Symbol:
Pgrmc1
Name:
progesterone receptor membrane component 1
RGD ID:
70890
Description:
Predicted to enable heme binding activity and protein homodimerization activity. Involved in several processes, including learning or memory; modification of synaptic structure; and negative regulation of synapse organization. Located in neuron projection; neuronal cell body; and synapse. Orthologous to human PGRMC1 (progesterone receptor membrane component 1); INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,4,6-trinitrotoluene.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
25-Dx; 25Dx; acidic 25 kDa protein; membrane-associated progesterone receptor component 1; membrane-bound progesterone receptor; MPR; VEMA; ventral midline antigen
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 X 120,698,610 - 120,706,805 (+) NCBI GRCr8 mRatBN7.2 X 115,832,865 - 115,841,060 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl X 115,832,884 - 115,888,682 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx X 117,934,866 - 117,943,066 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 X 121,504,010 - 121,512,210 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 X 119,050,166 - 119,058,365 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 X 123,205,869 - 123,213,880 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 123,205,869 - 123,213,882 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 X 123,352,144 - 123,360,155 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 X 8,265,543 - 8,273,667 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 X 8,271,098 - 8,279,223 (-) NCBI Celera X 115,065,055 - 115,073,267 (+) NCBI Celera Cytogenetic Map X q34 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Pgrmc1 Rat (1->4)-beta-D-glucan multiple interactions ISO Pgrmc1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PGRMC1 mRNA CTD PMID:36331819 Pgrmc1 Rat 1,2-dichloroethane decreases expression ISO Pgrmc1 (Mus musculus) 6480464 ethylene dichloride results in decreased expression of PGRMC1 mRNA CTD PMID:28960355 Pgrmc1 Rat 1,2-dimethylhydrazine decreases expression ISO Pgrmc1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of PGRMC1 mRNA CTD PMID:22206623 Pgrmc1 Rat 1,2-dimethylhydrazine multiple interactions ISO Pgrmc1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of PGRMC1 mRNA CTD PMID:22206623 Pgrmc1 Rat 17alpha-ethynylestradiol affects expression ISO Pgrmc1 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of PGRMC1 mRNA CTD PMID:17555576 Pgrmc1 Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of PGRMC1 protein CTD PMID:32145629 Pgrmc1 Rat 17beta-estradiol decreases expression ISO Pgrmc1 (Mus musculus) 6480464 Estradiol results in decreased expression of PGRMC1 mRNA CTD PMID:39298647 Pgrmc1 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of PGRMC1 mRNA CTD PMID:32145629 Pgrmc1 Rat 2,3',4,4',5-Pentachlorobiphenyl affects expression ISO Pgrmc1 (Mus musculus) 6480464 2 more ... CTD PMID:31388691 Pgrmc1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of PGRMC1 protein CTD PMID:12361703 Pgrmc1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Pgrmc1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to PGRMC1 gene] CTD PMID:28213091 Pgrmc1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Pgrmc1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of PGRMC1 mRNA CTD PMID:21496263 Pgrmc1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO PGRMC1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of PGRMC1 mRNA CTD PMID:21496263 Pgrmc1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Pgrmc1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of PGRMC1 mRNA CTD PMID:21570461 and PMID:28213091 Pgrmc1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of PGRMC1 mRNA CTD PMID:9006096 Pgrmc1 Rat 2,4,6-trinitrotoluene affects expression EXP 6480464 Trinitrotoluene affects the expression of PGRMC1 mRNA CTD PMID:21346803 Pgrmc1 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Pgrmc1 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Pgrmc1 Rat 2-hydroxypropanoic acid decreases expression ISO PGRMC1 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of PGRMC1 