Symbol:
Abcd1
Name:
ATP binding cassette subfamily D member 1
RGD ID:
1562128
Description:
Enables ATP binding activity; protein heterodimerization activity; and protein homodimerization activity. Involved in very long-chain fatty acid catabolic process. Located in peroxisomal membrane. Human ortholog(s) of this gene implicated in adrenoleukodystrophy. Orthologous to human ABCD1 (ATP binding cassette subfamily D member 1); PARTICIPATES IN adrenoleukodystrophy pathway; carnitine-acylcarnitine translocase deficiency; fatty acid beta degradation pathway; INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; bisphenol A.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
ALDP; ATP-binding cassette sub-family D member 1; ATP-binding cassette, sub-family D (ALD), member 1; ATP-binding cassette, subfamily D (ALD), member 1; LOC363516; RGD1562128; similar to mALDP
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Allele / Splice:
Abcd1em2Mcwi
Abcd1em4Mcwi
Genetic Models:
DA-Abcd1em4Mcwi
DA-Abcd1em2Mcwi
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 X 156,579,669 - 156,601,448 (+) NCBI GRCr8 mRatBN7.2 X 151,428,334 - 151,450,115 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl X 151,428,578 - 151,450,115 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx X 153,569,626 - 153,591,020 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 X 157,132,856 - 157,154,250 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 X 154,804,685 - 154,826,079 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 X 157,073,860 - 157,095,652 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 157,072,736 - 157,095,274 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 152,823,436 - 152,844,829 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 X 159,614,569 - 159,635,963 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 1 136,439,697 - 136,461,090 (-) NCBI Celera Cytogenetic Map X q37 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Abcd1 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of ABCD1 mRNA] CTD PMID:31150632 Abcd1 Rat (1->4)-beta-D-glucan multiple interactions ISO Abcd1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of ABCD1 mRNA CTD PMID:36331819 Abcd1 Rat (R,R,R)-alpha-tocopherol multiple interactions ISO Abcd1 (Mus musculus) 6480464 alpha-Tocopherol inhibits the reaction [7-ketocholesterol results in decreased expression of ABCD1 mRNA] CTD PMID:29065513 Abcd1 Rat 1,2-dimethylhydrazine increases expression ISO Abcd1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of ABCD1 mRNA CTD PMID:22206623 Abcd1 Rat 17beta-estradiol decreases expression ISO Abcd1 (Mus musculus) 6480464 Estradiol results in decreased expression of ABCD1 mRNA CTD PMID:39298647 Abcd1 Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Abcd1 (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Abcd1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of ABCD1 mRNA CTD PMID:21215274 Abcd1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Abcd1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of ABCD1 mRNA CTD PMID:21570461 Abcd1 Rat 2-palmitoylglycerol increases expression ISO ABCD1 (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of ABCD1 mRNA CTD PMID:37199045 Abcd1 Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO Abcd1 (Mus musculus) 6480464 tetrabromobisphenol A results in decreased expression of ABCD1 mRNA CTD PMID:25172293 Abcd1 Rat 4,4'-sulfonyldiphenol decreases expression ISO Abcd1 (Mus musculus) 6480464 bisphenol S results in decreased expression of ABCD1 mRNA CTD PMID:33297965 and PMID:39298647 Abcd1 Rat 4,4'-sulfonyldiphenol increases expression ISO ABCD1 (Homo sapiens) 6480464 bisphenol S results in increased expression of ABCD1 protein CTD PMID:34186270 Abcd1 Rat 7-ketocholesterol multiple interactions ISO Abcd1 (Mus musculus) 6480464 alpha-Tocopherol inhibits the reaction [7-ketocholesterol results in decreased expression of ABCD1 mRNA] and argan oil inhibits the reaction [7-ketocholesterol results in decreased expression of ABCD1 mRNA] CTD PMID:29065513 