Abcd3 (ATP binding cassette subfamily D member 3)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Abcd3 (ATP binding cassette subfamily D member 3) Rattus norvegicus

Analyze

Symbol:

Abcd3

Name:

ATP binding cassette subfamily D member 3

RGD ID:

2007

Description:

Enables ATP binding activity and protein self-association. Involved in response to organic cyclic compound and response to xenobiotic stimulus. Located in mitochondrion and peroxisomal membrane. Human ortholog(s) of this gene implicated in Zellweger syndrome and congenital bile acid synthesis defect 5. Orthologous to human ABCD3 (ATP binding cassette subfamily D member 3); INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 3H-1,2-dithiole-3-thione.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

70 kDa peroxisomal membrane protein; 70-kDa peroxisomal membrane protein; ATP-binding cassette sub-family D member 3; ATP-binding cassette, sub-family D (ALD), member 3; ATP-binding cassette, subfamily D (ALD), member 3; Peroxisomal membrane protein 1; PMP70; PMP70, 70-kDa peroxisomal membrane protein; Pxmp1

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	2	209,852,087 - 209,905,763 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	209,852,087 - 209,906,020 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	217,515,099 - 217,568,654 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	2	215,422,840 - 215,476,397 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	2	210,264,674 - 210,318,230 (-)	NCBI	Rnor_WKY
Rnor_6.0	2	225,335,708 - 225,389,120 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	225,335,718 - 225,389,120 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	243,374,189 - 243,409,604 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	218,396,071 - 218,432,172 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	218,359,132 - 218,395,230 (-)	NCBI
Celera	2	202,282,471 - 202,317,962 (-)	NCBI		Celera
RH 3.4 Map	2	1501.0	RGD
Cytogenetic Map	2	q41	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Colorectal Neoplasms (ISO)

congenital bile acid synthesis defect 5 (ISO)

genetic disease (ISO)

Zellweger syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-catechin (ISO)

(+)-schisandrin B (EXP)

(-)-epigallocatechin 3-gallate (ISO)

(R,R,R)-alpha-tocopherol (ISO)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-hydroxypropanoic acid (ISO)

3H-1,2-dithiole-3-thione (EXP)

4,4'-diaminodiphenylmethane (EXP)

4,4'-sulfonyldiphenol (ISO)

7-ketocholesterol (ISO)

9-cis-retinoic acid (EXP)

acetamide (EXP)

acrylamide (EXP)

aflatoxin B1 (ISO)

aflatoxin M1 (ISO)

aldrin (ISO)

all-trans-retinoic acid (EXP,ISO)

amiodarone (ISO)

ammonium chloride (EXP)

antirheumatic drug (ISO)

arachidonic acid (ISO)

aristolochic acid A (ISO)

Aroclor 1254 (ISO)

atrazine (ISO)

benzo[a]pyrene (EXP)

bexarotene (EXP)

bezafibrate (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

calcitriol (ISO)

carbon nanotube (ISO)

chloroethene (ISO)

clofibrate (EXP,ISO)

clofibric acid (ISO)

clothianidin (ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

coumestrol (ISO)

cyclosporin A (ISO)

dibenz[a,h]anthracene (EXP)

dibenzo[a,l]pyrene (EXP)

dichloroacetic acid (ISO)

dicrotophos (ISO)

dorsomorphin (ISO)

endosulfan (EXP)

enilconazole (ISO)

epoxiconazole (ISO)

fenofibrate (ISO)

finasteride (EXP)

fluoranthene (EXP)

folic acid (ISO)

fomesafen (ISO)

formaldehyde (ISO)

furan (EXP)

gentamycin (EXP)

glafenine (EXP)

indole-3-methanol (EXP)

ivermectin (ISO)

leflunomide (ISO)

MeIQx (ISO)

methamphetamine (ISO)

methapyrilene (EXP)

methotrexate (ISO)

methyl methanesulfonate (ISO)

Muraglitazar (EXP)

nickel atom (ISO)

oleic acid (ISO)

Oxyfluorfen (ISO)

ozone (ISO)

paracetamol (ISO)

perfluorooctane-1-sulfonic acid (EXP,ISO)

perfluorooctanoic acid (EXP,ISO)

phenylmercury acetate (ISO)

pirinixic acid (ISO)

piroxicam (ISO)

potassium chromate (ISO)

pravastatin (ISO)

progesterone (ISO)

propiconazole (ISO)

quercetin (ISO)

rac-lactic acid (ISO)

resveratrol (ISO)

rotenone (EXP)

sarin (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

sodium fluoride (ISO)

sulindac (EXP)

tamoxifen (ISO)

temozolomide (ISO)