mRNA CTD PMID:30851411 Pgrmc1 Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of PGRMC1 mRNA CTD PMID:28522335 Pgrmc1 Rat 4,4'-sulfonyldiphenol increases expression ISO Pgrmc1 (Mus musculus) 6480464 bisphenol S results in increased expression of PGRMC1 mRNA CTD PMID:39298647 Pgrmc1 Rat 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole affects expression EXP 6480464 Omeprazole affects the expression of PGRMC1 mRNA CTD PMID:19483382 Pgrmc1 Rat 6-propyl-2-thiouracil affects expression EXP 6480464 Propylthiouracil affects the expression of PGRMC1 mRNA CTD PMID:19483382 Pgrmc1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of PGRMC1 mRNA CTD PMID:24780913 Pgrmc1 Rat afimoxifene increases expression ISO PGRMC1 (Homo sapiens) 6480464 afimoxifene results in increased expression of PGRMC1 mRNA CTD PMID:16849584 Pgrmc1 Rat amiodarone affects expression EXP 6480464 Amiodarone affects the expression of PGRMC1 mRNA CTD PMID:19483382 Pgrmc1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PGRMC1 mRNA CTD PMID:16483693 Pgrmc1 Rat aristolochic acid A increases expression ISO PGRMC1 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of PGRMC1 mRNA CTD PMID:33212167 Pgrmc1 Rat Aroclor 1254 decreases expression ISO Pgrmc1 (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of PGRMC1 mRNA CTD PMID:23650126 Pgrmc1 Rat arsane multiple interactions ISO PGRMC1 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of PGRMC1 mRNA CTD PMID:39836092 Pgrmc1 Rat arsenic atom multiple interactions ISO PGRMC1 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of PGRMC1 mRNA CTD PMID:39836092 Pgrmc1 Rat arsenite(3-) multiple interactions ISO PGRMC1 (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to PGRMC1 mRNA] CTD PMID:32406909 Pgrmc1 Rat benzbromarone affects expression EXP 6480464 Benzbromarone affects the expression of PGRMC1 mRNA CTD PMID:19483382 Pgrmc1 Rat benzo[a]pyrene increases expression ISO Pgrmc1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of PGRMC1 mRNA CTD PMID:21715664 and PMID:22228805 Pgrmc1 Rat benzo[a]pyrene affects methylation ISO PGRMC1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of PGRMC1 exon and Benzo(a)pyrene affects the methylation of PGRMC1 promoter CTD PMID:27901495 Pgrmc1 Rat bis(2-ethylhexyl) phthalate increases expression ISO Pgrmc1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of PGRMC1 mRNA CTD PMID:33754040 Pgrmc1 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Testosterone] results in increased expression of PGRMC1 mRNA CTD PMID:26496021 Pgrmc1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PGRMC1 mRNA and bisphenol A results in decreased expression of PGRMC1 protein CTD PMID:32145629 and PMID:34947998 Pgrmc1 Rat bisphenol A decreases expression ISO PGRMC1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of PGRMC1 mRNA and bisphenol A results in decreased expression of PGRMC1 protein CTD PMID:37084542 and PMID:37567409 Pgrmc1 Rat bisphenol A affects expression ISO PGRMC1 (Homo sapiens) 6480464 bisphenol A affects the expression of PGRMC1 mRNA CTD PMID:30903817 Pgrmc1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of PGRMC1 mRNA CTD PMID:25181051 Pgrmc1 Rat bisphenol AF increases expression ISO PGRMC1 (Homo sapiens) 6480464 bisphenol AF results in increased expression of PGRMC1 protein CTD PMID:34186270 Pgrmc1 Rat Bisphenol B increases expression ISO PGRMC1 (Homo sapiens) 6480464 bisphenol B results in increased expression of PGRMC1 protein CTD PMID:34186270 Pgrmc1 Rat bisphenol F multiple interactions ISO PGRMC1 (Homo sapiens) 6480464 [bisphenol F co-treated with Fulvestrant] results in increased methylation of PGRMC1 gene CTD PMID:31601247 Pgrmc1 Rat cadmium atom multiple interactions ISO PGRMC1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of PGRMC1 mRNA CTD PMID:35301059 Pgrmc1 Rat cadmium dichloride multiple interactions ISO PGRMC1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of PGRMC1 mRNA CTD PMID:35301059 Pgrmc1 Rat caffeine increases phosphorylation ISO PGRMC1 (Homo sapiens) 6480464 Caffeine results in increased phosphorylation of PGRMC1 protein CTD PMID:35688186 Pgrmc1 Rat captan increases expression ISO Pgrmc1 (Mus