Slc27a2 (solute carrier family 27 member 2)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Slc27a2 (solute carrier family 27 member 2) Rattus norvegicus

Analyze

Symbol:

Slc27a2

Name:

solute carrier family 27 member 2

RGD ID:

71103

Description:

Enables long-chain fatty acid-CoA ligase activity and very long-chain fatty acid-CoA ligase activity. Involved in long-chain fatty acid metabolic process. Located in endoplasmic reticulum and peroxisomal membrane. Orthologous to human SLC27A2 (solute carrier family 27 member 2); PARTICIPATES IN phytanic acid degradation pathway; Refsum disease pathway; eicosanoid signaling pathway via peroxisome proliferator-activated receptor gamma; INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

arachidonate--CoA ligase; FATP-2; fatty acid transport protein 2; fatty-acid-coenzyme A ligase, very long-chain 1; long-chain fatty acid transport protein 2; long-chain-fatty-acid--CoA ligase; MGC93337; phytanate--CoA ligase; solute carrier family 27 (fatty acid transporter) member 2; solute carrier family 27 (fatty acid transporter), member 2; solute carrier family 27 (fatty acid transporter), member 32; THCA-CoA ligase; very long-chain acyl-CoA synthetase; very long-chain-fatty-acid-CoA ligase; VLACS; VLCS

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	3	113,804,728 - 113,842,208 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	113,804,728 - 113,842,208 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	117,687,726 - 117,725,657 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	3	126,283,254 - 126,321,189 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	3	123,943,634 - 123,981,567 (+)	NCBI	Rnor_WKY
Rnor_6.0	3	119,014,620 - 119,052,531 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	119,014,620 - 119,052,531 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	125,542,772 - 125,580,197 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	114,072,570 - 114,114,269 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	113,978,142 - 114,019,842 (+)	NCBI
Celera	3	112,647,886 - 112,684,776 (+)	NCBI		Celera
Cytogenetic Map	3	q36	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Bloom syndrome (ISO)

colorectal cancer (ISO)

Fibrosis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(-)-epigallocatechin 3-gallate (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP,ISO)

2,4-dinitrotoluene (ISO)

2,6-dinitrotoluene (EXP)

3,3',4,4',5-pentachlorobiphenyl (ISO)

3,3',4,4'-tetrachlorobiphenyl (ISO)

3-chloropropane-1,2-diol (EXP)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP)

6-(4-chlorophenyl)imidazo[2,1-b][1,3]thiazole-5-carbaldehyde O-(3,4-dichlorobenzyl)oxime (ISO)

6-propyl-2-thiouracil (EXP)

8-Br-cAMP (ISO)

acetamide (EXP)

adefovir pivoxil (ISO)

aflatoxin B1 (ISO)

Aflatoxin B2 alpha (ISO)

all-trans-retinoic acid (ISO)

amiodarone (EXP)

ammonium chloride (EXP)

antirheumatic drug (ISO)

arsenous acid (ISO)

belinostat (ISO)

benzbromarone (EXP)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

benzo[e]pyrene (ISO)

benzylpenicillin (ISO)

beta-naphthoflavone (ISO)

bexarotene (EXP)

bezafibrate (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

buta-1,3-diene (ISO)

cadmium dichloride (ISO)

calcitriol (ISO)

CGP 52608 (ISO)

chloroacetaldehyde (ISO)

chlorothalonil (ISO)

chromium(6+) (ISO)

cidofovir anhydrous (ISO)

ciguatoxin CTX1B (ISO)

clofibrate (EXP,ISO)

clofibric acid (EXP)

cobalt dichloride (EXP,ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

coumarin (EXP)

coumestrol (ISO)

crocidolite asbestos (ISO)

CU-O LINKAGE (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

cylindrospermopsin (ISO)

deoxycholic acid (ISO)

dexamethasone (EXP)

diarsenic trioxide (ISO)

dicrotophos (ISO)

dioxygen (ISO)

dipentyl phthalate (EXP)

dorsomorphin (ISO)

endosulfan (EXP)