Tesaglitazar (EXP)

testosterone (ISO)

tetrachloroethene (ISO)

tetrachloromethane (EXP,ISO)

tetracycline (ISO)

thioacetamide (EXP)

topotecan (ISO)

triacsin C (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

triclosan (ISO)

triptonide (ISO)

troglitazone (EXP)

valproic acid (ISO)

vincristine (ISO)

vorinostat (ISO)

zaragozic acid A (EXP,ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

bile acid and bile salt transport (ISO,ISS)

bile acid biosynthetic process (ISO,ISS)

fatty acid beta-oxidation (IBA,ISO)

fatty acid biosynthetic process (ISO,ISS)

lipid transport (ISO)

long-chain fatty acid import into peroxisome (IBA,IEA,ISO,ISS,TAS)

peroxisome organization (IBA,ISO)

phytanic acid metabolic process (ISO,ISS)

response to organic cyclic compound (IEP)

response to xenobiotic stimulus (IEP)

transmembrane transport (IEA)

very long-chain fatty acid catabolic process (IBA,ISO)

very long-chain fatty acid metabolic process (ISO)

Cellular Component

intracellular membrane-bounded organelle (ISO)

membrane (IEA,NAS)

mitochondrion (IDA)

peroxisomal matrix (ISO)

peroxisomal membrane (IBA,IDA,IEA,ISO)

peroxisome (IDA,ISO,NAS)

Molecular Function

ABC-type transporter activity (IEA)

acyl-CoA hydrolase activity (ISO,ISS)

ATP binding (IDA,IEA,ISO)

ATP hydrolysis activity (IEA,ISO,ISS)

ATPase-coupled transmembrane transporter activity (ISO,TAS)

long-chain fatty acid transporter activity (IBA,IEA,ISO,ISS)

protein binding (IPI,ISO)

protein homodimerization activity (ISO)

protein self-association (IDA)

References

References - curated

#	Reference Title	Reference Citation
1.	Fenofibrate differently alters expression of genes encoding ATP-binding transporter proteins of the peroxisomal membrane.	Albet S, etal., FEBS Lett. 1997 Apr 1;405(3):394-7.
2.	Restoration of peroxisome biogenesis in a peroxisome-deficient mammalian cell line by expression of either the 35 kDa or the 70 kDa peroxisomal membrane proteins.	Gartner J, etal., J Inherit Metab Dis 1994;17(3):327-9.
3.	Mutations in the 70K peroxisomal membrane protein gene in Zellweger syndrome.	Gartner J, etal., Nat Genet. 1992 Apr;1(1):16-23.
4.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
6.	The 70-kDa peroxisomal membrane protein is a member of the Mdr (P-glycoprotein)-related ATP-binding protein superfamily.	Kamijo K, etal., J Biol Chem 1990 Mar 15;265(8):4534-40.
7.	Nucleotide-induced conformational changes of PMP70, an ATP binding cassette transporter on rat liver peroxisomal membranes.	Kashiwayama Y, etal., Biochem Biophys Res Commun 2002 Mar 15;291(5):1245-51.
8.	70-kDa peroxisomal membrane protein related protein (P70R/ABCD4) localizes to endoplasmic reticulum not peroxisomes, and NH2-terminal hydrophobic property determines the subcellular localization of ABC subfamily D proteins.	Kashiwayama Y, etal., Exp Cell Res. 2009 Jan 15;315(2):190-205. doi: 10.1016/j.yexcr.2008.10.031. Epub 2008 Nov 3.
9.	Proteomic analysis of rat liver peroxisome: presence of peroxisome-specific isozyme of Lon protease.	Kikuchi M, etal., J Biol Chem. 2004 Jan 2;279(1):421-8. Epub 2003 Oct 15.
10.	High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.	Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
11.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
12.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
13.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
14.	RefSeq and LocusLink: NCBI gene-centered resources	Pruitt KD and Maglott DR, Nucleic Acids Res. 2001 Jan 1;29(1):137-40.
15.	Identification of a 24 kDa intrinsic membrane protein from mammalian peroxisomes.	Reguenga C, etal., Biochim Biophys Acta. 1999 Jun 9;1445(3):337-41.
16.	GOA pipeline	RGD automated data pipeline
17.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
18.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
19.	ATP binding/hydrolysis by and phosphorylation of peroxisomal ATP-binding cassette proteins PMP70 (ABCD3) and adrenoleukodystrophy protein (ABCD1).	Tanaka AR, etal., J Biol Chem. 2002 Oct 18;277(42):40142-7. Epub 2002 Aug 9.
20.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
21.	Differential induction of peroxisomal populations in subcellular fractions of rat liver.	Wilcke M and Alexson SE, Biochim Biophys Acta. 2001 Jan 12;1544(1-2):358-69.