musculus) 6480464 Captan results in increased expression of PGRMC1 mRNA CTD PMID:31558096 Pgrmc1 Rat carbamazepine increases expression EXP 6480464 Carbamazepine results in increased expression of PGRMC1 mRNA CTD PMID:17381134 Pgrmc1 Rat carbon nanotube decreases expression ISO Pgrmc1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Pgrmc1 Rat cetrorelix multiple interactions ISO PGRMC1 (Homo sapiens) 6480464 [cetrorelix co-treated with testosterone enanthate co-treated with Desogestrel] results in decreased expression of PGRMC1 mRNA and [cetrorelix co-treated with testosterone enanthate] results in decreased expression of PGRMC1 mRNA CTD PMID:18160741 Pgrmc1 Rat CGP 52608 multiple interactions ISO PGRMC1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to PGRMC1 gene] CTD PMID:28238834 Pgrmc1 Rat cisplatin increases expression ISO PGRMC1 (Homo sapiens) 6480464 Cisplatin results in increased expression of PGRMC1 mRNA CTD PMID:27594783 Pgrmc1 Rat clofibrate affects expression EXP 6480464 Clofibrate affects the expression of PGRMC1 mRNA CTD PMID:19483382 Pgrmc1 Rat clozapine multiple interactions EXP 6480464 PGRMC1 protein inhibits the reaction [Clozapine results in decreased expression of GLP1R protein] and PGRMC1 protein inhibits the reaction [Clozapine results in decreased expression of MFN2 protein] CTD PMID:37087062 Pgrmc1 Rat cobalt dichloride increases expression ISO PGRMC1 (Homo sapiens) 6480464 cobaltous chloride results in increased expression of PGRMC1 mRNA CTD PMID:19376846 Pgrmc1 Rat copper atom increases expression ISO Pgrmc1 (Mus musculus) 6480464 Copper results in increased expression of PGRMC1 mRNA CTD PMID:16629173 Pgrmc1 Rat copper(0) increases expression ISO Pgrmc1 (Mus musculus) 6480464 Copper results in increased expression of PGRMC1 mRNA CTD PMID:16629173 Pgrmc1 Rat copper(II) sulfate increases expression ISO PGRMC1 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of PGRMC1 mRNA CTD PMID:19549813 Pgrmc1 Rat coumarin decreases phosphorylation ISO PGRMC1 (Homo sapiens) 6480464 coumarin results in decreased phosphorylation of PGRMC1 protein CTD PMID:35688186 Pgrmc1 Rat coumestrol increases expression ISO PGRMC1 (Homo sapiens) 6480464 Coumestrol results in increased expression of PGRMC1 mRNA CTD PMID:19167446 Pgrmc1 Rat coumestrol multiple interactions ISO PGRMC1 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of PGRMC1 mRNA CTD PMID:19167446 Pgrmc1 Rat crocidolite asbestos decreases expression ISO Pgrmc1 (Mus musculus) 6480464 Asbestos and Crocidolite results in decreased expression of PGRMC1 mRNA CTD PMID:29279043 Pgrmc1 Rat cyclosporin A decreases expression ISO PGRMC1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of PGRMC1 mRNA CTD PMID:25562108 Pgrmc1 Rat deoxynivalenol affects phosphorylation ISO Pgrmc1 (Mus musculus) 6480464 deoxynivalenol affects the phosphorylation of PGRMC1 protein CTD PMID:23811945 Pgrmc1 Rat desogestrel multiple interactions ISO PGRMC1 (Homo sapiens) 6480464 [cetrorelix co-treated with testosterone enanthate co-treated with Desogestrel] results in decreased expression of PGRMC1 mRNA CTD PMID:18160741 Pgrmc1 Rat dextran sulfate multiple interactions ISO Pgrmc1 (Mus musculus) 6480464 evodiamine inhibits the reaction [Dextran Sulfate results in decreased expression of PGRMC1 protein] CTD PMID:35362542 Pgrmc1 Rat dextran sulfate decreases expression ISO Pgrmc1 (Mus musculus) 6480464 Dextran Sulfate results in decreased expression of PGRMC1 protein CTD PMID:35362542 Pgrmc1 Rat diethyl maleate increases expression ISO Pgrmc1 (Mus musculus) 6480464 diethyl maleate results in increased expression of PGRMC1 mRNA CTD PMID:25270620 Pgrmc1 Rat dioxygen increases expression ISO Pgrmc1 (Mus musculus) 6480464 Oxygen deficiency results in increased expression of PGRMC1 mRNA CTD PMID:24205000 Pgrmc1 Rat doxorubicin affects response to substance ISO PGRMC1 (Homo sapiens) 6480464 PGRMC1 protein affects the susceptibility to Doxorubicin CTD PMID:16217747 Pgrmc1 Rat doxorubicin decreases expression ISO PGRMC1 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of PGRMC1 mRNA CTD PMID:29803840 Pgrmc1 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of PGRMC1 