Symbol:
Plppr4
Name:
phospholipid phosphatase related 4
RGD ID:
727806
Description:
Enables lipid phosphatase activity and lysophosphatidic acid phosphatase activity. Involved in axonogenesis and phospholipid dephosphorylation. Located in external side of plasma membrane. Orthologous to human PLPPR4 (phospholipid phosphatase related 4); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; acrylamide; alpha-Zearalanol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
2-lysophosphatidate phosphatase PLPPR4; brain-specific phosphatidic acid phosphatase-like protein 1; inactive 2-lysophosphatidate phosphatase PLPPR4; lipid phosphate phosphatase-related protein type 4; Lppr4; phospholipid phosphatase-related protein type 4; plasticity related gene 1; plasticity-related gene 1; Prg-1; Prg1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 208,056,206 - 208,097,191 (-) NCBI GRCr8 mRatBN7.2 2 205,371,317 - 205,412,302 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 205,371,322 - 205,412,302 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 213,018,609 - 213,059,602 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 210,933,198 - 210,974,196 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 205,751,648 - 205,792,638 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 220,298,239 - 220,341,863 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 220,298,245 - 220,341,866 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 238,365,252 - 238,405,892 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 213,686,578 - 213,727,831 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 213,649,335 - 213,690,585 (-) NCBI Celera 2 197,848,561 - 197,889,304 (-) NCBI Celera Cytogenetic Map 2 q42 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Plppr4 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of PLPPR4 mRNA CTD PMID:21215274 Plppr4 Rat 4,4'-sulfonyldiphenol decreases methylation ISO RGD:1616551 6480464 bisphenol S results in decreased methylation of PLPPR4 exon CTD PMID:33297965 Plppr4 Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of PLPPR4 mRNA CTD PMID:28959563 Plppr4 Rat all-trans-retinoic acid decreases expression ISO RGD:1605099 6480464 Tretinoin results in decreased expression of PLPPR4 mRNA CTD PMID:23724009 Plppr4 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of PLPPR4 mRNA CTD PMID:35163327 Plppr4 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of PLPPR4 mRNA CTD PMID:38685447 Plppr4 Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of PLPPR4 gene CTD PMID:35440735 Plppr4 Rat benzo[a]pyrene increases methylation ISO RGD:1605099 6480464 Benzo(a)pyrene results in increased methylation of PLPPR4 exon CTD PMID:27901495 Plppr4 Rat benzo[a]pyrene affects methylation ISO RGD:1605099 6480464 Benzo(a)pyrene affects the methylation of PLPPR4 3' UTR; Benzo(a)pyrene affects the methylation of PLPPR4 promoter CTD PMID:27901495 Plppr4 Rat benzo[a]pyrene diol epoxide I increases expression ISO RGD:1605099 6480464 7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in increased expression of PLPPR4 mRNA CTD PMID:20382639 Plppr4 Rat bis(2-ethylhexyl) phthalate decreases expression ISO RGD:1605099 6480464 Diethylhexyl Phthalate results in decreased expression of PLPPR4 mRNA CTD PMID:31163220 Plppr4 Rat bis(2-ethylhexyl) phthalate increases expression ISO RGD:1616551 6480464 Diethylhexyl Phthalate results in increased expression of PLPPR4 mRNA CTD PMID:33162236 Plppr4 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PLPPR4 mRNA CTD PMID:25181051|PMID:30816183|PMID:34947998 Plppr4 Rat bisphenol A increases expression ISO RGD:1605099 6480464 bisphenol A results in increased expression of PLPPR4 mRNA CTD PMID:29275510 Plppr4 Rat cadmium atom multiple interactions ISO RGD:1605099 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of PLPPR4 more ... CTD PMID:35301059 Plppr4 Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of PLPPR4 mRNA CTD PMID:33453195 Plppr4 Rat cadmium dichloride multiple interactions ISO RGD:1605099 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of PLPPR4 more ... CTD PMID:35301059 Plppr4 Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of PLPPR4 mRNA CTD PMID:26577399 Plppr4 Rat decabromodiphenyl ether decreases expression EXP 6480464 decabromobiphenyl ether results in decreased expression of PLPPR4 mRNA CTD PMID:23640034 Plppr4 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of PLPPR4 mRNA CTD PMID:21266533 Plppr4 Rat dorsomorphin multiple interactions ISO RGD:1605099 