Abcd1 Rat 7-ketocholesterol decreases expression ISO Abcd1 (Mus musculus) 6480464 7-ketocholesterol results in decreased expression of ABCD1 mRNA CTD PMID:29065513 Abcd1 Rat acrylamide decreases expression ISO ABCD1 (Homo sapiens) 6480464 Acrylamide results in decreased expression of ABCD1 mRNA CTD PMID:32763439 Abcd1 Rat aristolochic acid A increases expression ISO ABCD1 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of ABCD1 mRNA CTD PMID:33212167 Abcd1 Rat arsenite(3-) decreases expression ISO Abcd1 (Mus musculus) 6480464 arsenite results in decreased expression of ABCD1 protein CTD PMID:37955338 Abcd1 Rat aspartame multiple interactions ISO Abcd1 (Mus musculus) 6480464 [Fats more ... CTD PMID:23783067 Abcd1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of ABCD1 mRNA CTD PMID:25181051 Abcd1 Rat bisphenol A increases expression ISO ABCD1 (Homo sapiens) 6480464 bisphenol A results in increased expression of ABCD1 protein CTD PMID:34186270 Abcd1 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of ABCD1 gene CTD PMID:28505145 Abcd1 Rat Bisphenol B increases expression ISO ABCD1 (Homo sapiens) 6480464 bisphenol B results in increased expression of ABCD1 protein CTD PMID:34186270 Abcd1 Rat bisphenol F increases expression ISO ABCD1 (Homo sapiens) 6480464 bisphenol F results in increased expression of ABCD1 protein CTD PMID:34186270 Abcd1 Rat cadmium atom multiple interactions ISO ABCD1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of ABCD1 mRNA CTD PMID:35301059 Abcd1 Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of ABCD1 mRNA CTD PMID:33453195 Abcd1 Rat cadmium dichloride multiple interactions ISO ABCD1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of ABCD1 mRNA CTD PMID:35301059 Abcd1 Rat chlormequat chloride increases expression EXP 6480464 Chlormequat results in increased expression of ABCD1 protein CTD PMID:34958886 Abcd1 Rat cisplatin decreases expression ISO ABCD1 (Homo sapiens) 6480464 Cisplatin results in decreased expression of ABCD1 mRNA CTD PMID:27594783 Abcd1 Rat cisplatin multiple interactions ISO ABCD1 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of ABCD1 mRNA CTD PMID:27392435 Abcd1 Rat clofibric acid multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of ABCD1 mRNA CTD PMID:17602206 Abcd1 Rat dicrotophos increases expression ISO ABCD1 (Homo sapiens) 6480464 dicrotophos results in increased expression of ABCD1 mRNA CTD PMID:28302478 Abcd1 Rat disodium selenite decreases expression ISO ABCD1 (Homo sapiens) 6480464 Sodium Selenite results in decreased expression of ABCD1 mRNA CTD PMID:18175754 Abcd1 Rat doxorubicin decreases expression ISO ABCD1 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of ABCD1 mRNA CTD PMID:29803840 Abcd1 Rat epoxiconazole decreases expression ISO Abcd1 (Mus musculus) 6480464 epoxiconazole results in decreased expression of ABCD1 mRNA CTD PMID:35436446 Abcd1 Rat fenthion increases expression ISO Abcd1 (Mus musculus) 6480464 Fenthion results in increased expression of ABCD1 mRNA CTD PMID:34813904 Abcd1 Rat fluoranthene multiple interactions ISO Abcd1 (Mus musculus) 6480464 [1-methylanthracene co-treated with fluoranthene] results in decreased expression of ABCD1 mRNA CTD PMID:28329830 Abcd1 Rat hypochlorous acid decreases expression ISO Abcd1 (Mus musculus) 6480464 Hypochlorous Acid results in decreased expression of ABCD1 mRNA CTD PMID:19376150 Abcd1 Rat kojic acid multiple interactions ISO Abcd1 (Mus musculus) 6480464 [Diethylnitrosamine co-treated with kojic acid] results in increased expression of ABCD1 mRNA CTD PMID:17917374 Abcd1 Rat methotrexate decreases expression ISO ABCD1 (Homo sapiens) 6480464 Methotrexate results in decreased expression of ABCD1 mRNA CTD PMID:17400583 Abcd1 Rat monosodium L-glutamate multiple interactions ISO Abcd1 (Mus musculus) 6480464 [Fats more ... CTD PMID:23783067 Abcd1 Rat N-ethyl-N-nitrosourea increases mutagenesis ISO Abcd1 (Mus musculus) 6480464 Ethylnitrosourea results in increased mutagenesis of ABCD1 mRNA CTD PMID:27776689 Abcd1 Rat N-nitrosodiethylamine multiple