mRNA CTD PMID:29391264 Pgrmc1 Rat Enterolactone multiple interactions ISO PGRMC1 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of PGRMC1 mRNA CTD PMID:19167446 Pgrmc1 Rat enzyme inhibitor multiple interactions ISO PGRMC1 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of PGRMC1 protein CTD PMID:23301498 Pgrmc1 Rat Evodiamine multiple interactions ISO Pgrmc1 (Mus musculus) 6480464 evodiamine inhibits the reaction [Dextran Sulfate results in decreased expression of PGRMC1 protein] CTD PMID:35362542 Pgrmc1 Rat felbamate increases expression EXP 6480464 felbamate results in increased expression of PGRMC1 mRNA CTD PMID:17381134 Pgrmc1 Rat fipronil increases expression EXP 6480464 fipronil results in increased expression of PGRMC1 mRNA CTD PMID:23962444 Pgrmc1 Rat flavonoids decreases expression EXP 6480464 Flavonoids results in decreased expression of PGRMC1 mRNA CTD PMID:18035473 Pgrmc1 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of PGRMC1 mRNA CTD PMID:24136188 Pgrmc1 Rat folic acid multiple interactions ISO Pgrmc1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of PGRMC1 mRNA CTD PMID:22206623 Pgrmc1 Rat folpet increases expression ISO Pgrmc1 (Mus musculus) 6480464 folpet results in increased expression of PGRMC1 mRNA CTD PMID:31558096 Pgrmc1 Rat FR900359 increases phosphorylation ISO PGRMC1 (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of PGRMC1 protein CTD PMID:37730182 Pgrmc1 Rat fulvestrant multiple interactions ISO PGRMC1 (Homo sapiens) 6480464 [bisphenol F co-treated with Fulvestrant] results in increased methylation of PGRMC1 gene CTD PMID:31601247 Pgrmc1 Rat gefitinib decreases response to substance ISO PGRMC1 (Homo sapiens) 6480464 PGRMC1 protein results in decreased susceptibility to gefitinib CTD PMID:26298006 Pgrmc1 Rat genistein decreases expression ISO Pgrmc1 (Mus musculus) 6480464 Genistein results in decreased expression of PGRMC1 mRNA CTD PMID:24967385 Pgrmc1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of PGRMC1 mRNA CTD PMID:33387578 Pgrmc1 Rat glafenine decreases expression EXP 6480464 Glafenine results in decreased expression of PGRMC1 mRNA CTD PMID:24136188 Pgrmc1 Rat inulin multiple interactions ISO Pgrmc1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of PGRMC1 mRNA CTD PMID:36331819 Pgrmc1 Rat isotretinoin decreases expression ISO PGRMC1 (Homo sapiens) 6480464 Isotretinoin results in decreased expression of PGRMC1 mRNA CTD PMID:20436886 Pgrmc1 Rat ivermectin decreases expression ISO PGRMC1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of PGRMC1 protein CTD PMID:32959892 Pgrmc1 Rat L-ethionine affects expression EXP 6480464 Ethionine affects the expression of PGRMC1 mRNA CTD PMID:19483382 Pgrmc1 Rat manganese atom multiple interactions ISO PGRMC1 (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] which results in decreased expression of PGRMC1 mRNA CTD PMID:39836092 Pgrmc1 Rat manganese(0) multiple interactions ISO PGRMC1 (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] which results in decreased expression of PGRMC1 mRNA CTD PMID:39836092 Pgrmc1 Rat manganese(II) chloride multiple interactions ISO PGRMC1 (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] which results in decreased expression of PGRMC1 mRNA CTD PMID:39836092 Pgrmc1 Rat menadione increases expression ISO Pgrmc1 (Mus musculus) 6480464 Vitamin K 3 results in increased expression of PGRMC1 mRNA CTD PMID:25270620 Pgrmc1 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of PGRMC1 mRNA CTD PMID:24136188 Pgrmc1 Rat nimesulide increases expression EXP 6480464 nimesulide results in increased expression of PGRMC1 mRNA CTD PMID:24136188 Pgrmc1 Rat omeprazole affects expression EXP 6480464 Omeprazole affects the expression of PGRMC1 mRNA CTD PMID:19483382 Pgrmc1 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of PGRMC1 mRNA CTD PMID:25729387 Pgrmc1 Rat p-toluidine increases expression EXP 6480464 4-toluidine results in increased expression of PGRMC1 mRNA CTD PMID:27638505 Pgrmc1 Rat paracetamol affects expression ISO Pgrmc1 (Mus musculus) 6480464 Acetaminophen affects the expression of PGRMC1 mRNA CTD PMID:17562736 Pgrmc1 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of