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Plppr4 Rat doxorubicin decreases expression ISO RGD:1605099 6480464 Doxorubicin results in decreased expression of PLPPR4 mRNA CTD PMID:29803840 Plppr4 Rat ethanol affects splicing ISO RGD:1616551 6480464 Ethanol affects the splicing of PLPPR4 mRNA CTD PMID:30319688 Plppr4 Rat ferric oxide decreases expression EXP 6480464 ferric oxide analog results in decreased expression of PLPPR4 mRNA CTD PMID:38615722 Plppr4 Rat flurotyl increases expression EXP 6480464 Flurothyl results in increased expression of PLPPR4 protein CTD PMID:20167268 Plppr4 Rat folic acid decreases expression ISO RGD:1616551 6480464 Folic Acid results in decreased expression of PLPPR4 mRNA CTD PMID:25629700 Plppr4 Rat geldanamycin increases expression ISO RGD:1605099 6480464 geldanamycin results in increased expression of PLPPR4 mRNA CTD PMID:26705709 Plppr4 Rat iron dichloride decreases expression ISO RGD:1605099 6480464 ferrous chloride results in decreased expression of PLPPR4 mRNA CTD PMID:35984750 Plppr4 Rat lead(0) affects expression ISO RGD:1605099 6480464 Lead affects the expression of PLPPR4 mRNA CTD PMID:28903495 Plppr4 Rat mercury atom increases expression ISO RGD:1605099 6480464 Mercury results in increased expression of PLPPR4 mRNA CTD PMID:16823088 Plppr4 Rat mercury(0) increases expression ISO RGD:1605099 6480464 Mercury results in increased expression of PLPPR4 mRNA CTD PMID:16823088 Plppr4 Rat methotrexate decreases expression ISO RGD:1605099 6480464 Methotrexate results in decreased expression of PLPPR4 mRNA CTD PMID:17400583 Plppr4 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of PLPPR4 gene CTD PMID:35440735 Plppr4 Rat methylmercury chloride decreases expression ISO RGD:1605099 6480464 methylmercuric chloride results in decreased expression of PLPPR4 mRNA CTD PMID:28001369 Plppr4 Rat N,N-diethyl-m-toluamide multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in increased methylation of PLPPR4 gene CTD PMID:33148267 Plppr4 Rat ozone multiple interactions ISO RGD:1616551 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased more ... CTD PMID:34911549 Plppr4 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of PLPPR4 mRNA CTD PMID:35163327 Plppr4 Rat permethrin multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in increased methylation of PLPPR4 gene CTD PMID:33148267 Plppr4 Rat permethrin decreases expression ISO RGD:1605099 6480464 Permethrin results in decreased expression of PLPPR4 mRNA CTD PMID:37047231 Plppr4 Rat phenylmercury acetate decreases expression ISO RGD:1605099 6480464 Phenylmercuric Acetate results in decreased expression of PLPPR4 mRNA CTD PMID:26272509 Plppr4 Rat phenylmercury acetate multiple interactions ISO RGD:1605099 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Plppr4 Rat poly(I:C) multiple interactions EXP 6480464 [Poly I-C co-treated with HU 211] results in decreased expression of PLPPR4 mRNA CTD PMID:26923065 Plppr4 Rat SB 431542 multiple interactions ISO RGD:1605099 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Plppr4 Rat sodium arsenite decreases expression ISO RGD:1605099 6480464 sodium arsenite results in decreased expression of PLPPR4 mRNA CTD PMID:25879800 Plppr4 Rat sodium arsenite increases expression ISO RGD:1605099 6480464 sodium arsenite results in increased expression of PLPPR4 mRNA CTD PMID:22714537 Plppr4 Rat sodium arsenite decreases methylation ISO RGD:1605099 6480464 sodium arsenite results in decreased methylation of PLPPR4 gene CTD PMID:24570342 Plppr4 Rat titanium dioxide increases methylation ISO RGD:1616551 6480464 titanium dioxide results in increased methylation of PLPPR4 gene CTD PMID:35295148 Plppr4 Rat triadimefon decreases expression ISO RGD:1605099 6480464 triadimefon results in decreased expression of PLPPR4 mRNA CTD PMID:26705709 Plppr4 Rat trichostatin A increases expression ISO RGD:1605099 6480464 trichostatin A results in increased expression of PLPPR4 mRNA CTD PMID:24935251|PMID:26705709 Plppr4 Rat trichostatin A decreases expression ISO RGD:1605099 6480464 trichostatin A results in decreased expression of PLPPR4 mRNA CTD PMID:24935251 Plppr4 Rat triptonide increases expression ISO RGD:1616551 6480464 triptonide results in increased expression of PLPPR4 mRNA CTD PMID:33045310 Plppr4 Rat valproic acid increases expression ISO RGD:1605099 6480464 Valproic Acid results in increased expression of PLPPR4 mRNA CTD PMID:24935251|PMID:26705709 Plppr4 Rat valproic acid decreases methylation ISO RGD:1605099 6480464 Valproic Acid results in decreased methylation of PLPPR4 gene CTD PMID:29154799
