 16 19,046,197 - 19,056,301 (+) NCBI Celera 16 18,739,349 - 18,749,322 (+) NCBI Celera Cytogenetic Map 16 p14 NCBI
Slc5a5 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955524 3,372,539 - 3,380,758 (-) NCBI ChiLan1.0 ChiLan1.0
SLC5A5 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 20 22,734,367 - 22,760,028 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 19 21,741,167 - 21,769,744 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 19 17,352,635 - 17,377,130 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 19 18,327,410 - 18,344,480 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 19 18,327,410 - 18,344,480 (+) Ensembl panpan1.1 panPan2
SLC5A5 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 20 45,017,939 - 45,030,598 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 20 45,018,119 - 45,030,209 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 20 44,930,090 - 44,942,416 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 20 45,502,644 - 45,514,972 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 20 45,502,824 - 45,514,917 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 20 44,739,503 - 44,751,827 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 20 45,149,996 - 45,162,311 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 20 45,425,947 - 45,438,272 (-) NCBI UU_Cfam_GSD_1.0
Slc5a5 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 203,623,144 - 203,639,908 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936596 3,177,422 - 3,188,637 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936596 3,176,009 - 3,188,637 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
SLC5A5 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 59,869,155 - 59,885,266 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 59,869,157 - 59,885,086 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 59,438,591 - 59,454,519 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SLC5A5
Slc5a5
.
miRNA Target Status (No longer updated)
Predicted Target Of
Count of predictions: 367 Count of miRNA genes: 272 Interacting mature miRNAs: 306 Transcripts: ENSMUST00000000809 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
QTLs in Region (GRCm39)
1558870 Eae36_m experimental allergic encephalomyelitis susceptibility 36 (mouse) Not determined 8 14773160 71498244 Mouse 10043992 Hbnr11_m Heligmosomoides bakeri nematode resistance 11 (mouse) Not determined 8 66326836 100326976 Mouse 4141437 W10q14_m weight 10 weeks QTL 14 (mouse) Not determined 32506572 71740637 Mouse 1301013 Capsq4_m capsaicin sensitivity related QTL 4 (mouse) Not determined 8 36630154 93455280 Mouse 1301717 Adip4_m adiposity 4 (mouse) Not determined 8 48090064 82090180 Mouse 1357715 Alaa3_m alopecia areata 3 (mouse) Not determined 8 49245591 83245673 Mouse 11353828 Gf7_m gonadal fat pad weight 7 (mouse) 8 58928107 92928107 Mouse 14746987 Manh64_m mandible shape 64 (mouse) 8 50505958 84505958 Mouse 4141172 W6q9_m weight 6 weeks QTL 9 (mouse) Not determined 32506572 71740637 Mouse 1558875 Eae31_m experimental allergic encephalomyelitis susceptibility 31 (mouse) Not determined 8 35109930 115563747 Mouse 1357787 Vtbt5_m vertebral trabecular bone trait 5 (mouse) Not determined 8 66084397 100084549 Mouse 10766453 Char11_m P. chabaudi malaria resistance QTL 11 (mouse) 8 48090064 82090180 Mouse 1301506 Aevm1_m autoimmune extremity vasculitis in MRL mice 1 (mouse) Not determined 8 54740461 88740637 Mouse 1301441 Skull11_m skull morphology 11 (mouse) Not determined 8 48190168 82190288 Mouse 1301952 Im3_m immunoregulatory 3 (mouse) Not determined 8 55159258 89159407 Mouse 1301767 Fcsa2_m femoral cross-sectional area 2 (mouse) Not determined 8 71032003 105032123 Mouse 4140967 Bmd39_m bone mineral density 39 (mouse) Not determined 8 32506572 117965439 Mouse 4140966 Egq12_m early growth QTL 12 (mouse) Not determined 32506572 71740637 Mouse 4141285 