Additional References at PubMed

PMID:9425230	PMID:9765053	PMID:9922452	PMID:10527525	PMID:10704444	PMID:11248239	PMID:11453642	PMID:12865426	PMID:12915479	PMID:14651853	PMID:16344115	PMID:17542813
PMID:17609205	PMID:18178290	PMID:18614015	PMID:18992293	PMID:19479899	PMID:19686593	PMID:19946888	PMID:20007743	PMID:21460186	PMID:21502359	PMID:21525035	PMID:22871113
PMID:25168382	PMID:31505169

Genomics

Comparative Map Data

Abcd3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	2	209,852,087 - 209,905,763 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	209,852,087 - 209,906,020 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	217,515,099 - 217,568,654 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	2	215,422,840 - 215,476,397 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	2	210,264,674 - 210,318,230 (-)	NCBI	Rnor_WKY
Rnor_6.0	2	225,335,708 - 225,389,120 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	225,335,718 - 225,389,120 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	243,374,189 - 243,409,604 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	218,396,071 - 218,432,172 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	218,359,132 - 218,395,230 (-)	NCBI
Celera	2	202,282,471 - 202,317,962 (-)	NCBI		Celera
RH 3.4 Map	2	1501.0	RGD
Cytogenetic Map	2	q41	NCBI

ABCD3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	94,385,131 - 94,518,663 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	1	94,418,389 - 94,518,666 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	94,883,945 - 94,984,219 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	94,656,599 - 94,756,672 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	94,596,031 - 94,696,105	NCBI
Celera	1	93,137,599 - 93,238,680 (+)	NCBI		Celera
Cytogenetic Map	1	p21.3	ENTREZGENE
HuRef	1	93,005,619 - 93,105,917 (+)	NCBI		HuRef
CHM1_1	1	94,998,783 - 95,099,070 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	94,266,512 - 94,366,700 (+)	NCBI		T2T-CHM13v2.0

Abcd3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	121,552,553 - 121,609,851 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	121,552,423 - 121,608,951 (-)	Ensembl		GRCm39 Ensembl
GRCm38	3	121,758,904 - 121,815,302 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	121,758,774 - 121,815,302 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	3	121,461,828 - 121,518,133 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	3	121,750,933 - 121,807,238 (-)	NCBI		MGSCv36	mm8
Celera	3	128,155,294 - 128,218,276 (-)	NCBI		Celera
Cytogenetic Map	3	G1	NCBI
cM Map	3	52.94	NCBI

Abcd3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955423	280,497 - 359,711 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955423	280,497 - 359,711 (-)	NCBI	ChiLan1.0	ChiLan1.0

ABCD3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	1	95,808,027 - 95,907,864 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	95,808,027 - 95,907,864 (+)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	1	97,079,326 - 97,179,886 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

ABCD3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	54,740,704 - 54,816,854 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	6	54,742,111 - 54,817,235 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	6	57,449,009 - 57,525,742 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	55,116,365 - 55,193,330 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	6	55,116,488 - 55,193,330 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	6	54,797,137 - 54,873,570 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	54,781,385 - 54,858,240 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	55,234,335 - 55,310,979 (-)	NCBI		UU_Cfam_GSD_1.0