interactions ISO Abcd1 (Mus musculus) 6480464 [Diethylnitrosamine co-treated with kojic acid] results in increased expression of ABCD1 mRNA CTD PMID:17917374 Abcd1 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of ABCD1 mRNA CTD PMID:17602206 Abcd1 Rat nitrates multiple interactions ISO Abcd1 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of ABCD1 mRNA CTD PMID:35964746 Abcd1 Rat paracetamol increases expression ISO ABCD1 (Homo sapiens) 6480464 Acetaminophen results in increased expression of ABCD1 mRNA CTD PMID:22230336 Abcd1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Abcd1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of ABCD1 mRNA CTD PMID:36331819 Abcd1 Rat phenobarbital increases expression ISO Abcd1 (Mus musculus) 6480464 Phenobarbital results in increased expression of ABCD1 mRNA CTD PMID:19482888 Abcd1 Rat phenobarbital multiple interactions ISO Abcd1 (Mus musculus) 6480464 NR1I3 protein affects the reaction [Phenobarbital results in increased expression of ABCD1 mRNA] CTD PMID:19482888 Abcd1 Rat potassium chromate decreases expression ISO ABCD1 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of ABCD1 mRNA CTD PMID:22714537 Abcd1 Rat potassium dichromate decreases expression ISO Abcd1 (Mus musculus) 6480464 Potassium Dichromate results in decreased expression of ABCD1 mRNA CTD PMID:23608068 Abcd1 Rat progesterone affects expression ISO Abcd1 (Mus musculus) 6480464 Progesterone affects the expression of ABCD1 mRNA CTD PMID:17251523 Abcd1 Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of ABCD1 mRNA CTD PMID:28374803 Abcd1 Rat silicon dioxide increases expression ISO ABCD1 (Homo sapiens) 6480464 Silicon Dioxide results in increased expression of ABCD1 mRNA CTD PMID:34973136 Abcd1 Rat sodium arsenite increases expression ISO ABCD1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of ABCD1 mRNA CTD PMID:38568856 Abcd1 Rat sodium arsenite increases expression ISO Abcd1 (Mus musculus) 6480464 sodium arsenite results in increased expression of ABCD1 mRNA CTD PMID:36209798 Abcd1 Rat Soman increases expression EXP 6480464 Soman results in increased expression of ABCD1 mRNA CTD PMID:19281266 Abcd1 Rat sunitinib decreases expression ISO ABCD1 (Homo sapiens) 6480464 Sunitinib results in decreased expression of ABCD1 mRNA CTD PMID:31533062 Abcd1 Rat tamoxifen decreases expression ISO Abcd1 (Mus musculus) 6480464 Tamoxifen results in decreased expression of ABCD1 mRNA CTD PMID:25123088 Abcd1 Rat tert-butyl hydroperoxide increases expression ISO Abcd1 (Mus musculus) 6480464 tert-Butylhydroperoxide results in increased expression of ABCD1 mRNA CTD PMID:15003993 Abcd1 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of ABCD1 mRNA] CTD PMID:31150632 Abcd1 Rat tetrachloromethane decreases expression ISO Abcd1 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of ABCD1 mRNA CTD PMID:31919559 Abcd1 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of ABCD1 mRNA CTD PMID:31150632 Abcd1 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of ABCD1 mRNA CTD PMID:23411599 Abcd1 Rat titanium dioxide increases expression ISO ABCD1 (Homo sapiens) 6480464 titanium dioxide results in increased expression of ABCD1 mRNA CTD PMID:34973136 Abcd1 Rat triphenyl phosphate affects expression ISO ABCD1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of ABCD1 mRNA CTD PMID:37042841 Abcd1 Rat urethane increases expression ISO ABCD1 (Homo sapiens) 6480464 Urethane results in increased expression of ABCD1 mRNA CTD PMID:28818685 Abcd1 Rat zidovudine increases expression ISO ABCD1 (Homo sapiens) 6480464 Zidovudine results in increased expression of ABCD1 mRNA CTD PMID:24292225
Imported Annotations - SMPDB