Tgq18_m triglyceride QTL 18 (mouse) Not determined 64186736 98186736 Mouse 4141797 Skmw16_m skeletal muscle weight 16 (mouse) Not determined 8 64666176 98666325 Mouse 14747005 Mancz7_m mandible centroid size 7 (mouse) 8 50505958 84505958 Mouse 27226754 Femd6_m femur midshaft diameter 6, 10 week (mouse) 8 37867154 110326632 Mouse 10043975 Obq31_m obesity QTL 31 (mouse) Not determined 8 59136404 93136404 Mouse 10412287 Carg3_m Candida albicans resistance gene 3 (mouse) Not determined 8 56298872 90298872 Mouse 10766466 Char12_m P. chabaudi malaria resistance QTL 12 (mouse) 8 68722479 83326976 Mouse 1357811 Orq3_m ovulation rate QTL 3 (mouse) Not determined 8 32506572 71740637 Mouse 11039503 Ccc4_m colitis susceptibility in the Collaborative Cross 4 (mouse) 8 65174237 78002730 Mouse 1301688 Orch6_m autoimmune orchitis resistance 6 (mouse) Not determined 8 61513479 95513605 Mouse 12904744 Carcdq1_m cardiac collagen deposition QTL 1 (mouse) 8 40162297 95416226 Mouse 14700686 Civq3_m cerebral infarct volume QTL 3 (mouse) 8 52334843 86334843 Mouse 4142283 Imraq2_m immune response to AAV2 QTL 2 (mouse) Not determined 8 71032003 105032123 Mouse 1301544 Iba3_m induction of brown adipocytes 3 (mouse) Not determined 8 44747914 78748059 Mouse
Markers in Region
Slc5a5
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 8 C1 UniSTS cM Map 8 34.36 UniSTS
Expression
RNA-SEQ Expression
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Sequence
Ensembl Acc Id:
ENSMUST00000000809 ⟹ ENSMUSP00000000809
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 71,335,533 - 71,345,401 (-) Ensembl GRCm38.p6 Ensembl 8 70,882,889 - 70,892,757 (-) Ensembl
RefSeq Acc Id:
NM_053248 ⟹ NP_444478
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 71,335,533 - 71,345,401 (-) NCBI GRCm38 8 70,882,889 - 70,892,757 (-) NCBI MGSCv37 8 73,406,788 - 73,416,656 (-) RGD Celera 8 73,444,192 - 73,454,060 (-) RGD cM Map 8 ENTREZGENE
Sequence:
GGTCGACGGCCCAGCAGGAACTCGCGCTGCGACGACGCTCGCTCTGAGAGTCCCCGACGTCCTCCGCATCCTCTCCGTTCCGAGTTACCTGTCTCCATGGAGGGCGCGGAGGCAGGGGCCCGGGCCAC
hide sequence
RefSeq Acc Id:
XM_006509537 ⟹ XP_006509600
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 71,335,529 - 71,345,428 (-) NCBI GRCm38 8 70,882,885 - 70,892,784 (-) NCBI
Sequence:
ATAAATCCGCCGCGCGAAAAGCTTGTGGGTCGACGGCCCAGCAGGAACTCGCGCTGCGACGACGCTCGCTCTGAGAGTCCCCGACGTCCTCCGCATCCTCTCCGTTCCGAGTTACCTGTCTCCATGGA
hide sequence
RefSeq Acc Id:
XR_870460
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 71,341,192 - 71,345,429 (-) NCBI GRCm38 8 70,888,548 - 70,892,785 (-) NCBI
Sequence:
AATAAATCCGCCGCGCGAAAAGCTTGTGGGTCGACGGCCCAGCAGGAACTCGCGCTGCGACGACGCTCGCTCTGAGAGTCCCCGACGTCCTCCGCATCCTCTCCGTTCCGAGTTACCTGTCTCCATGG
hide sequence
RefSeq Acc Id:
NP_444478 ⟸ NM_053248
- UniProtKB:
Q99PN0 (UniProtKB/Swiss-Prot), B2RPX6 (UniProtKB/Swiss-Prot), G3X8P5 (UniProtKB/TrEMBL)
- Sequence:
MEGAEAGARATFGPWDYGVFATMLLVSTGIGLWVGLARGGQRSADDFFTGGRQLAAVPVGLSLAASFMSAVQVLGVPAEAARYGLKFLWMCVGQLLNSLLTALLFLPIFYRLGLTSTYQYLELRFSRA
hide sequence
RefSeq Acc Id:
XP_006509600 ⟸ XM_006509537
- Peptide Label:
isoform X1
- UniProtKB:
Q99PN0 (UniProtKB/Swiss-Prot), B2RPX6 (UniProtKB/Swiss-Prot)
- Sequence:
MEGAEAGARATFGPWDYGVFATMLLVSTGIGLWVGLARGGQRSADDFFTGGRQLAAVPVGLSLAASFMSAVQVLGVPAEAARYGLKFLWMCVGQLLNSLLTALLFLPIFYRLGLTSTYQMLYTGIVIY
hide sequence
Ensembl Acc Id:
ENSMUSP00000000809 ⟸ ENSMUST00000000809
Promoters
RGD ID: 8667365 Promoter ID: EPDNEW_M11714 Type: single initiation site Name: Slc5a5_1 Description: Mus musculus solute carrier family 5 , member 5 , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 8 70,892,756 - 70,892,816 EPDNEW
RGD ID: 6843735 Promoter ID: MM_KWN:54755 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day4, 3T3L1_Day6, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen Transcripts: NM_053248 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 8 73,416,516 - 73,417,647 (-) MPROMDB
Additional Information