PGRMC1 mRNA CTD PMID:33387578 Pgrmc1 Rat paracetamol decreases expression ISO PGRMC1 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of PGRMC1 mRNA CTD PMID:22230336 Pgrmc1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Pgrmc1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PGRMC1 mRNA more ... CTD PMID:36331819 Pgrmc1 Rat perfluorooctanoic acid decreases expression ISO PGRMC1 (Homo sapiens) 6480464 perfluorooctanoic acid results in decreased expression of PGRMC1 protein CTD PMID:26879310 Pgrmc1 Rat phenobarbital increases expression EXP 6480464 Phenobarbital results in increased expression of PGRMC1 mRNA CTD PMID:17381134 Pgrmc1 Rat phenytoin increases expression EXP 6480464 Phenytoin results in increased expression of PGRMC1 mRNA CTD PMID:17381134 Pgrmc1 Rat picoxystrobin increases expression ISO PGRMC1 (Homo sapiens) 6480464 picoxystrobin results in increased expression of PGRMC1 mRNA CTD PMID:33512557 Pgrmc1 Rat pirinixic acid affects expression EXP 6480464 pirinixic acid affects the expression of PGRMC1 mRNA CTD PMID:19483382 Pgrmc1 Rat pregnenolone 16alpha-carbonitrile increases expression EXP 6480464 Pregnenolone Carbonitrile results in increased expression of PGRMC1 mRNA CTD PMID:19162173 Pgrmc1 Rat procymidone decreases expression EXP 6480464 procymidone results in decreased expression of PGRMC1 mRNA CTD PMID:15686871 Pgrmc1 Rat progesterone affects binding EXP 6480464 Progesterone binds to PGRMC1 protein CTD PMID:15934950 Pgrmc1 Rat quercetin affects phosphorylation ISO PGRMC1 (Homo sapiens) 6480464 Quercetin affects the phosphorylation of PGRMC1 protein CTD PMID:35688186 Pgrmc1 Rat rac-lactic acid decreases expression ISO PGRMC1 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of PGRMC1 mRNA CTD PMID:30851411 Pgrmc1 Rat resveratrol decreases expression EXP 6480464 resveratrol results in decreased expression of PGRMC1 mRNA CTD PMID:25905778 Pgrmc1 Rat rotenone increases expression ISO PGRMC1 (Homo sapiens) 6480464 Rotenone results in increased expression of PGRMC1 mRNA CTD PMID:33512557 Pgrmc1 Rat SB 431542 increases expression ISO PGRMC1 (Homo sapiens) 6480464 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide results in increased expression of PGRMC1 protein CTD PMID:25670856 Pgrmc1 Rat sodium arsenite increases expression ISO PGRMC1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of PGRMC1 mRNA CTD PMID:21457566 and PMID:38568856 Pgrmc1 Rat sodium arsenite multiple interactions ISO PGRMC1 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of PGRMC1 mRNA CTD PMID:39836092 Pgrmc1 Rat sodium arsenite decreases expression ISO Pgrmc1 (Mus musculus) 6480464 sodium arsenite results in decreased expression of PGRMC1 mRNA CTD PMID:38266874 Pgrmc1 Rat sodium arsenite increases expression ISO Pgrmc1 (Mus musculus) 6480464 sodium arsenite results in increased expression of PGRMC1 mRNA CTD PMID:25270620 Pgrmc1 Rat tamoxifen affects expression ISO Pgrmc1 (Mus musculus) 6480464 Tamoxifen affects the expression of PGRMC1 mRNA CTD PMID:17555576 Pgrmc1 Rat testosterone multiple interactions EXP 6480464 [bisphenol A co-treated with Testosterone] results in increased expression of PGRMC1 mRNA CTD PMID:26496021 Pgrmc1 Rat testosterone enanthate multiple interactions ISO PGRMC1 (Homo sapiens) 6480464 [cetrorelix co-treated with testosterone enanthate co-treated with Desogestrel] results in decreased expression of PGRMC1 mRNA and [cetrorelix co-treated with testosterone enanthate] results in decreased expression of PGRMC1 mRNA CTD PMID:18160741 Pgrmc1 Rat thapsigargin decreases expression ISO Pgrmc1 (Mus musculus) 6480464 Thapsigargin results in decreased expression of PGRMC1 protein CTD PMID:24648495 Pgrmc1 Rat thapsigargin decreases expression EXP 6480464 Thapsigargin results in decreased expression of PGRMC1 protein CTD PMID:35544339 Pgrmc1 Rat thioacetamide affects expression EXP 6480464 Thioacetamide affects the expression of PGRMC1 mRNA CTD PMID:19483382 Pgrmc1 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of PGRMC1 mRNA CTD PMID:34492290 Pgrmc1 Rat titanium dioxide increases expression ISO PGRMC1 (Homo sapiens) 6480464 titanium dioxide results in increased