Enterolactone (ISO)

erythromycin A (ISO)

ethanol (EXP,ISO)

farnesol (ISO)

fenofibrate (EXP,ISO)

flutamide (EXP)

folic acid (ISO)

folpet (ISO)

fructose (ISO)

fumonisin B1 (ISO)

furan (EXP)

gemfibrozil (EXP)

genistein (ISO)

GW 4064 (ISO)

GW 7647 (ISO)

hydrogen peroxide (ISO)

isotretinoin (ISO)

L-ethionine (EXP)

menadione (ISO)

mercury dibromide (ISO)

methapyrilene (ISO)

methotrexate (ISO)

methylmercury chloride (ISO)

Muraglitazar (EXP)

N-acetyl-L-cysteine (EXP)

N-nitrosodiethylamine (EXP)

nicotinic acid (ISO)

nitrofen (EXP)

olanzapine (ISO)

oleic acid (ISO)

omeprazole (EXP)

p-chloromercuribenzoic acid (ISO)

panobinostat (ISO)

paracetamol (EXP,ISO)

perfluorohexanesulfonic acid (ISO)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (EXP,ISO)

perfluorooctanoic acid (EXP,ISO)

phenobarbital (ISO)

pirinixic acid (EXP,ISO)

potassium chromate (ISO)

potassium dichromate (ISO)

pravastatin (EXP,ISO)

procymidone (ISO)

progesterone (ISO)

propamocarb (ISO)

quercetin (ISO)

resveratrol (ISO)

rifampicin (ISO)

rotenone (EXP)

SB 431542 (ISO)

sodium arsenite (ISO)

sodium dichromate (EXP)

sulforaphane (ISO)

tauroursodeoxycholic acid (EXP)

tert-butyl ethyl ether (EXP)

tert-butyl hydroperoxide (ISO)

Tesaglitazar (EXP)

testosterone (ISO)

tetrachloroethene (ISO)

tetrachloromethane (EXP,ISO)

tetracycline (ISO)

thioacetamide (EXP)

trichloroethene (EXP,ISO)

trichostatin A (ISO)

troglitazone (EXP)

tunicamycin (ISO)

valproic acid (ISO)

vinclozolin (EXP)

vorinostat (ISO)

zidovudine (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

bile acid biosynthetic process (IBA,IEA,ISO)

carboxylic acid transmembrane transport (ISO)

fatty acid alpha-oxidation (IEA,ISO)

fatty acid beta-oxidation (IEA,ISO)

fatty acid transport (ISO)

long-chain fatty acid import into cell (IBA,IEA,ISO)

long-chain fatty acid metabolic process (IEA,IMP,ISO)

methyl-branched fatty acid metabolic process (IEA,ISO)

monocarboxylic acid transport (ISO)

very long-chain fatty acid catabolic process (IBA,IEA,ISO)

very long-chain fatty acid metabolic process (ISO)

Cellular Component

endoplasmic reticulum (IBA,IDA,ISO)

endoplasmic reticulum lumen (IBA,IEA,ISO,ISS)

endoplasmic reticulum membrane (IBA,IEA,ISO)

intracellular membrane-bounded organelle (IDA)

obsolete integral component of endoplasmic reticulum membrane (ISO)

obsolete integral component of peroxisomal membrane (ISO)

peroxisomal membrane (IBA,IDA,IEA,ISO,ISS)

peroxisome (IDA,ISO)

plasma membrane (IEA,ISO)

Molecular Function

arachidonate-CoA ligase activity (IEA)

ATP binding (IEA)

cholate-CoA ligase activity (IEA)

enzyme binding (IEA,ISO)

fatty acid transmembrane transporter activity (IBA,IEA,ISO)

long-chain fatty acid transporter activity (IBA,IEA,ISO)

long-chain fatty acid-CoA ligase activity (IBA,IDA,IEA,IMP,ISO)

oleate transmembrane transporter activity (IEA)

phytanate-CoA ligase activity (IBA,IEA,ISO)

pristanate-CoA ligase activity (IBA,IEA,ISO)

protein binding (IPI)

very long-chain fatty acid-CoA ligase activity (IBA,IEA,IMP,ISO,ISS)

Molecular Pathway Annotations Click to see Annotation Detail View

eicosanoid signaling pathway via peroxisome proliferator-activated receptor gamma (IEA)

phytanic acid degradation pathway (ISO)

Refsum disease pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Proteomic analysis of rat liver peroxisome: presence of peroxisome-specific isozyme of Lon protease.	Kikuchi M, etal., J Biol Chem. 2004 Jan 2;279(1):421-8. Epub 2003 Oct 15.
4.	Cellular cholesterol stimulates acute uptake of palmitate by redistribution of fatty acid translocase in type II pneumocytes.	Kolleck I, etal., Biochemistry 2002 May 21;41(20):6369-75.
5.	Molecular organization of peroxisomal enzymes: protein-protein interactions in the membrane and in the matrix.	Makkar RS, etal., Arch Biochem Biophys. 2006 Jul 15;451(2):128-40. Epub 2006 May 24.
6.	Gene Data Set	MGD Curation, June 12, 2002
7.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
8.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.	Identification of acyl-CoA synthetases involved in the mammalian sphingosine 1-phosphate metabolic pathway.	Ohkuni A, etal., Biochem Biophys Res Commun. 2013 Dec 13;442(3-4):195-201. doi: 10.1016/j.bbrc.2013.11.036. Epub 2013 Nov 19.
10.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
11.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
12.	GOA pipeline	RGD automated data pipeline
13.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
14.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
15.	Intraperoxisomal localization of very-long-chain fatty acyl-CoA synthetase: implication in X-adrenoleukodystrophy.	Smith BT, etal., Exp Cell Res. 2000 Feb 1;254(2):309-20.
16.	Human very-long-chain acyl-CoA synthetase: cloning, topography, and relevance to branched-chain fatty acid metabolism.	Steinberg SJ, etal., Biochem Biophys Res Commun. 1999 Apr 13;257(2):615-21.
17.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
18.	Molecular cloning of cDNA encoding rat very long-chain acyl-CoA synthetase.	Uchiyama A, etal., J Biol Chem 1996 Nov 29;271(48):30360-5.

Additional References at PubMed

PMID:9271215	PMID:9671728	PMID:10749848	PMID:11980911	PMID:12048192	PMID:12719378	PMID:14651853	PMID:15699031	PMID:19056867	PMID:20142826	PMID:20178365	PMID:20530735
PMID:21768100	PMID:22022213	PMID:23376485	PMID:28993506

Genomics

Comparative Map Data

Slc27a2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	3	113,804,728 - 113,842,208 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	113,804,728 - 113,842,208 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	117,687,726 - 117,725,657 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	3	126,283,254 - 126,321,189 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	3	123,943,634 - 123,981,567 (+)	NCBI	Rnor_WKY
Rnor_6.0	3	119,014,620 - 119,052,531 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	119,014,620 - 119,052,531 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	125,542,772 - 125,580,197 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	114,072,570 - 114,114,269 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	113,978,142 - 114,019,842 (+)	NCBI
Celera	3	112,647,886 - 112,684,776 (+)	NCBI		Celera
Cytogenetic Map	3	q36	NCBI

SLC27A2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	15	50,182,196 - 50,236,385 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	15	50,182,196 - 50,236,385 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	15	50,474,393 - 50,528,582 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	15	48,261,714 - 48,315,862 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	15	48,261,713 - 48,315,862	NCBI
Celera	15	27,367,005 - 27,421,191 (+)	NCBI		Celera
Cytogenetic Map	15	q21.2	NCBI
HuRef	15	27,305,393 - 27,359,548 (+)	NCBI		HuRef
CHM1_1	15	50,592,321 - 50,646,529 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	15	47,990,417 - 48,044,633 (+)	NCBI		T2T-CHM13v2.0