Abcd3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	104,201,915 - 104,288,290 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936537	4,659,484 - 4,746,616 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936537	4,659,685 - 4,745,992 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ABCD3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	122,847,927 - 122,953,257 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	4	122,847,925 - 122,929,454 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	134,491,144 - 134,572,292 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ABCD3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	38,750,147 - 38,846,011 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	38,748,787 - 38,845,989 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666033	79,200,937 - 79,302,556 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Abcd3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624742	3,142,570 - 3,236,728 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624742	3,146,000 - 3,236,473 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Abcd3
253 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	537
Count of miRNA genes:	263
Interacting mature miRNAs:	318
Transcripts:	ENSRNOT00000016739
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118463	226797303	Rat
1581569	Uae32	Urinary albumin excretion QTL 32		0.0001	urine protein amount (VT:0005160)	urine albumin excretion rate (CMO:0000757)	2	78665619	219826953	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	78665619	249053267	Rat
8662832	Vetf7	Vascular elastic tissue fragility QTL 7	3.5		aorta elastin amount (VT:0003905)	aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002)	2	81689826	221035911	Rat
1354622	Kidm16	Kidney mass QTL 16	3		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	2	81754530	222436696	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	81754530	227146641	Rat
631507	Bp105	Blood pressure QTL 105		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	112456140	212696837	Rat
634308	Sach6	Saccharin preference QTL 6	4.9		taste sensitivity trait (VT:0001986)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	2	112456140	212696837	Rat
1578648	Bss11	Bone structure and strength QTL 11	4.7		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	2	114837527	211674221	Rat
1554319	Bmd2	Bone mineral density QTL 2	13.4	0.0001	lumbar vertebra area (VT:0010570)	lumbar vertebra cross-sectional area (CMO:0001689)	2	114837675	212549332	Rat
1359022	Ppulsi1	Prepulse inhibition QTL 1	3.63		prepulse inhibition trait (VT:0003088)	acoustic startle response measurement (CMO:0001519)	2	136916935	213594495	Rat
1331794	Bp202	Blood pressure QTL 202	3.66819		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	141194931	223265385	Rat
1331805	Cm29	Cardiac mass QTL 29	3.50746		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	2	141194931	223265385	Rat
724568	Uae13	Urinary albumin excretion QTL 13	4.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	2	143157029	210020885	Rat
1641925	Alcrsp2	Alcohol response QTL 2			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	149559561	221167075	Rat
1641891	Alcrsp17	Alcohol response QTL 17			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	149559561	249053267	Rat
1358900	Bw48	Body weight QTL 48	4.88		body mass (VT:0001259)	body weight (CMO:0000012)	2	157142078	211086598	Rat
8662843	Vetf9	Vascular elastic tissue fragility QTL 9	2.05		thoracic aorta molecular composition trait (VT:0010568)	aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003)	2	157142078	226277316	Rat
1358356	Srcrt1	Stress Responsive Cort QTL1	3.66		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	2	161699179	222436696	Rat
2306901	Bp337	Blood pressure QTL 337		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	164073756	227146641	Rat
1598838	Bp290	Blood pressure QTL 290	1.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	166539266	211539266	Rat
1331734	Bp204	Blood pressure QTL 204	3.61192		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	168358098	223265385	Rat
2307174	Activ3	Activity QTL 3	4.83	0.000058	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	2	168594495	213594495	Rat
61469	Bp16	Blood pressure QTL 16	5.64		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	2	169745596	214745596	Rat
70162	Bp63	Blood pressure QTL 63	5.64		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	2	169745596	214745596	Rat
2293084	Iddm26	Insulin dependent diabetes mellitus QTL 26	2.9		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	174930955	213594495	Rat
2300189	Bmd48	Bone mineral density QTL 48	5.8	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	2	179335906	224335906	Rat
61417	Cia10	Collagen induced arthritis QTL 10	3.4		joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	2	179946951	224946951	Rat
8694435	Bw166	Body weight QTL 166	14.08	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	2	182171407	227171407	Rat
9589044	Scfw1	Subcutaneous fat weight QTL 1	5.8	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	2	182171407	227171407	Rat
8694383	Bw158	Body weight QTL 158	7.69	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	2	182171407	227171407	Rat
8694194	Abfw1	Abdominal fat weight QTL 1	11.7	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	2	182171407	227171407	Rat
738013	Alc15	Alcohol consumption QTL 15	4.1	0.00022	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	2	184165752	229165752	Rat
1359031	Bp275	Blood pressure QTL 275			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	185876309	219753474	Rat
1359031	Bp275	Blood pressure QTL 275			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	185876309	219753474	Rat
61458	Bp10	Blood pressure QTL 10	3.42		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	189020722	215287351	Rat
1298083	Bp158	Blood pressure QTL 158	2.62		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	189020722	215287351	Rat
1331745	Bp203	Blood pressure QTL 203	4.377		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	189599258	218414891	Rat
1581499	Esta2	Estrogen-induced thymic atrophy QTL 2			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	2	189599258	226936289	Rat
61366	Iddm3	Insulin dependent diabetes mellitus QTL 3	4.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	189599258	234599258	Rat
61398	Bp50	Blood pressure QTL 50	4.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	189599258	234599258	Rat
2301408	Kidm36	Kidney mass QTL 36		0.002	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	190613715	226808892	Rat
2317752	Glom23	Glomerulus QTL 23	3.6		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	2	193452645	245889826	Rat
1598813	Memor9	Memory QTL 9	2.7		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	2	199341726	234244620	Rat
1598835	Anxrr18	Anxiety related response QTL 18	2.98		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	2	200990457	245990457	Rat
2298479	Eau5	Experimental allergic uveoretinitis QTL 5		0.0021	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	2	202446871	237938339	Rat
2299161	Iddm33	Insulin dependent diabetes mellitus QTL 33	2.98		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	2	206312063	220876787	Rat
631203	Gluco14	Glucose level QTL 14		0.0001	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	2	206665645	219003804	Rat