(+)-schisandrin B (EXP) (1->4)-beta-D-glucan (ISO) (R,R,R)-alpha-tocopherol (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-palmitoylglycerol (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 4,4'-sulfonyldiphenol (ISO) 7-ketocholesterol (ISO) acrylamide (ISO) aristolochic acid A (ISO) arsenite(3-) (ISO) aspartame (ISO) bisphenol A (EXP,ISO) Bisphenol B (ISO) bisphenol F (ISO) cadmium atom (ISO) cadmium dichloride (EXP,ISO) chlormequat chloride (EXP) cisplatin (ISO) clofibric acid (EXP) dicrotophos (ISO) disodium selenite (ISO) doxorubicin (ISO) epoxiconazole (ISO) fenthion (ISO) fluoranthene (ISO) hypochlorous acid (ISO) kojic acid (ISO) methotrexate (ISO) monosodium L-glutamate (ISO) N-ethyl-N-nitrosourea (ISO) N-nitrosodiethylamine (EXP,ISO) nitrates (ISO) paracetamol (ISO) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (ISO) potassium chromate (ISO) potassium dichromate (ISO) progesterone (ISO) rotenone (EXP) silicon dioxide (ISO) sodium arsenite (ISO) Soman (EXP) sunitinib (ISO) tamoxifen (ISO) tert-butyl hydroperoxide (ISO) tetrachloromethane (EXP,ISO) thioacetamide (EXP) titanium dioxide (ISO) triphenyl phosphate (ISO) urethane (ISO) zidovudine (ISO)
Biological Process
alpha-linolenic acid metabolic process (ISO) fatty acid beta-oxidation (IBA,ISO,ISS) fatty acid biosynthetic process (ISO) fatty acid derivative biosynthetic process (ISO) fatty acid elongation (ISO,ISS) fatty acid homeostasis (ISO) fatty-acyl-CoA transport (IEA) linoleic acid metabolic process (ISO) long-chain fatty acid biosynthetic process (ISO) long-chain fatty acid catabolic process (ISO,ISS) long-chain fatty acid import into peroxisome (IBA,IEA,ISO,ISS) myelin maintenance (ISO) negative regulation of cytokine production involved in inflammatory response (ISO,ISS) negative regulation of reactive oxygen species biosynthetic process (ISO,ISS) neuron projection maintenance (ISO) peroxisome organization (IBA,ISO) positive regulation of fatty acid beta-oxidation (ISO,ISS) positive regulation of unsaturated fatty acid biosynthetic process (ISO) regulation of cellular response to oxidative stress (ISO) regulation of fatty acid beta-oxidation (ISO) regulation of mitochondrial depolarization (ISO) regulation of oxidative phosphorylation (ISO) sterol homeostasis (ISO) transmembrane transport (IEA) unsaturated fatty acid biosynthetic process (ISO) very long-chain fatty acid catabolic process (IBA,IMP,ISO,ISS) very long-chain fatty acid metabolic process (ISO,ISS) very long-chain fatty-acyl-CoA catabolic process (ISO,ISS)
Molecular Function
ABC-type fatty-acyl-CoA transporter activity (IEA,ISO,ISS) ABC-type transporter activity (IEA) ADP binding (ISO) amide transmembrane transporter activity (ISO) ATP binding (IBA,IDA,IEA,ISO) ATP hydrolysis activity (IEA,ISO,ISS) ATPase-coupled transmembrane transporter activity (IBA,IEA,ISO,ISS) enzyme binding (ISO) fatty acyl-CoA hydrolase activity (ISO,ISS) hydrolase activity (IEA) identical protein binding (ISO) long-chain fatty acid transmembrane transporter activity (IBA,IEA,ISO,ISS) nucleobase-containing compound transmembrane transporter activity (ISO) nucleotide binding (IEA) organophosphate ester transmembrane transporter activity (ISO) protein binding (IPI,ISO) protein heterodimerization activity (IDA) protein homodimerization activity (IDA,ISO) sulfur compound transmembrane transporter activity (ISO) very long-chain fatty acyl-CoA hydrolase activity (IEA)
1.
Topology of ATP-binding domain of adrenoleukodystrophy gene product in peroxisomes.
Contreras M, etal., Arch Biochem Biophys. 1996 Oct 15;334(2):369-79.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Structure-function analysis of peroxisomal ATP-binding cassette transporters using chimeric dimers.
Geillon F, etal., J Biol Chem. 2014 Aug 29;289(35):24511-20. doi: 10.1074/jbc.M114.575506. Epub 2014 Jul 20.
4.
Peroxisomal ATP-binding cassette transporters form mainly tetramers.
Geillon F, etal., J Biol Chem. 2017 Apr 28;292(17):6965-6977. doi: 10.1074/jbc.M116.772806. Epub 2017 Mar 3.
5.
Substrate specificity overlap and interaction between adrenoleukodystrophy protein (ALDP/ABCD1) and adrenoleukodystrophy-related protein (ALDRP/ABCD2).
Genin EC, etal., J Biol Chem. 2011 Mar 11;286(10):8075-8084. doi: 10.1074/jbc.M110.211912. Epub 2011 Jan 5.
6.
Identification of a two base pair deletion in five unrelated families with adrenoleukodystrophy: a possible hot spot for mutations.
Kemp S, etal., Biochem Biophys Res Commun. 1994 Jul 29;202(2):647-53.
7.
Molecular organization of peroxisomal enzymes: protein-protein interactions in the membrane and in the matrix.
Makkar RS, etal., Arch Biochem Biophys. 2006 Jul 15;451(2):128-40. Epub 2006 May 24.
8.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
9.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
10.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
11.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
12.
Intraperoxisomal localization of very-long-chain fatty acyl-CoA synthetase: implication in X-adrenoleukodystrophy.
Smith BT, etal., Exp Cell Res. 2000 Feb 1;254(2):309-20.
13.
ATP binding/hydrolysis by and phosphorylation of peroxisomal ATP-binding cassette proteins PMP70 (ABCD3) and adrenoleukodystrophy protein (ABCD1).
Tanaka AR, etal., J Biol Chem. 2002 Oct 18;277(42):40142-7. Epub 2002 Aug 9.
Abcd1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 X 156,579,669 - 156,601,448 (+) NCBI GRCr8 mRatBN7.2 X 151,428,334 - 151,450,115 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl X 151,428,578 - 151,450,115 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx X 153,569,626 - 153,591,020 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 X 157,132,856 - 157,154,250 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 X 154,804,685 - 154,826,079 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 X 157,073,860 - 157,095,652 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 157,072,736 - 157,095,274 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 152,823,436 - 152,844,829 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 X 159,614,569 - 159,635,963 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 1 136,439,697 - 136,461,090 (-) NCBI Celera Cytogenetic Map X q37 NCBI
ABCD1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 X 153,724,856 - 153,744,755 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl X 153,724,856 - 153,744,755 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 X 152,990,311 - 153,010,209 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 X 152,643,530 - 152,663,375 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 X 152,511,182 - 152,531,028 NCBI Celera X 153,224,004 - 153,243,898 (+) NCBI Celera Cytogenetic Map X q28 NCBI HuRef X 141,647,579 - 141,667,479 (+) NCBI HuRef CHM1_1 X 152,864,732 - 152,884,627 (+) NCBI CHM1_1 T2T-CHM13v2.0 X 151,998,519 - 152,018,419 (+) NCBI T2T-CHM13v2.0
Abcd1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 X 72,760,203 - 72,782,140 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl X 72,760,203 - 72,782,140 (+) Ensembl GRCm39 Ensembl GRCm38 X 73,716,597 - 73,738,534 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl X 73,716,597 - 73,738,534 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 X 70,961,936 - 70,983,626 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 X 69,969,317 - 69,991,007 (+) NCBI MGSCv36 mm8 Celera X 64,970,295 - 64,991,971 (+) NCBI Celera Cytogenetic Map X A7.3 NCBI cM Map X 37.39 NCBI
Abcd1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955580 459,715 - 475,774 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955580 459,715 - 475,363 (+) NCBI ChiLan1.0 ChiLan1.0
ABCD1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 X 153,764,997 - 153,785,252 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 X 153,768,686 - 153,788,864 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 X 143,275,165 - 143,295,283 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 X 153,162,412 - 153,182,424 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl X 153,162,412 - 153,182,424 (+) Ensembl panpan1.1 panPan2
ABCD1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 X 121,545,690 - 121,564,117 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl X 121,545,586 - 121,563,186 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha X 106,875,063 - 106,895,708 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 X 124,687,215 - 124,707,872 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl X 124,687,201 - 124,705,644 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 X 120,456,646 - 120,477,290 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 X 122,971,670 - 122,992,305 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 X 122,733,767 - 122,754,413 (+) NCBI UU_Cfam_GSD_1.0
Abcd1
ABCD1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl X 124,485,076 - 124,501,741 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 X 124,485,076 - 124,501,742 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 X 142,049,646 - 142,066,321 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ABCD1
Abcd1
.