Biological Process
axonogenesis (IBA,IDA) G protein-coupled receptor signaling pathway (IEA,ISO,ISS) inner ear development (IEA,ISO) lipid import into cell (IEA,ISO,ISS) modulation of chemical synaptic transmission (IEA,ISO) phospholipid dephosphorylation (IBA,IDA,ISO) phospholipid metabolic process (IBA,IEA) regulation of postsynapse organization (IEA,ISO) regulation of synaptic transmission, glutamatergic (IEA,ISO,ISS) signal transduction (IBA)
Plppr4 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 208,056,206 - 208,097,191 (-) NCBI GRCr8 mRatBN7.2 2 205,371,317 - 205,412,302 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 205,371,322 - 205,412,302 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 213,018,609 - 213,059,602 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 210,933,198 - 210,974,196 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 205,751,648 - 205,792,638 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 220,298,239 - 220,341,863 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 220,298,245 - 220,341,866 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 238,365,252 - 238,405,892 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 213,686,578 - 213,727,831 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 213,649,335 - 213,690,585 (-) NCBI Celera 2 197,848,561 - 197,889,304 (-) NCBI Celera Cytogenetic Map 2 q42 NCBI
PLPPR4 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 99,262,924 - 99,309,584 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 99,264,292 - 99,309,590 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 99,730,048 - 99,775,140 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 99,502,488 - 99,547,728 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 1 97,983,902 - 98,029,193 (+) NCBI Celera Cytogenetic Map 1 p21.3-p21.2 NCBI HuRef 1 97,852,810 - 97,898,096 (+) NCBI HuRef CHM1_1 1 99,846,184 - 99,891,476 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 99,111,296 - 99,157,921 (+) NCBI T2T-CHM13v2.0
Plppr4 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 117,112,794 - 117,154,525 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 117,112,788 - 117,154,525 (-) Ensembl GRCm39 Ensembl GRCm38 3 117,319,145 - 117,360,876 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 117,319,139 - 117,360,876 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 117,022,063 - 117,063,794 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 117,311,149 - 117,352,880 (-) NCBI MGSCv36 mm8 Celera 3 123,722,032 - 123,763,668 (-) NCBI Celera Cytogenetic Map 3 G1 NCBI cM Map 3 50.57 NCBI
Plppr4 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955435 4,091,165 - 4,114,376 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955435 4,085,918 - 4,112,207 (+) NCBI ChiLan1.0 ChiLan1.0
PLPPR4 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 127,720,740 - 127,766,341 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 126,875,286 - 126,920,897 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 101,919,714 - 101,965,146 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 100,640,187 - 100,685,483 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 100,640,187 - 100,685,483 (+) Ensembl panpan1.1 panPan2
PLPPR4 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 6 50,553,769 - 50,594,298 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 6 50,554,949 - 50,594,383 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 6 53,237,104 - 53,277,408 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 6 50,906,076 - 50,946,382 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 6 50,906,113 - 50,946,341 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 6 50,599,385 - 50,639,586 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 6 50,578,764 - 50,619,057 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 6 51,011,414 - 51,051,742 (-) NCBI UU_Cfam_GSD_1.0
Plppr4
PLPPR4 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 4 118,713,994 - 118,752,224 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 4 118,713,987 - 118,752,499 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 4 130,278,777 - 130,316,328 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PLPPR4 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 33,996,027 - 34,042,145 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 33,996,021 - 34,042,004 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 24,010,104 - 24,055,697 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Plppr4
.