Slc27a2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	126,394,944 - 126,430,163 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	126,394,327 - 126,430,163 (+)	Ensembl		GRCm39 Ensembl
GRCm38	2	126,553,024 - 126,588,243 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	126,552,407 - 126,588,243 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	126,378,760 - 126,413,979 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	126,244,596 - 126,279,377 (+)	NCBI		MGSCv36	mm8
Celera	2	127,790,803 - 127,826,187 (+)	NCBI		Celera
Cytogenetic Map	2	F1	NCBI

Slc27a2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955409	4,077,149 - 4,112,828 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955409	4,077,685 - 4,112,828 (-)	NCBI	ChiLan1.0	ChiLan1.0

SLC27A2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	15	47,452,227 - 47,505,066 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	15	47,452,227 - 47,505,066 (+)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	15	29,130,262 - 29,182,752 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

SLC27A2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	30	16,155,932 - 16,196,919 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	30	16,156,063 - 16,196,829 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	30	16,082,144 - 16,122,978 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	30	16,299,840 - 16,340,742 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	30	16,299,931 - 16,340,726 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	30	16,222,402 - 16,263,283 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	30	16,339,970 - 16,380,747 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	30	16,446,344 - 16,487,168 (+)	NCBI		UU_Cfam_GSD_1.0

Slc27a2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	94,411,670 - 94,450,694 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936471	12,259,734 - 12,298,760 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936471	12,259,779 - 12,298,760 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SLC27A2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	121,526,295 - 121,579,120 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	121,530,449 - 121,578,994 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	135,172,705 - 135,221,753 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SLC27A2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	26	33,080,844 - 33,134,467 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	26	33,083,317 - 33,134,433 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666048	108,014,439 - 108,068,707 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Slc27a2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624731	9,862,731 - 9,896,661 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624731	9,862,948 - 9,896,064 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Slc27a2
302 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	340
Count of miRNA genes:	125
Interacting mature miRNAs:	137
Transcripts:	ENSRNOT00000013605, ENSRNOT00000067700
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
737818	Hcar12	Hepatocarcinoma resistance QTL 12	2.6		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	3	29463235	118376539	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	31172320	163586636	Rat
1358362	Srcrt2	Stress Responsive Cort QTL 2	2.78		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	38192233	133483320	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	41874578	155617519	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	41874578	155617519	Rat
1581503	Cm58	Cardiac mass QTL 58	2.7	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	43827364	121056321	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	43827364	169034231	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	47233211	147415807	Rat
631665	Bw8	Body weight QTL 8	5.5		body mass (VT:0001259)	body weight (CMO:0000012)	3	50437042	119183768	Rat
724523	Tsu1	Thymus enlargement suppressive QTL 1	3.84		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	3	50437504	115638231	Rat
1582218	Bw74	Body weight QTL 74	3.9	0.0021	body mass (VT:0001259)	body weight (CMO:0000012)	3	53184593	115665732	Rat
1582238	Bw68	Body weight QTL 68	3.2	0.0064	body mass (VT:0001259)	body weight (CMO:0000012)	3	53184593	115665732	Rat
1582239	Epfw1	Epididymal fat weight QTL 1	4.5	0.0006	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	3	53184593	115665732	Rat
1581568	Rf53	Renal function QTL 53			urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	3	56395968	161299569	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	59242096	157323038	Rat
1300111	Rf12	Renal function QTL 12	3.78		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	3	61017749	121056321	Rat
1582210	Bw71	Body weight QTL 71	3.3	0.0012	body mass (VT:0001259)	body weight (CMO:0000012)	3	64655305	115665732	Rat
1582221	Kidm30	Kidney mass QTL 30	3.5	0.0008	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	3	64655305	115665732	Rat
12879848	Bw181	Body weght QTL 181		0.015	body mass (VT:0001259)	body weight (CMO:0000012)	3	70348525	121056321	Rat
2301414	Kidm37	Kidney mass QTL 37		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	70653097	121056321	Rat
1600376	Arunc5	Aerobic running capacity QTL 5		0.21	exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	3	73376539	118376539	Rat
1581546	Pur13	Proteinuria QTL 13	2.93	0.0335	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	3	78196190	146592722	Rat
2302273	Gluco35	Glucose level QTL 35	5.3	0.001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	80800231	114297550	Rat
631649	Bp123	Blood pressure QTL 123	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	89772419	134772419	Rat
8694437	Bw167	Body weight QTL 167	22.46	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	3	91797474	136797474	Rat
631841	Niddm39	Non-insulin dependent diabetes mellitus QTL 39	3.36		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	94856903	159898684	Rat
724532	Cm17	Cardiac mass QTL 17	2		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	3	95735366	140735366	Rat
1582219	Bw63	Body weight QTL 63	3.8	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	3	96127817	115665732	Rat
1354611	Despr2	Despair related QTL 2	3.03	0.0028	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	3	97084464	142084464	Rat
2293087	Iddm27	Insulin dependent diabetes mellitus QTL 27	2.68		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	97551417	147415807	Rat
2312659	Slep7	Serum leptin concentration QTL 7		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	3	98535255	168026850	Rat
2312670	Bw94	Body weight QTL 94		0.01	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	3	98535255	168026850	Rat
2312673	Scl63	Serum cholesterol level QTL 63		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	3	98535255	168026850	Rat
2302373	Gluco39	Glucose level QTL 39	5.01		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	3	98535386	161695835	Rat
1582216	Bw65	Body weight QTL 65	6.3		body mass (VT:0001259)	body weight (CMO:0000012)	3	102200529	115665732	Rat
619618	Rf3	Renal disease susceptibility QTL 3	6.5	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate to body weight ratio (CMO:0001270)	3	107693393	152693393	Rat
1331758	Bp207	Blood pressure QTL 207	2.848		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	112287552	135181505	Rat
1578754	Stresp16	Stress response QTL 16	4	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	3	112681431	157681431	Rat