expression of PGRMC1 protein CTD PMID:30910687 Pgrmc1 Rat titanium dioxide decreases methylation ISO Pgrmc1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of PGRMC1 gene CTD PMID:35295148 Pgrmc1 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of PGRMC1 mRNA CTD PMID:25729387 Pgrmc1 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of PGRMC1 mRNA CTD PMID:33387578 Pgrmc1 Rat triphenyl phosphate affects expression ISO PGRMC1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of PGRMC1 mRNA CTD PMID:37042841 Pgrmc1 Rat valproic acid decreases methylation ISO PGRMC1 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of PGRMC1 gene CTD PMID:29154799 Pgrmc1 Rat valproic acid affects expression ISO PGRMC1 (Homo sapiens) 6480464 Valproic Acid affects the expression of PGRMC1 mRNA CTD PMID:25979313 Pgrmc1 Rat venlafaxine hydrochloride decreases expression EXP 6480464 Venlafaxine Hydrochloride results in decreased expression of PGRMC1 mRNA CTD PMID:25423262 Pgrmc1 Rat vincaleukoblastine affects response to substance ISO PGRMC1 (Homo sapiens) 6480464 PGRMC1 protein affects the susceptibility to Vinblastine CTD PMID:16217747 Pgrmc1 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of PGRMC1 mRNA CTD PMID:15686871 and PMID:23034163 Pgrmc1 Rat zinc atom decreases expression EXP 6480464 Zinc deficiency results in decreased expression of PGRMC1 mRNA CTD PMID:15671213 Pgrmc1 Rat zinc(0) decreases expression EXP 6480464 Zinc deficiency results in decreased expression of PGRMC1 mRNA CTD PMID:15671213
(1->4)-beta-D-glucan (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-trinitrotoluene (EXP) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2-hydroxypropanoic acid (ISO) 3-chloropropane-1,2-diol (EXP) 4,4'-sulfonyldiphenol (ISO) 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP) 6-propyl-2-thiouracil (EXP) afimoxifene (ISO) amiodarone (EXP) ammonium chloride (EXP) aristolochic acid A (ISO) Aroclor 1254 (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) benzbromarone (EXP) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) cadmium atom (ISO) cadmium dichloride (ISO) caffeine (ISO) captan (ISO) carbamazepine (EXP) carbon nanotube (ISO) cetrorelix (ISO) CGP 52608 (ISO) cisplatin (ISO) clofibrate (EXP) clozapine (EXP) cobalt dichloride (ISO) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) coumarin (ISO) coumestrol (ISO) crocidolite asbestos (ISO) cyclosporin A (ISO) deoxynivalenol (ISO) desogestrel (ISO) dextran sulfate (ISO) diethyl maleate (ISO) dioxygen (ISO) doxorubicin (ISO) endosulfan (EXP) Enterolactone (ISO) enzyme inhibitor (ISO) Evodiamine (ISO) felbamate (EXP) fipronil (EXP) flavonoids (EXP) flutamide (EXP) folic acid (ISO) folpet (ISO) FR900359 (ISO) fulvestrant (ISO) gefitinib (ISO) genistein (ISO) gentamycin (EXP) glafenine (EXP) inulin (ISO) isotretinoin (ISO) ivermectin (ISO) L-ethionine (EXP) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) menadione (ISO) nefazodone (EXP) nimesulide (EXP) omeprazole (EXP) oxaliplatin (EXP) p-toluidine (EXP) paracetamol (EXP,ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phenobarbital (EXP) phenytoin (EXP) picoxystrobin (ISO) pirinixic acid (EXP) pregnenolone 16alpha-carbonitrile (EXP) procymidone (EXP) progesterone (EXP) quercetin (ISO) rac-lactic acid (ISO) resveratrol (EXP) rotenone (ISO) SB 431542 (ISO) sodium arsenite (ISO) tamoxifen (ISO) testosterone (EXP) testosterone enanthate (ISO) thapsigargin (EXP,ISO) thioacetamide (EXP) titanium dioxide (ISO) topotecan (EXP) trichloroethene (EXP) triphenyl phosphate (ISO) valproic acid (ISO) venlafaxine hydrochloride (EXP) vincaleukoblastine (ISO) vinclozolin (EXP) zinc atom (EXP) zinc(0) (EXP)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
3.
Alzheimer's therapeutics targeting amyloid beta 1-42 oligomers I: Abeta 42 oligomer binding to specific neuronal receptors is displaced by drug candidates that improve cognitive deficits.
Izzo NJ, etal., PLoS One. 2014 Nov 12;9(11):e111898. doi: 10.1371/journal.pone.0111898. eCollection 2014.
4.
Alzheimer's therapeutics targeting amyloid beta 1-42 oligomers II: Sigma-2/PGRMC1 receptors mediate Abeta 42 oligomer binding and synaptotoxicity.