Predicted Target Of
Count of predictions: 776 Count of miRNA genes: 304 Interacting mature miRNAs: 402 Transcripts: ENSRNOT00000022625 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
1578648 Bss11 Bone structure and strength QTL 11 4.7 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 2 114837527 211674221 Rat 1358356 Srcrt1 Stress Responsive Cort QTL1 3.66 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 2 161699179 222436696 Rat 1331734 Bp204 Blood pressure QTL 204 3.61192 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 168358098 223265385 Rat 1354648 Bp239 Blood pressure QTL 239 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118463 226797303 Rat 1354649 Kidm17 Kidney mass QTL 17 2.9 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 2 81754530 227146641 Rat 10755499 Bp389 Blood pressure QTL 389 2.61 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 18960362 228801039 Rat 152025245 Scl81 Serum cholesterol level QTL 81 3.49 blood cholesterol amount (VT:0000180) 2 122609194 206936711 Rat 61458 Bp10 Blood pressure QTL 10 3.42 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 189020722 215287351 Rat 70162 Bp63 Blood pressure QTL 63 5.64 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 2 169745596 214745596 Rat 1554319 Bmd2 Bone mineral density QTL 2 13.4 0.0001 lumbar vertebra area (VT:0010570) lumbar vertebra cross-sectional area (CMO:0001689) 2 114837675 212549332 Rat 1581569 Uae32 Urinary albumin excretion QTL 32 0.0001 urine protein amount (VT:0005160) urine albumin excretion rate (CMO:0000757) 2 78665619 219826953 Rat 2317752 Glom23 Glomerulus QTL 23 3.6 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 2 193452645 245889826 Rat 61469 Bp16 Blood pressure QTL 16 5.64 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 2 169745596 214745596 Rat 1358900 Bw48 Body weight QTL 48 4.88 body mass (VT:0001259) body weight (CMO:0000012) 2 157142078 211086598 Rat 1359031 Bp275 Blood pressure QTL 275 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 185876309 219753474 Rat 1581499 Esta2 Estrogen-induced thymic atrophy QTL 2 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 2 189599258 226936289 Rat 9589044 Scfw1 Subcutaneous fat weight QTL 1 5.8 0.001 subcutaneous adipose mass (VT:1000472) abdominal subcutaneous fat pad weight (CMO:0002069) 2 182171407 227171407 Rat 8694435 Bw166 Body weight QTL 166 14.08 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 2 182171407 227171407 Rat 1298083 Bp158 Blood pressure QTL 158 2.62 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 189020722 215287351 Rat 8662832 Vetf7 Vascular elastic tissue fragility QTL 7 3.5 aorta elastin amount (VT:0003905) aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002) 2 81689826 221035911 Rat 1331745 Bp203 Blood pressure QTL 203 4.377 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 189599258 218414891 Rat 8694194 Abfw1 Abdominal fat weight QTL 1 11.7 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 2 182171407 227171407 Rat 61366 Iddm3 Insulin dependent diabetes mellitus QTL 3 4.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 2 189599258 234599258 Rat 1359022 Ppulsi1 Prepulse inhibition QTL 1 3.63 prepulse inhibition trait (VT:0003088) acoustic startle response measurement (CMO:0001519) 2 136916935 213594495 Rat 1641891 Alcrsp17 Alcohol response QTL 17 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 149559561 249053267 Rat 724534 Uae6 Urinary albumin excretion QTL 6 10 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 2 78665619 249053267 Rat 2300189 Bmd48 Bone mineral density QTL 48 5.8 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 2 179335906 224335906 Rat 8662843 Vetf9 Vascular elastic tissue fragility QTL 9 2.05 thoracic aorta molecular composition trait (VT:0010568) aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003) 2 157142078 226277316 Rat 2301408 Kidm36 Kidney mass QTL 36 0.002 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 190613715 226808892 Rat 2307174 Activ3 Activity QTL 3 4.83 0.000058 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 2 168594495 213594495 Rat 1598813 Memor9 Memory QTL 9 2.7 exploratory behavior trait (VT:0010471) average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674) 2 199341726 234244620 Rat 1331794 Bp202 Blood pressure QTL 202 3.66819 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 141194931 223265385 Rat 1331805 Cm29 Cardiac mass QTL 29 3.50746 heart mass (VT:0007028) heart wet weight (CMO:0000069) 2 141194931 223265385 Rat 2298479 Eau5 Experimental allergic uveoretinitis QTL 5 0.0021 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 2 202446871 237938339 Rat 634308 Sach6 Saccharin preference QTL 6 4.9 taste sensitivity trait (VT:0001986) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 2 112456140 212696837 Rat 724568 Uae13 Urinary albumin excretion QTL 13 4.4 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 2 143157029 210020885 Rat 738013 Alc15 Alcohol consumption QTL 15 4.1 0.00022 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 2 184165752 229165752 Rat 61398 Bp50 Blood pressure QTL 50 4.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 189599258 234599258 Rat 631507 Bp105 Blood pressure QTL 105 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 112456140 212696837 Rat 1641925 Alcrsp2 Alcohol response QTL 2 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 149559561 221167075 Rat 61417 Cia10 Collagen induced arthritis QTL 10 3.4 joint integrity trait (VT:0010548) experimental arthritis severity measurement (CMO:0001459) 2 179946951 224946951 Rat 1354622 Kidm16 Kidney mass QTL 16 3 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 2 81754530 222436696 Rat 8694383 Bw158 Body weight QTL 158 7.69 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 2 182171407 227171407 Rat 1598835 Anxrr18 Anxiety related response QTL 18 2.98 body movement coordination trait (VT:0005424) number of rearing movements in an experimental apparatus (CMO:0001752) 2 200990457 245990457 Rat 7488927 Bp365 Blood pressure QTL 365 0.008 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 162765032 207765032 Rat 1598838 Bp290 Blood pressure QTL 290 1.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 166539266 211539266 Rat 7488925 Bp364 Blood pressure QTL 364 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 160564068 205564068 Rat 2306901 Bp337 Blood pressure QTL 337 0.01 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 164073756 227146641 Rat 1354605 Rf48 Renal function QTL 48 2.9 blood creatinine amount (VT:0005328) plasma creatinine level (CMO:0000537) 2 74786664 206665859 Rat 2293084 Iddm26 Insulin dependent diabetes mellitus QTL 26 2.9 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 2 174930955 213594495 Rat
AW526088
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 205,371,352 - 205,371,561 (-) MAPPER mRatBN7.2 Rnor_6.0 2 220,341,619 - 220,341,827 NCBI Rnor6.0 Rnor_5.0 2 238,405,648 - 238,405,856 UniSTS Rnor5.0 RGSC_v3.4 2 213,686,613 - 213,686,821 UniSTS RGSC3.4 Celera 2 197,848,597 - 197,848,805 UniSTS RH 3.4 Map 2 1489.3 UniSTS Cytogenetic Map 2 q41 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
8
45
107
75
74
43
25
43
6
192
87
87
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000022625 ⟹ ENSRNOP00000022625
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 205,371,322 - 205,412,302 (-) Ensembl Rnor_6.0 Ensembl 2 220,298,245 - 220,341,866 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000114094 ⟹ ENSRNOP00000084199
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 205,371,322 - 205,390,852 (-) Ensembl
RefSeq Acc Id:
NM_001001508 ⟹ NP_001001508
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 208,056,206 - 208,097,191 (-) NCBI mRatBN7.2 2 205,371,317 - 205,412,302 (-) NCBI Rnor_6.0 2 220,298,239 - 220,341,863 (+) NCBI Rnor_5.0 2 238,365,252 - 238,405,892 (+) NCBI RGSC_v3.4 2 213,686,578 - 213,727,831 (-) RGD Celera 2 197,848,561 - 197,889,304 (-) NCBI
Sequence:
ATGCCCCAATTCACCCTCTCTCTTCAGATGCAGGCAAAAAATTCTCACTTTGTTCCTCGGCGGATTGGAGCTTTTTCTAGGTGCTTCCCTTGGAGTTACCTCCCTAGAGATCAGTAGTCAGGGCTGTC
hide sequence
RefSeq Acc Id:
NP_001001508 ⟸ NM_001001508
- UniProtKB:
Q7TMB7 (UniProtKB/Swiss-Prot), G3V864 (UniProtKB/TrEMBL), A6HVB7 (UniProtKB/TrEMBL)
- Sequence:
MQRAGSSGARGECDISGTGRLRLEQAARLGGRAVHTSPTGGLGARQVAGMSAKERPKGKVIKDSVTLLPCFYFVELPILASSVVSLYFLELTDVFKPVHSGFSCYDRSLSMPYIEPTQEAIPFLMLLS
hide sequence
Ensembl Acc Id:
ENSRNOP00000022625 ⟸ ENSRNOT00000022625
Ensembl Acc Id:
ENSRNOP00000084199 ⟸ ENSRNOT00000114094
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-10-26
Plppr4
phospholipid phosphatase related 4
Lppr4
lipid phosphate phosphatase-related protein type 4
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2009-11-02
Lppr4
lipid phosphate phosphatase-related protein type 4
Lppr4
plasticity related gene 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-11-14
Lppr4
plasticity related gene 1
Prg-1
plasticity-related gene 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-07-23
Prg-1
plasticity-related gene 1
Lppr4
plasticity related gene 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-03-06
Lppr4
plasticity related gene 1
Prg1
plasticity related gene 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-09-30
Prg1
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_cellular_localization
localizes to the plasma membranes of outgrowing axons
1299556
gene_process
attenuates phospholipid-induced axon collapse in neurons thereby facilitating axonal outgrowth in the hippocampus
1299556
gene_process
acts as an ectoenzyme
1299556