Predicted Target Of
Count of predictions: 381 Count of miRNA genes: 192 Interacting mature miRNAs: 226 Transcripts: ENSRNOT00000025863 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
634346 Insul4 Insulin level QTL 4 0 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) X 126975089 152453651 Rat 10059603 Bw174 Body weight QTL 174 3.4 0.025 body mass (VT:0001259) body weight (CMO:0000012) X 113937816 152453651 Rat
GDB:376683
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 X 151,442,695 - 151,442,776 (-) MAPPER mRatBN7.2 Rnor_6.0 X 157,081,197 - 157,081,277 NCBI Rnor6.0 Rnor_5.0 1 152,830,516 - 152,830,596 UniSTS Rnor5.0 RGSC_v3.4 X 159,628,803 - 159,628,883 UniSTS RGSC3.4 Celera 1 136,446,781 - 136,446,861 UniSTS Cytogenetic Map X q37 UniSTS
UniSTS:238038
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 X 156,601,023 - 156,601,204 (+) Marker Load Pipeline mRatBN7.2 X 151,449,689 - 151,449,871 (-) MAPPER mRatBN7.2 Rnor_6.0 X 157,074,104 - 157,074,285 NCBI Rnor6.0 Rnor_5.0 1 152,823,423 - 152,823,604 UniSTS Rnor5.0 RGSC_v3.4 X 159,635,795 - 159,635,976 UniSTS RGSC3.4 Celera 1 136,439,684 - 136,439,865 UniSTS Cytogenetic Map X q37 UniSTS
This gene Abcd1 is modified in the following models/strains:
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000084088 ⟹ ENSRNOP00000070359
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl X 151,428,578 - 151,450,115 (+) Ensembl Rnor_6.0 Ensembl X 157,072,736 - 157,095,274 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000107613 ⟹ ENSRNOP00000083864
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl X 151,428,578 - 151,450,115 (+) Ensembl
RefSeq Acc Id:
NM_001108821 ⟹ NP_001102291
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 156,579,797 - 156,601,191 (+) NCBI mRatBN7.2 X 151,428,461 - 151,449,858 (+) NCBI Rnor_6.0 X 157,074,117 - 157,095,511 (-) NCBI Rnor_5.0 1 152,823,436 - 152,844,829 (-) NCBI RGSC_v3.4 X 159,614,569 - 159,635,963 (+) RGD Celera 1 136,439,697 - 136,461,090 (-) NCBI
Sequence:
CTTGGTGTAGACGCTGTGGTTACTGCCCGGCTGCAGAGCGGACAAACACGCCTAGTGCCCCGGGGAGGGGCGTCACGGGGGGGGGGGAGGAGCAGTAAAGAAGAGGGAGGTGGAAGGGAAGAGACAAC
hide sequence
RefSeq Acc Id:
XM_039099912 ⟹ XP_038955840
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 156,579,694 - 156,601,448 (+) NCBI mRatBN7.2 X 151,428,346 - 151,450,115 (+) NCBI
RefSeq Acc Id:
XR_005498011
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 156,579,669 - 156,600,124 (+) NCBI mRatBN7.2 X 151,428,334 - 151,448,791 (+) NCBI
RefSeq Acc Id:
NP_001102291 ⟸ NM_001108821
- UniProtKB:
D3ZHR2 (UniProtKB/TrEMBL), A0A8I5ZWT6 (UniProtKB/TrEMBL)
- Sequence:
MPVLSTPSRPSRVTTLKRTAVVLALTAYGVHKIYPLVRQCLTPARGPQVPAGESTQEASGATTAKAGMNRVFLQRLLVLLRLLFPGVLCRETGLLALHSAALVSRTFLSVYVARLDGRLARCIVRKDP
hide sequence
Ensembl Acc Id:
ENSRNOP00000070359 ⟸ ENSRNOT00000084088
RefSeq Acc Id:
XP_038955840 ⟸ XM_039099912
- Peptide Label:
isoform X1
Ensembl Acc Id:
ENSRNOP00000083864 ⟸ ENSRNOT00000107613
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-12-09
Abcd1
ATP binding cassette subfamily D member 1
Abcd1
ATP-binding cassette, subfamily D (ALD), member 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2010-11-16
Abcd1
ATP-binding cassette, subfamily D (ALD), member 1
Abcd1
ATP-binding cassette, sub-family D (ALD), member 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Abcd1
ATP-binding cassette, sub-family D (ALD), member 1
Abcd1_predicted
ATP-binding cassette, sub-family D (ALD), member 1 (predicted)
'predicted' is removed
2292626 APPROVED
2006-03-30
Abcd1_predicted
ATP-binding cassette, sub-family D (ALD), member 1 (predicted)
RGD1562128_predicted
similar to mALDP (predicted)
Symbol and Name updated
1299863 APPROVED
2006-03-07
RGD1562128_predicted
similar to mALDP (predicted)
LOC363516
similar to mALDP
Symbol and Name status set to approved
1299863 APPROVED
2006-02-09
LOC363516
similar to mALDP
Symbol and Name status set to provisional
70820 PROVISIONAL