Izzo NJ, etal., PLoS One. 2014 Nov 12;9(11):e111899. doi: 10.1371/journal.pone.0111899. eCollection 2014.
5.
Gene Data Set
MGD Curation, June 12, 2002
6.
GOA pipeline
RGD automated data pipeline
7.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
8.
Cloning and expression of VEMA: a novel ventral midline antigen in the rat CNS.
Runko E, etal., Mol Cell Neurosci 1999 Dec;14(6):428-43.
9.
Isolation and characterization of a novel gene induced by 2,3,7,8-tetrachlorodibenzo-p-dioxin in rat liver.
Selmin O, etal., Carcinogenesis 1996 Dec;17(12):2609-15.
10.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
Pgrmc1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 X 120,698,610 - 120,706,805 (+) NCBI GRCr8 mRatBN7.2 X 115,832,865 - 115,841,060 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl X 115,832,884 - 115,888,682 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx X 117,934,866 - 117,943,066 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 X 121,504,010 - 121,512,210 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 X 119,050,166 - 119,058,365 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 X 123,205,869 - 123,213,880 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 123,205,869 - 123,213,882 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 X 123,352,144 - 123,360,155 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 X 8,265,543 - 8,273,667 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 X 8,271,098 - 8,279,223 (-) NCBI Celera X 115,065,055 - 115,073,267 (+) NCBI Celera Cytogenetic Map X q34 NCBI
PGRMC1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 X 119,236,285 - 119,244,466 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl X 119,236,245 - 119,244,466 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 X 118,370,248 - 118,378,429 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 X 118,254,291 - 118,262,457 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 X 118,152,144 - 118,160,310 NCBI Celera X 118,824,941 - 118,833,159 (+) NCBI Celera Cytogenetic Map X q24 NCBI HuRef X 107,864,078 - 107,872,271 (+) NCBI HuRef CHM1_1 X 118,281,446 - 118,289,662 (+) NCBI CHM1_1 T2T-CHM13v2.0 X 117,614,039 - 117,622,220 (+) NCBI T2T-CHM13v2.0
Pgrmc1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 X 35,861,846 - 35,869,732 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl X 35,861,859 - 35,869,732 (+) Ensembl GRCm39 Ensembl GRCm38 X 36,598,193 - 36,606,079 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl X 36,598,206 - 36,606,079 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 X 34,138,220 - 34,146,074 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 X 33,029,670 - 33,037,524 (+) NCBI MGSCv36 mm8 Celera X 23,322,277 - 23,330,131 (+) NCBI Celera Cytogenetic Map X A3.3 NCBI cM Map X 21.0 NCBI
Pgrmc1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955534 698,734 - 706,946 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955534 698,895 - 706,586 (-) NCBI ChiLan1.0 ChiLan1.0
PGRMC1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 X 118,631,349 - 118,639,583 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 X 118,634,953 - 118,643,187 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 X 108,282,958 - 108,291,187 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 X 118,711,495 - 118,719,714 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl X 118,711,495 - 118,719,714 (+) Ensembl panpan1.1 panPan2
PGRMC1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 X 91,329,243 - 91,337,951 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl X 91,329,243 - 91,337,951 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha X 77,405,200 - 77,413,908 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 X 93,069,899 - 93,078,605 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl X 93,069,840 - 93,078,601 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 X 90,522,743 - 90,531,448 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 X 92,281,492 - 92,290,197 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 X 92,010,000 - 92,018,705 (+) NCBI UU_Cfam_GSD_1.0
Pgrmc1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 X 90,353,427 - 90,361,506 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936479 10,625,889 - 10,634,136 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936479 10,625,989 - 10,634,058 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PGRMC1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl X 97,735,244 - 97,743,423 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 X 97,735,402 - 97,743,424 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 X 113,925,761 - 113,933,800 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PGRMC1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Vero_WHO_p1.0 NW_023666065 31,998,876 - 32,007,022 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Pgrmc1
.
Predicted Target Of
Count of predictions: 311 Count of miRNA genes: 188 Interacting mature miRNAs: 235 Transcripts: ENSRNOT00000017101 Prediction methods: Miranda, Pita, Pita,Targetscan, Targetscan Result types: miRGate_prediction
1598872 Memor14 Memory QTL 14 4.5 exploratory behavior trait (VT:0010471) difference between time of physical contact/close proximity of test subject and social stimulus during sample phase and test phase (CMO:0002678) X 93956491 138956491 Rat 1598856 Memor1 Memory QTL 1 1.9 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) X 103312877 148312877 Rat 1598809 Memor15 Memory QTL 15 4.4 exploratory behavior trait (VT:0010471) difference between time of physical contact/close proximity of test subject and social stimulus during sample phase and test phase (CMO:0002678) X 103312877 148312877 Rat 738025 Stresp3 Stress response QTL 3 4.61 0.0066 stress-related behavior trait (VT:0010451) defensive burying - approach X 100567703 150256146 Rat 61430 Cia18 Collagen induced arthritis QTL 18 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) X 14843113 120568734 Rat 738029 Stresp2 Stress response QTL 2 3.4 0.0004 stress-related behavior trait (VT:0010451) defensive burying - approach X 112934952 138400867 Rat 61431 Cia19 Collagen induced arthritis QTL 19 4.4 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) X 65612192 120568734 Rat 5685004 Bss104 Bone structure and strength QTL 104 3.9 tibia area (VT:1000281) tibia area measurement (CMO:0001382) X 113805422 126975220 Rat 10059603 Bw174 Body weight QTL 174 3.4 0.025 body mass (VT:0001259) body weight (CMO:0000012) X 113937816 152453651 Rat 724551 Glom1 Glomerulus QTL 1 2.8 0.0004 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) X 75294106 120294106 Rat 1598837 Memor13 Memory QTL 13 3.2 exploratory behavior trait (VT:0010471) difference between time of physical contact/close proximity of test subject and social stimulus during sample phase and test phase (CMO:0002678) X 41052407 146860749 Rat
RH139267
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 19 30,511,961 - 30,512,089 (+) MAPPER mRatBN7.2 Rnor_6.0 19 34,204,203 - 34,204,330 NCBI Rnor6.0 Rnor_5.0 19 45,084,621 - 45,084,748 UniSTS Rnor5.0 RGSC_v3.4 19 32,324,466 - 32,324,593 UniSTS RGSC3.4 Celera 19 29,992,287 - 29,992,414 UniSTS RH 3.4 Map 19 234.8 UniSTS Cytogenetic Map 19 q11 UniSTS Cytogenetic Map X q12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000017101 ⟹ ENSRNOP00000017101
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl X 115,832,884 - 115,888,682 (+) Ensembl Rnor_6.0 Ensembl X 123,205,869 - 123,213,882 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000079231 ⟹ ENSRNOP00000071066
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl X 123,205,891 - 123,212,727 (+) Ensembl
RefSeq Acc Id:
NM_021766 ⟹ NP_068534
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 120,698,610 - 120,706,805 (+) NCBI mRatBN7.2 X 115,832,865 - 115,841,060 (+) NCBI Rnor_6.0 X 123,205,869 - 123,213,880 (+) NCBI Rnor_5.0 X 123,352,144 - 123,360,155 (+) NCBI RGSC_v3.4 X 8,265,543 - 8,273,667 (-) RGD Celera X 115,065,055 - 115,073,267 (+) RGD
Sequence:
GCAAAATTAATTTATTGGCCACTGTTCGCTTAGAGGGCGGAGGAAGCCGACTGTTTCGGTCTCTGCATAACAGGCCCAAACCTTTGCTCCAGAGATCATGGCTGCCGAGGATGTGGTGGCGACTGGCG
hide sequence
RefSeq Acc Id:
NP_068534 ⟸ NM_021766
- UniProtKB:
P70580 (UniProtKB/Swiss-Prot), O70606 (UniProtKB/Swiss-Prot), Q549C4 (UniProtKB/Swiss-Prot), A6JMF3 (UniProtKB/TrEMBL), A0A0H2UHK2 (UniProtKB/TrEMBL)
- Sequence:
MAAEDVVATGADPSELEGGGLLQEIFTSPLNLLLLGLCIFLLYKIVRGDQPGASGDNDDDEPPPLPRLKPRDFTPAELRRYDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASRGLATF
hide sequence
Ensembl Acc Id:
ENSRNOP00000071066 ⟸ ENSRNOT00000079231
Ensembl Acc Id:
ENSRNOP00000017101 ⟸ ENSRNOT00000017101
RGD ID: 13701981 Promoter ID: EPDNEW_R12504 Type: multiple initiation site Name: Pgrmc1_1 Description: progesterone receptor membrane component 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 X 123,205,872 - 123,205,932 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2002-07-09
Pgrmc1
progesterone receptor membrane component 1
Symbol and Name updated to reflect Human and Mouse nomenclature
70877 APPROVED
Note Type
Note
Reference
gene_drugs
mRNA expression is induced by 2,3,7,8-tetrachlorodibenzo-p-dioxin (TCDD)
70623