Markers in Region

D2Arb23

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	209,852,836 - 209,853,134 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	225,336,447 - 225,336,744	NCBI	Rnor6.0
Rnor_5.0	2	243,374,928 - 243,375,225	UniSTS	Rnor5.0
RGSC_v3.4	2	218,396,809 - 218,397,107	RGD	RGSC3.4
RGSC_v3.4	2	218,396,810 - 218,397,107	UniSTS	RGSC3.4
RGSC_v3.1	2	218,359,871 - 218,360,169	RGD
Celera	2	202,283,210 - 202,283,507	UniSTS
Cytogenetic Map	2	q41	UniSTS

RH128671

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	209,852,127 - 209,852,336 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	225,335,738 - 225,335,946	NCBI	Rnor6.0
Rnor_5.0	2	243,374,219 - 243,374,427	UniSTS	Rnor5.0
RGSC_v3.4	2	218,396,101 - 218,396,309	UniSTS	RGSC3.4
Celera	2	202,282,501 - 202,282,709	UniSTS
RH 3.4 Map	2	1501.4	UniSTS
Cytogenetic Map	2	q41	UniSTS

RH94667

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	209,852,706 - 209,852,860 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	225,336,317 - 225,336,470	NCBI	Rnor6.0
Rnor_5.0	2	243,374,798 - 243,374,951	UniSTS	Rnor5.0
RGSC_v3.4	2	218,396,680 - 218,396,833	UniSTS	RGSC3.4
Celera	2	202,283,080 - 202,283,233	UniSTS
RH 3.4 Map	2	1501.0	UniSTS
Cytogenetic Map	2	q41	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	43	57	41	19	41	8	11	74	35	38	11	8
Low											3
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_012804	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039101772	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039101774	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC117861	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473952	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D90038	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000078	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000016739 ⟹ ENSRNOP00000016739

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	209,852,087 - 209,905,680 (-)	Ensembl
Rnor_6.0 Ensembl	2	225,335,718 - 225,389,120 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000106914 ⟹ ENSRNOP00000085866

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	209,852,087 - 209,906,020 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000110813 ⟹ ENSRNOP00000094858

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	209,852,087 - 209,905,680 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000119497 ⟹ ENSRNOP00000079442

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	209,852,087 - 209,905,680 (-)	Ensembl

RefSeq Acc Id:

NM_012804 ⟹ NP_036936

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	2	209,852,087 - 209,905,680 (-)	NCBI
Rnor_6.0	2	225,335,708 - 225,389,120 (-)	NCBI
Rnor_5.0	2	243,374,189 - 243,409,604 (-)	NCBI
RGSC_v3.4	2	218,396,071 - 218,432,172 (-)	RGD
Celera	2	202,282,471 - 202,317,962 (-)	RGD

Sequence:

show sequence

GAATTCCAGTGCGGCTCGCTCGCCCTGCCGGTGCCATGGCGGCCTTCAGCAAGTACTTGACGGC
GCGGAACTCCTCGCTGGCGGGGGCCGCGTTCCTGCTGTTCTGCCTGCTCCACAAGCGGCGTCGC
GCCCTCGGCCTGCACGGTAAGAAAAGTGGAAAACCGCCATTACAGAATAATGAGAAAGAAGGAA
AGAAAGAGCGAGCTGTGGTGGACAAAGTGTTTTTATCAAGGCTCTCACAGATCCTAAAAATTAT
GGTCCCTAGAACATTTTGTAAAGAGACAGGGTACTTGATACTTATTGCTGTTATGCTGGTATCT
CGAACATACTGTGATGTTTGGATGATTCAAAATGGCACACTGATTGAAAGTGGCATCATTGGTC
GTAGCAGTAAAGATTTCAAGAGATACTTATTCAACTTCATCGCTGCCATGCCTCTTATCTCTCT
GGTTAATAACTTCTTGAAGTATGGGTTAAATGAGCTCAAACTGTGCTTCCGTGTGCGGCTCACT
AGATACCTCTATGAGGAGTATCTCCAAGCCTTCACCTACTATAAAATGGGCAACCTGGATAACA
GAATAGCAAACCCAGACCAGCTGCTTACACAAGATGTAGAAAAGTTTTGTAACAGTGTAGTTGA
TCTTTATTCGAATCTTAGTAAGCCATTTTTAGACATAGTTTTGTATATTTTCAAGTTAACAAGT
GCAATTGGAGCTCAGGGCCCGGCAAGCATGATGGCCTACTTGCTTGTTTCTGGGCTATTCCTAA
CTCGACTCAGAAGACCCATCGGTAAAATGACGATTATGGAGCAGAAGTATGAAGGAGAATATAG
ATTCGTTAATTCACGGCTTATCACTAATAGTGAAGAAATTGCCTTTTACAATGGGAATAAACGA
GAAAAGCAGACAATCCACTCTGTCTTCCGAAAACTGGTGGAACACCTACATAATTTCATTTTCT
TCCGGTTTTCTATGGGTTTCATTGATAGCATCATTGCCAAATATATTGCCACTGTAGTTGGGTA
CCTGGTTGTCAGTCGCCCGTTCCTAGACCTGGCGCATCCGCGACACCTTCACAGCACCCACTCA
GAGCTGCTGGAGGATTACTACCAAAGTGGAAGAATGCTTTTGAGAATGTCTCAAGCTTTGGGGC
GGATAGTTTTGGCTGGGCGTGAAATGACTAGATTGGCTGGTTTTACGGCTCGGATTACGGAATT
AATGCAAGTACTAAAGGATTTAAATCATGGCAAATATGAACGTACAATGGTGTCACAACAGGAT
AAGGGTATTGAAGGAGCACAAGCTAGTCCCTTGATACCTGGTGCTGGAGAAATCATCAATGCAG
ACAACATTATAAAGTTTGATCATGTTCCTTTAGCAACACCAAATGGAGATATCTTGATCCAAGA
CCTTAGTTTTGAAGTTCGATCTGGGGCCAACGTTCTCATTTGTGGTCCAAATGGCTGTGGAAAG
AGCTCCCTCTTCCGTGTTCTTGGTGAATTATGGCCTCTCTTTGGAGGACATCTTACTAAACCTG
AGAGAGGAAAGTTATTTTATGTTCCTCAGCGACCCTATATGACCCTGGGAACACTGAGAGACCA
AGTAATATATCCAGATGGAAAGGAGGATCAGAAGAAGAAGGGGATATCTGACCAAGTGCTGAAG
GGGTACTTGGACAATGTACAGTTGGGCCATATCCTTGAGCGGGAAGGAGGCTGGGACAGTGTTC
AGGACTGGATGGATGTACTCAGCGGAGGAGAAAAACAAAGAATGGCGATGGCAAGATTGTTTTA
TCATAAACCCCAGTTTGCCATTCTGGATGAGTGCACAAGTGCAGTTAGTGTGGATGTGGAAGAC
TACATTTACAGCCACTGTCGGAAGGTTGGCATCACCCTCTTCACTGTCTCACACAGGAAATCCC
TTTGGAAACACCACGAGTACTACCTGCACATGGATGGCAGAGGCAATTATGAATTCAAAAAGAT
CACAGAAGACACAGTTGAGTTCGGATCATAGAGACCATCTGGAGAACTTCACACTTCACAAGAG
AATGAATGAACAGAATGCATTTGTAAACAACGTGCATTGTAAAATAAAGTTAAGCTTGTTTTTT
TTAAAAAAACAAAGCTACAAATTGACTAGATATAGGATAATTGAAACATGTTAAAACATTTAAT
ATTGTATAGGATATTGCTAATTGTGTATATGTTGGTTTAATTATTAATTATGTACTAAGAATGT
CCTTATTCTTGTGGTTAAAAAACCTGCCTGAATTAAATTGGGCTTAAATCAGTGTAACCTGATT
CATGGGATGTAAACCATTTGAAGTCAGCTAATTTGACTTTTATAGCTCTGTCTTTTTCTTTAAT
GAAGAACCCTATTTAAAACTGGGTCATTAGCTGTTTATTCTAACAAAGTAGTCTTGAGTTCCTT
TTTGGGTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTGTGCCCCATGGTAGTGGGAACCAAACC
AATCACAATGTTTTATTGGAACATATTCCATCATCACAGGATAGCATTTATTAAACAGTGGCGG
ATTTCTCTAGCTGCTACATTTATTCTCATTCCTCATACATACCTTGAGGTGCATTTGATTCCAG
GAGAGCCATTTGGGTTTTCTTTAGCTAAATAATAAATGTACCCGTCTCAGTCTTTTGGACTGAG
TCGTTCTGAAGGCTCTCGTGTGGACAGCAGTGTGTGCAGTCTCTTACAGTCCGTGCCTGCTCCA
CATGGTACCAGTCTTACCAGTGCTTGAGAGCTCAGACACACCCTGCTGCATGAAGTTGGAGGTC
TCGGGAGGGTTTTAGATTTTGTGACGGGAACCGGAAAGGCTCGTCAGAGTGTGGCTGTGTCATG
GTGAGCACCACGTGGCTGTAGAGGCCCGACATGAGGTAATGCACTGAGCACACAACGCCACTGC
TGCTGTCTGTGGCTGTGGGTTCTTAAAAGTGCTGGACTTTGTCATGCTCGTGGGCCAATGACAT
TTCCTAGGAGCGGCCTCTGACTCCTGTGCAGCTGCGTCTGTGTCAGCTCTGGCTCCCTGGAACC
ACGAGTGACTTTGCACAAAGGAGGGCTGAGAGCGGACTTGATCAGTAAGTCGTCGTGAATCAGT
TTGCTTGAGTGGGCTCGGAATGGGCCTTATCACGATGGTTTTGTTTCTTCGTAACTCATAATCA
CTGGCTACCAGGATAACCCTGATGTATTGATTCCGTGAATACATCACATTCAATCTTACCATGT
CTCCTTAGCAAACGTGTGTACTTATTTTCTGTTCAGATTAAAAAAAAAAAAAAGGAATTC