Markers in Region

D3Got230

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	113,804,232 - 113,804,401 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	119,014,125 - 119,014,293	NCBI	Rnor6.0
Rnor_5.0	3	125,542,277 - 125,542,445	UniSTS	Rnor5.0
RGSC_v3.4	3	114,072,075 - 114,072,243	UniSTS	RGSC3.4
Celera	3	112,647,391 - 112,647,559	UniSTS
Cytogenetic Map	3	q36	UniSTS

RH128972

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	113,841,956 - 113,842,152 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	119,052,280 - 119,052,475	NCBI	Rnor6.0
Rnor_5.0	3	125,579,946 - 125,580,141	UniSTS	Rnor5.0
RGSC_v3.4	3	114,114,018 - 114,114,213	UniSTS	RGSC3.4
Celera	3	112,684,525 - 112,684,720	UniSTS
RH 3.4 Map	3	988.0	UniSTS
Cytogenetic Map	3	q36	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium			43	41	2	41			29	23	1	2
Low	2	3	14		12		4	4	39	8	30	9	4
Below cutoff	1	31			5		4	5	6	4	10		4

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_031736	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC081766	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D85100	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000118	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000013605 ⟹ ENSRNOP00000013607

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	3	119,015,412 - 119,052,222 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000067700 ⟹ ENSRNOP00000059771

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	113,804,728 - 113,842,208 (+)	Ensembl
Rnor_6.0 Ensembl	3	119,014,620 - 119,052,531 (+)	Ensembl

RefSeq Acc Id:

NM_031736 ⟹ NP_113924

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	3	113,804,728 - 113,842,208 (+)	NCBI
Rnor_6.0	3	119,014,620 - 119,052,531 (+)	NCBI
Rnor_5.0	3	125,542,772 - 125,580,197 (+)	NCBI
RGSC_v3.4	3	114,072,570 - 114,114,269 (+)	RGD
Celera	3	112,647,886 - 112,684,776 (+)	RGD

Sequence:

show sequence

GACACAGTACTGCCGATGTTGGACAGAGGATCGCTTAACAGAACGAAATCTCAAAACAAATTAA
CAGGACCCGGTTGCTTGATTTCCCAAATCAGAAAAGGCTCGAAATGTCTAGAGGGGCTGACTGA
TGCAGCGGTGACCCGGACTGGAGACAGTTGGACGCGATCATCTCTGGTGCTTTTGTTCAACCTT
GAAACCTTCGCCACAGGAGACTTGCCTGAGCAGAGAAGCAAACGTGGAGAAACAAAGAGAGATC
TAGCGAAAAGCCTCTGGGACCAAGGAGGGGAGGTGGGACTCTGGGTTGGCGGTGGCACCTGCTG
CCGGCTATTAATAATAGGGTCGCGATGCGTTTATAAGGTGTTTGATTAAACAAAGACTCTATGA
GAGAAGAATAACTAGCAACAGCCCCACGTCTGAGTCGTCGCCTCCGACCTTTTTCAACGTGGGT
TCTTTGGGCCGAGCGTCGTTTGCCGAGAACTAGATCTCACCTGACCCCAGACGCTGAAAACAAG
CGCTGTGGCATCCTGGGCCACCCAAGCTGACAAGGGCGCGCCCCCTGAGCACACGAGGTGCCCC
ACGAGGGGGAGGGACCCACAGCCGTCCCGCCCGCACCGCGGTGTCCGCTGCGGGCACCTGCAGC
CGAGCCGCCACCCGCAGTCGCAGCGCGTCCGGCGGCCGAACCCGGTCGTCAGCTCGTCAGCACC
TGCTCTGCTTCTCTCCCGCCCGCCGCCGCGCTGCACGCCTCGAGCGCTCCCTCGGCCCCGGCGG
GGACCGGGGACCCCGCAGCCACCGCCATGCTGCCTGTGCTCTACACCGGCCTGGCGGGGCTGCT
GCTGCTGCCTCTGCTGCTCACCTGCTGCTGCCCCTACCTCCTCCAGGACGTGCGGTTCTTCCTG
CAACTGGCCAACATGGCCCGGCAGGTGCGCAGCTACCGGCAGCGGCGACCCGTGCGCACCATCC
TGCATGTCTTCTTGGAGCAAGCGCGCAAGACCCCGCACAAGCCCTTCCTGCTGTTTCGCGACGA
GACGCTTACCTACGCCCAGGTAGACCGGCGCAGCAACCAAGTAGCGCGAGCGCTGCATGATCAC
CTGGGCCTGCGGCAGGGGGATTGCGTGGCCCTCTTCATGGGCAATGAGCCGGCCTACGTGTGGC
TCTGGCTGGGACTGCTCAAACTGGGCTGTCCCATGGCGTGCCTCAACTACAACATCCGTGCCAA
GTCTCTGCTACACTGCTTTCAGTGCTGCGGGGCGAAGGTGCTGCTGGCCTCCCCAGAGCTACAC
GAAGCTGTCGAGGAGGTTCTTCCAACCCTGAAAAAGGAGGGCGTGTCCGTCTTCTACGTAAGCA
GAACTTCTAACACTAATGGCGTGGACACAGTACTGGACAAAGTAGACGGGGTGTCGGCGGACCC
CATCCCGGAGTCGTGGAGGTCTGAAGTCACGTTCACCACACCCGCAGTCTACATATATACTTCG
GGCACCACAGGTCTTCCAAAGGCTGCAACCATTAATCACCATCGCCTCTGGTATGGGACCAGCC
TTGCCCTGAGGTCCGGAATTAAGGCTCATGACGTCATCTACACCACCATGCCCCTGTACCACAG
CGCGGCGCTCATGATTGGCCTCCACGGATGCATTGTGGTTGGGGCTACATTTGCTTTGCGGAGC
AAATTTTCAGCCAGCCAGTTTTGGGACGACTGCAGGAAATACAACGCCACTGTCATTCAGTACA
TCGGTGAACTGCTTCGGTACCTCTGCAACACGCCCCAGAAACCAAATGACCGGGACCACAAAGT
GAAAATAGCACTAGGAAATGGCTTACGAGGAGATGTGTGGAGAGAGTTCATCAAGAGATTTGGG
GACATTCACATTTATGAGTTCTACGCTTCCACTGAAGGCAACATTGGATTTATGAACTATCCAA
GAAAAATCGGAGCTGTTGGAAGAGAAAATTACCTACAAAAAAAAGTTGTAAGGCACGAGCTGAT
CAAGTATGACGTGGAGAAGGATGAGCCTGTCCGTGATGCAAATGGATATTGCATCAAAGTCCCC
AAAGGAGAGGTTGGACTCTTGATTTGCAAAATCACAGAGCTCACACCATTTTTTGGCTATGCTG
GAGGAAAGACCCAGACAGAGAAGAAAAAGCTCAGAGATGTTTTTAAGAAAGGAGACGTCTACTT
CAACAGTGGCGATCTCCTGATGATCGACCGTGAAAATTTCATCTATTTTCACGACAGAGTTGGA
GACACCTTCCGGTGGAAAGGAGAGAATGTAGCTACCACGGAAGTCGCTGACATTGTGGGACTGG
TAGATTTTGTTGAAGAAGTGAATGTTTACGGTGTGCCCGTGCCAGGTCATGAAGGTCGCATCGG
GATGGCCTCGATCAAGATGAAAGAAAACTACGAGTTCAATGGAAAGAAACTCTTTCAGCACATC
TCGGAGTACCTGCCCAGTTACTCGAGGCCTCGGTTCCTGAGAATACAAGATACCATTGAGATCA
CCGGGACTTTTAAACACCGCAAAGTGACCCTGATGGAAGAGGGCTTTAACCCCTCAGTCATCAA
AGATACCTTGTATTTCATGGATGACACAGAAAAAACATACGTGCCCATGACTGAGGACATTTAT
AATGCCATAATTGATAAGACTCTGAAGCTCTGAATGTTGCCTGGCTCCTAACACTTCCAGAAAG
AAACACAATAGGCCTAGCATAGCCCCTTCACATGTGTAATCCAACTTTAACTTGATTAAAGGTT
ATAGGTGTGATTTTTCCTAGGAAATTATTCATTTAAAGGACAATTGTTTGTTTGTTTGTTTGTT
TTTTATTAATTACACCAGAACGTTTGCAAGTAAAAAGATTTAAAGTCACTTATTTTTCAATGTG
CACCTGCCATTTGTCCTTGCAAACTTAGCTTCTTGGAGAGAGGGCCTTATTTTTTTAAAGACAT
AATAAACTATGTAAACACT

hide sequence

Protein Sequences


Protein RefSeqs	NP_113924	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH81766	(Get FASTA)	NCBI Sequence Viewer
	BAA12722	(Get FASTA)	NCBI Sequence Viewer
	P97524	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_113924 ⟸ NM_031736

- UniProtKB:

D3ZSL9 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MLPVLYTGLAGLLLLPLLLTCCCPYLLQDVRFFLQLANMARQVRSYRQRRPVRTILHVFLEQAR
KTPHKPFLLFRDETLTYAQVDRRSNQVARALHDHLGLRQGDCVALFMGNEPAYVWLWLGLLKLG
CPMACLNYNIRAKSLLHCFQCCGAKVLLASPELHEAVEEVLPTLKKEGVSVFYVSRTSNTNGVD
TVLDKVDGVSADPIPESWRSEVTFTTPAVYIYTSGTTGLPKAATINHHRLWYGTSLALRSGIKA
HDVIYTTMPLYHSAALMIGLHGCIVVGATFALRSKFSASQFWDDCRKYNATVIQYIGELLRYLC
NTPQKPNDRDHKVKIALGNGLRGDVWREFIKRFGDIHIYEFYASTEGNIGFMNYPRKIGAVGRE
NYLQKKVVRHELIKYDVEKDEPVRDANGYCIKVPKGEVGLLICKITELTPFFGYAGGKTQTEKK
KLRDVFKKGDVYFNSGDLLMIDRENFIYFHDRVGDTFRWKGENVATTEVADIVGLVDFVEEVNV
YGVPVPGHEGRIGMASIKMKENYEFNGKKLFQHISEYLPSYSRPRFLRIQDTIEITGTFKHRKV
TLMEEGFNPSVIKDTLYFMDDTEKTYVPMTEDIYNAIIDKTLKL

hide sequence

RefSeq Acc Id:

ENSRNOP00000059771 ⟸ ENSRNOT00000067700

RefSeq Acc Id:

ENSRNOP00000013607 ⟸ ENSRNOT00000013605

Protein Domains

AMP-binding AMP-binding_C

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P97524-F1-model_v2	AlphaFold	P97524	1-620	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692388

Promoter ID:

EPDNEW_R2913

Type:

initiation region

Name:

Slc27a2_1

Description:

solute carrier family 27 member 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	119,015,273 - 119,015,333	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:71103	AgrOrtholog
BioCyc Gene	G2FUF-48024	BioCyc
BioCyc Pathway	PWY-5143 [long-chain fatty acid activation]	BioCyc
	PWY-5972 [stearate biosynthesis I (animals)]	BioCyc
	PWY-6000 [gamma-linolenate biosynthesis II (animals)]	BioCyc
	PWY-6061 [bile acid biosynthesis, neutral pathway]	BioCyc
	PWY3DJ-11470 [sphingosine and sphingosine-1-phosphate metabolism]	BioCyc
Ensembl Genes	ENSRNOG00000010128	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000059771	ENTREZGENE
	ENSRNOP00000059771.4	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000067700	ENTREZGENE
	ENSRNOT00000067700.4	UniProtKB/TrEMBL
Gene3D-CATH	3.30.300.30	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	3.40.50.12780	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7106977	IMAGE-MGC_LOAD
InterPro	AMP-bd_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	AMP-bd_C_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	AMP-binding_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	AMP-dep_Synth/Lig	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	AMP-dep_Synthh-like_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	FATP2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:65192	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:93337	IMAGE-MGC_LOAD
NCBI Gene	65192	ENTREZGENE
PANTHER	PTHR43107:SF13	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	AMP-binding	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	AMP-binding_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Slc27a2	PhenoGen
PROSITE	AMP_BINDING	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	D3ZSL9	ENTREZGENE
	P97524	ENTREZGENE
	Q66HN6_RAT	UniProtKB/TrEMBL
	S27A2_RAT	UniProtKB/Swiss-Prot
UniProt Secondary	D3ZSL9	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-02-24	Slc27a2	solute carrier family 27 member 2	Slc27a2	solute carrier family 27 (fatty acid transporter), member 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Slc27a2	solute carrier family 27 (fatty acid transporter), member 2		solute carrier family 27 (fatty acid transporter), member 32	Name updated	1299863	APPROVED
2002-07-09	Slc27a2	solute carrier family 27 (fatty acid transporter), member 32			Symbol and Name updated to reflect Human and Mouse nomenclature	70877	APPROVED

RGD Curation Notes

Note Type	Note	Reference

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)