hide sequence

RefSeq Acc Id:

XM_039101772 ⟹ XP_038957700

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	2	209,852,087 - 209,905,763 (-)	NCBI

RefSeq Acc Id:

XM_039101774 ⟹ XP_038957702

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	2	209,852,087 - 209,905,647 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_036936	(Get FASTA)	NCBI Sequence Viewer
	XP_038957700	(Get FASTA)	NCBI Sequence Viewer
	XP_038957702	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	BAA14086	(Get FASTA)	NCBI Sequence Viewer
	EDL82089	(Get FASTA)	NCBI Sequence Viewer
	EDL82090	(Get FASTA)	NCBI Sequence Viewer
	EDL82091	(Get FASTA)	NCBI Sequence Viewer
	P16970	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_036936 ⟸ NM_012804

- UniProtKB:

P16970 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MAAFSKYLTARNSSLAGAAFLLFCLLHKRRRALGLHGKKSGKPPLQNNEKEGKKERAVVDKVFL
SRLSQILKIMVPRTFCKETGYLILIAVMLVSRTYCDVWMIQNGTLIESGIIGRSSKDFKRYLFN
FIAAMPLISLVNNFLKYGLNELKLCFRVRLTRYLYEEYLQAFTYYKMGNLDNRIANPDQLLTQD
VEKFCNSVVDLYSNLSKPFLDIVLYIFKLTSAIGAQGPASMMAYLLVSGLFLTRLRRPIGKMTI
MEQKYEGEYRFVNSRLITNSEEIAFYNGNKREKQTIHSVFRKLVEHLHNFIFFRFSMGFIDSII
AKYIATVVGYLVVSRPFLDLAHPRHLHSTHSELLEDYYQSGRMLLRMSQALGRIVLAGREMTRL
AGFTARITELMQVLKDLNHGKYERTMVSQQDKGIEGAQASPLIPGAGEIINADNIIKFDHVPLA
TPNGDILIQDLSFEVRSGANVLICGPNGCGKSSLFRVLGELWPLFGGHLTKPERGKLFYVPQRP
YMTLGTLRDQVIYPDGKEDQKKKGISDQVLKGYLDNVQLGHILEREGGWDSVQDWMDVLSGGEK
QRMAMARLFYHKPQFAILDECTSAVSVDVEDYIYSHCRKVGITLFTVSHRKSLWKHHEYYLHMD
GRGNYEFKKITEDTVEFGS

hide sequence

RefSeq Acc Id:

ENSRNOP00000016739 ⟸ ENSRNOT00000016739

RefSeq Acc Id:	XP_038957700 ⟸ XM_039101772
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I5ZN14 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038957702 ⟸ XM_039101774
- Peptide Label:	isoform X2
- UniProtKB:	A0A8I6A495 (UniProtKB/TrEMBL)

RefSeq Acc Id:

ENSRNOP00000085866 ⟸ ENSRNOT00000106914

RefSeq Acc Id:

ENSRNOP00000079442 ⟸ ENSRNOT00000119497

RefSeq Acc Id:

ENSRNOP00000094858 ⟸ ENSRNOT00000110813

Protein Domains

ABC transmembrane type-1 ABC transporter

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P16970-F1-model_v2	AlphaFold	P16970	1-659	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13691720

Promoter ID:

EPDNEW_R2245

Type:

initiation region

Name:

Abcd3_1

Description:

ATP binding cassette subfamily D member 3

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	2	225,389,173 - 225,389,233	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:2007	AgrOrtholog
BioCyc Gene	G2FUF-51390	BioCyc
Ensembl Genes	ENSRNOG00000011929	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000016739	ENTREZGENE
	ENSRNOP00000016739.5	UniProtKB/Swiss-Prot
	ENSRNOP00000079442	ENTREZGENE
	ENSRNOP00000079442.1	UniProtKB/TrEMBL
	ENSRNOP00000085866	ENTREZGENE
	ENSRNOP00000085866.1	UniProtKB/TrEMBL
	ENSRNOP00000094858.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000016739	ENTREZGENE
	ENSRNOT00000016739.7	UniProtKB/Swiss-Prot
	ENSRNOT00000106914	ENTREZGENE
	ENSRNOT00000106914.1	UniProtKB/TrEMBL
	ENSRNOT00000110813.1	UniProtKB/TrEMBL
	ENSRNOT00000119497	ENTREZGENE
	ENSRNOT00000119497.1	UniProtKB/TrEMBL
Gene3D-CATH	1.20.1560.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	3.40.50.300	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	AAA+_ATPase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ABC1_TM_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ABC1_TM_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ABC_transporter-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ABC_transporter-like_CS	UniProtKB/TrEMBL, UniProtKB/Swiss-Prot
	FA_transporter	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	P-loop_NTPase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:25270	UniProtKB/Swiss-Prot
NCBI Gene	25270	ENTREZGENE
PANTHER	ATP-BINDING CASSETTE SUB-FAMILY D MEMBER 3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ATP-BINDING CASSETTE, SUB-FAMILY D MEMBER	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	ABC_membrane_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ABC_tran	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Abcd3	PhenoGen
PROSITE	ABC_TM1F	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ABC_TRANSPORTER_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ABC_TRANSPORTER_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	AAA	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF52540	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SSF90123	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
TIGR	TC229511
TIGRFAMs	3a01203	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I5ZN14	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6A495	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6ANP9_RAT	UniProtKB/TrEMBL
	ABCD3_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-12-09	Abcd3	ATP binding cassette subfamily D member 3	Abcd3	ATP-binding cassette, subfamily D (ALD), member 3	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2010-11-16	Abcd3	ATP-binding cassette, subfamily D (ALD), member 3	Abcd3	ATP-binding cassette, sub-family D (ALD), member 3	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-06-10	Abcd3	ATP-binding cassette, sub-family D (ALD), member 3			Symbol and Name status set to approved	70586	APPROVED
2001-04-19	Pxmp1	Peroxisomal membrane protein 1			Symbol withdrawn, duplicate entry of Abcd3(RGD:2007)	61478	WITHDRAWN

RGD Curation Notes

Note Type	Note	Reference
gene_cellular_localization	localized to the peroxisomal membrane	631711
gene_domains	contains an ATP-binding domain	631711
gene_function	may form an ATP-binding channel	631711
gene_homology	has similarity to MalK and Mdr ATP-binding proteins	631711
gene_process	may play a role in active transport in peroxisomes	631711
gene_product	peroxisomal membrane protein	631711
gene_product	member of the P-glycoprotein related ATP binding protein superfamily	631711
gene_protein	70-kDa	631711

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM