Advanced Search (OLGA)

Gene: Snd1 (staphylococcal nuclease and tudor domain containing 1) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Snd1

Name:

staphylococcal nuclease and tudor domain containing 1

RGD ID:

631340

Description:

Predicted to enable RISC complex binding activity; RNA binding activity; and RNA endonuclease activity. Predicted to be involved in mRNA catabolic process; miRNA catabolic process; and regulation of cell cycle process. Predicted to be located in dense body. Predicted to be part of RNAi effector complex. Predicted to be active in cytosol and nucleus. Orthologous to human SND1 (staphylococcal nuclease and tudor domain containing 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 3-chloropropane-1,2-diol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

100 kDa coactivator; p100 co-activator; p105 coactivator; SND p102; staphylococcal nuclease domain containing 1; staphylococcal nuclease domain-containing protein 1; U83883

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	58,060,689 - 58,459,926 (+)	NCBI		GRCr8
mRatBN7.2	4	57,095,205 - 57,494,501 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	57,095,208 - 57,530,843 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	62,078,458 - 62,478,049 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	57,994,397 - 58,393,503 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	56,396,509 - 56,796,112 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	55,772,377 - 56,171,669 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	55,772,377 - 56,171,668 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	55,519,828 - 55,919,018 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	55,350,745 - 55,761,185 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	55,601,827 - 56,012,017 (+)	NCBI
Celera	4	52,206,130 - 52,605,087 (+)	NCBI		Celera
Cytogenetic Map	4	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Snd1	Rat	autistic disorder		ISO	SND1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Autistic behavior	ClinVar
Snd1	Rat	hypospadias		ISO	SND1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Hypospadias	ClinVar	PMID:25741868
Snd1	Rat	long QT syndrome		ISO	SND1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Long QT syndrome	ClinVar	PMID:26132555
Snd1	Rat	pleomorphic xanthoastrocytoma		ISO	SND1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Pleomorphic xanthoastrocytoma	ClinVar	PMID:28299358
Snd1	Rat	teratoma		ISO	SND1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Teratoma	ClinVar

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Snd1	Rat	autistic disorder		ISO	SND1 (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:20442744
Snd1	Rat	Lung Neoplasms		ISO	SND1 (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:25940438

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Snd1	Rat	1,2-dimethylhydrazine	multiple interactions	ISO	Snd1 (Mus musculus)	6480464	[1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of SND1 mRNA	CTD	PMID:22206623
Snd1	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Snd1 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of SND1 mRNA	CTD	PMID:21570461
Snd1	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of SND1 mRNA	CTD	PMID:34747641
Snd1	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	Snd1 (Mus musculus)	6480464	Tetrachlorodibenzodioxin results in decreased expression of SND1 mRNA	CTD	PMID:15034205
Snd1	Rat	2,4-dinitrotoluene	affects expression	EXP		6480464	2 and 4-dinitrotoluene affects the expression of SND1 mRNA	CTD	PMID:21346803
Snd1	Rat	2,6-dimethoxyphenol	multiple interactions	ISO	SND1 (Homo sapiens)	6480464	[Sodium Chloride co-treated with pyrogallol 1 and 3-dimethyl ether] results in decreased expression of and affects the localization of SND1 protein	CTD	PMID:38598786
Snd1	Rat	2-deoxy-D-glucose	decreases expression	ISO	SND1 (Homo sapiens)	6480464	Deoxyglucose results in decreased expression of SND1 protein	CTD	PMID:37927237
Snd1	Rat	3',5'-cyclic UMP	affects binding	ISO	SND1 (Homo sapiens)	6480464	SND1 protein binds to cyclic 3' and 5'-uridine monophosphate	CTD	PMID:30528433
Snd1	Rat	3-chloropropane-1,2-diol	decreases expression	EXP		6480464	alpha-Chlorohydrin analog results in decreased expression of SND1 protein	CTD	PMID:26597043
Snd1	Rat	3-chloropropane-1,2-diol	increases expression	EXP		6480464	alpha-Chlorohydrin results in increased expression of SND1 protein	CTD	PMID:34915118
Snd1	Rat	4,4'-sulfonyldiphenol	affects expression	ISO	Snd1 (Mus musculus)	6480464	bisphenol S affects the expression of SND1 mRNA	CTD	PMID:39298647
Snd1	Rat	4,4'-sulfonyldiphenol	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of SND1 mRNA	CTD	PMID:36041667
Snd1	Rat	4,4'-sulfonyldiphenol	increases methylation	ISO	Snd1 (Mus musculus)	6480464	bisphenol S results in increased methylation of SND1 exon	CTD	PMID:33297965
Snd1	Rat	aflatoxin B1	decreases expression	ISO	Snd1 (Mus musculus)	6480464	Aflatoxin B1 results in decreased expression of SND1 mRNA	CTD	PMID:19770486
Snd1	Rat	aflatoxin B1	increases methylation	ISO	SND1 (Homo sapiens)	6480464	Aflatoxin B1 results in increased methylation of SND1 gene and Aflatoxin B1 results in increased methylation of SND1 intron	CTD	PMID:27153756 and PMID:30157460
Snd1	Rat	aflatoxin B1	decreases expression	ISO	SND1 (Homo sapiens)	6480464	Aflatoxin B1 results in decreased expression of SND1 mRNA	CTD	PMID:27153756
Snd1	Rat	amitrole	decreases expression	EXP		6480464	Amitrole results in decreased expression of SND1 mRNA	CTD	PMID:38685447
Snd1	Rat	ammonium chloride	affects expression	EXP		6480464	Ammonium Chloride affects the expression of SND1 mRNA	CTD	PMID:16483693
Snd1	Rat	aristolochic acid A	decreases expression	ISO	SND1 (Homo sapiens)	6480464	aristolochic acid I results in decreased expression of SND1 mRNA	CTD	PMID:33212167
Snd1	Rat	arsane	affects methylation	ISO	SND1 (Homo sapiens)	6480464	Arsenic affects the methylation of SND1 gene	CTD	PMID:25304211
Snd1	Rat	arsenic atom	affects methylation	ISO	SND1 (Homo sapiens)	6480464	Arsenic affects the methylation of SND1 gene	CTD	PMID:25304211
Snd1	Rat	arsenite(3-)	affects localization	ISO	SND1 (Homo sapiens)	6480464	arsenite affects the localization of SND1 protein	CTD	PMID:22240577
Snd1	Rat	benzo[a]pyrene	decreases expression	ISO	SND1 (Homo sapiens)	6480464	Benzo(a)pyrene results in decreased expression of SND1 mRNA and Benzo(a)pyrene results in decreased expression of SND1 protein	CTD	PMID:20064835 and PMID:33278487
Snd1	Rat	benzo[a]pyrene	affects methylation	ISO	SND1 (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of SND1 intron and Benzo(a)pyrene affects the methylation of SND1 promoter	CTD	PMID:27901495 and PMID:30157460
Snd1	Rat	benzo[a]pyrene	increases methylation	ISO	Snd1 (Mus musculus)	6480464	Benzo(a)pyrene results in increased methylation of SND1 intron	CTD	PMID:27901495
Snd1	Rat	benzo[a]pyrene	decreases expression	ISO	Snd1 (Mus musculus)	6480464	Benzo(a)pyrene results in decreased expression of SND1 mRNA	CTD	PMID:15034205 more ...
Snd1	Rat	benzo[a]pyrene diol epoxide I	increases expression	ISO	SND1 (Homo sapiens)	6480464	7 more ...	CTD	PMID:20382639
Snd1	Rat	benzo[e]pyrene	increases methylation	ISO	SND1 (Homo sapiens)	6480464	benzo(e)pyrene results in increased methylation of SND1 intron	CTD	PMID:30157460
Snd1	Rat	bexarotene	increases expression	EXP		6480464	bexarotene results in increased expression of SND1 mRNA	CTD	PMID:16648578
Snd1	Rat	bis(2-chloroethyl) sulfide	decreases expression	ISO	SND1 (Homo sapiens)	6480464	Mustard Gas results in decreased expression of SND1 mRNA	CTD	PMID:25102026
Snd1	Rat	bis(2-ethylhexyl) phthalate	increases methylation	ISO	Snd1 (Mus musculus)	6480464	Diethylhexyl Phthalate results in increased methylation of SND1 intron	CTD	PMID:32864567
Snd1	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of SND1 mRNA	CTD	PMID:25181051
Snd1	Rat	bisphenol A	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of SND1 mRNA	CTD	PMID:36041667
Snd1	Rat	bisphenol A	multiple interactions	ISO	SND1 (Homo sapiens)	6480464	[bisphenol A co-treated with Fulvestrant] results in decreased methylation of SND1 gene	CTD	PMID:31601247
Snd1	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of SND1 mRNA	CTD	PMID:30816183 more ...
Snd1	Rat	bisphenol A	increases methylation	EXP		6480464	bisphenol A results in increased methylation of SND1 gene	CTD	PMID:28505145
Snd1	Rat	bisphenol AF	increases expression	ISO	SND1 (Homo sapiens)	6480464	bisphenol AF results in increased expression of SND1 protein	CTD	PMID:34186270
Snd1	Rat	Bisphenol B	increases expression	ISO	SND1 (Homo sapiens)	6480464	bisphenol B results in increased expression of SND1 protein	CTD	PMID:34186270
Snd1	Rat	bisphenol F	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of SND1 mRNA	CTD	PMID:36041667
Snd1	Rat	bisphenol F	increases expression	ISO	SND1 (Homo sapiens)	6480464	bisphenol F results in increased expression of SND1 protein	CTD	PMID:34186270
Snd1	Rat	buspirone	decreases expression	EXP		6480464	Buspirone results in decreased expression of SND1 mRNA	CTD	PMID:24136188
Snd1	Rat	cadmium dichloride	increases expression	ISO	SND1 (Homo sapiens)	6480464	Cadmium Chloride results in increased expression of SND1 mRNA	CTD	PMID:26472689
Snd1	Rat	caffeine	affects phosphorylation	ISO	SND1 (Homo sapiens)	6480464	Caffeine affects the phosphorylation of SND1 protein	CTD	PMID:35688186
Snd1	Rat	carbon nanotube	increases expression	ISO	Snd1 (Mus musculus)	6480464	Nanotubes more ...	CTD	PMID:25554681
Snd1	Rat	chloropicrin	decreases expression	ISO	SND1 (Homo sapiens)	6480464	chloropicrin results in decreased expression of SND1 mRNA	CTD	PMID:26352163
Snd1	Rat	chlorpyrifos	increases expression	ISO	Snd1 (Mus musculus)	6480464	Chlorpyrifos results in increased expression of SND1 mRNA	CTD	PMID:37019170
Snd1	Rat	cisplatin	multiple interactions	ISO	SND1 (Homo sapiens)	6480464	[SND1 mutant form results in increased susceptibility to Cisplatin] which results in increased cleavage of and results in increased activity of CASP3 protein more ...	CTD	PMID:25940438
Snd1	Rat	cisplatin	decreases expression	ISO	SND1 (Homo sapiens)	6480464	Cisplatin results in decreased expression of SND1 mRNA	CTD	PMID:27392435 and PMID:27594783
Snd1	Rat	cisplatin	increases response to substance	ISO	SND1 (Homo sapiens)	6480464	SND1 mutant form results in increased susceptibility to Cisplatin	CTD	PMID:25940438
Snd1	Rat	clobetasol	increases expression	ISO	Snd1 (Mus musculus)	6480464	Clobetasol results in increased expression of SND1 mRNA	CTD	PMID:27462272
Snd1	Rat	clofibrate	decreases expression	ISO	Snd1 (Mus musculus)	6480464	Clofibrate results in decreased expression of SND1 mRNA	CTD	PMID:17585979
Snd1	Rat	clofibric acid	multiple interactions	EXP		6480464	[Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of SND1 mRNA	CTD	PMID:17602206
Snd1	Rat	cocaine	increases expression	EXP		6480464	Cocaine results in increased expression of SND1 protein	CTD	PMID:25100957
Snd1	Rat	coumarin	decreases phosphorylation	ISO	SND1 (Homo sapiens)	6480464	coumarin results in decreased phosphorylation of SND1 protein	CTD	PMID:35688186
Snd1	Rat	CU-O LINKAGE	increases expression	ISO	SND1 (Homo sapiens)	6480464	cupric oxide results in increased expression of SND1 protein	CTD	PMID:25470785
Snd1	Rat	cyclosporin A	increases expression	ISO	SND1 (Homo sapiens)	6480464	Cyclosporine results in increased expression of SND1 mRNA	CTD	PMID:20106945 more ...
Snd1	Rat	cytarabine	decreases expression	ISO	SND1 (Homo sapiens)	6480464	Cytarabine results in decreased expression of SND1 mRNA	CTD	PMID:21198554
Snd1	Rat	dioxygen	multiple interactions	ISO	Snd1 (Mus musculus)	6480464	[sulforaphane affects the susceptibility to Oxygen] which affects the expression of SND1 mRNA	CTD	PMID:30529165
Snd1	Rat	disodium selenite	increases expression	ISO	SND1 (Homo sapiens)	6480464	Sodium Selenite results in increased expression of SND1 mRNA	CTD	PMID:18175754
Snd1	Rat	doxorubicin	increases expression	ISO	SND1 (Homo sapiens)	6480464	Doxorubicin results in increased expression of SND1 mRNA	CTD	PMID:29803840
Snd1	Rat	endosulfan	increases expression	EXP		6480464	Endosulfan results in increased expression of SND1 mRNA	CTD	PMID:29391264
Snd1	Rat	enzyme inhibitor	multiple interactions	ISO	SND1 (Homo sapiens)	6480464	[Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of SND1 protein	CTD	PMID:23301498
Snd1	Rat	ethanol	affects expression	ISO	Snd1 (Mus musculus)	6480464	Ethanol affects the expression of SND1 mRNA	CTD	PMID:30319688
Snd1	Rat	fenthion	increases expression	ISO	Snd1 (Mus musculus)	6480464	Fenthion results in increased expression of SND1 mRNA	CTD	PMID:34813904
Snd1	Rat	fluoxetine	increases expression	EXP		6480464	Fluoxetine results in increased expression of SND1 mRNA	CTD	PMID:21852994
Snd1	Rat	folic acid	decreases expression	ISO	Snd1 (Mus musculus)	6480464	Folic Acid results in decreased expression of SND1 mRNA	CTD	PMID:25629700
Snd1	Rat	folic acid	multiple interactions	ISO	Snd1 (Mus musculus)	6480464	[1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of SND1 mRNA	CTD	PMID:22206623
Snd1	Rat	FR900359	increases phosphorylation	ISO	SND1 (Homo sapiens)	6480464	FR900359 results in increased phosphorylation of SND1 protein	CTD	PMID:37730182
Snd1	Rat	fulvestrant	multiple interactions	ISO	SND1 (Homo sapiens)	6480464	[bisphenol A co-treated with Fulvestrant] results in decreased methylation of SND1 gene	CTD	PMID:31601247
Snd1	Rat	furfural	multiple interactions	ISO	SND1 (Homo sapiens)	6480464	[Sodium Chloride co-treated with Furaldehyde] results in decreased expression of SND1 protein and [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of SND1 protein	CTD	PMID:38598786
Snd1	Rat	glafenine	increases expression	EXP		6480464	Glafenine results in increased expression of SND1 mRNA	CTD	PMID:24136188
Snd1	Rat	ivermectin	decreases expression	ISO	SND1 (Homo sapiens)	6480464	Ivermectin results in decreased expression of SND1 protein	CTD	PMID:32959892
Snd1	Rat	lead diacetate	increases expression	ISO	Snd1 (Mus musculus)	6480464	lead acetate results in increased expression of SND1 mRNA	CTD	PMID:22609695
Snd1	Rat	lead(0)	decreases expression	ISO	SND1 (Homo sapiens)	6480464	Lead results in decreased expression of SND1 mRNA	CTD	PMID:19921347
Snd1	Rat	leptomycin B	affects localization	ISO	SND1 (Homo sapiens)	6480464	leptomycin B affects the localization of SND1 protein	CTD	PMID:22240577
Snd1	Rat	lipopolysaccharide	multiple interactions	ISO	SND1 (Homo sapiens)	6480464	[NAT10 protein affects the susceptibility to Lipopolysaccharides] which affects the expression of SND1 mRNA	CTD	PMID:35877022
Snd1	Rat	methapyrilene	increases methylation	ISO	SND1 (Homo sapiens)	6480464	Methapyrilene results in increased methylation of SND1 intron	CTD	PMID:30157460
Snd1	Rat	methidathion	increases expression	ISO	Snd1 (Mus musculus)	6480464	methidathion results in increased expression of SND1 mRNA	CTD	PMID:34813904
Snd1	Rat	methylseleninic acid	decreases expression	ISO	SND1 (Homo sapiens)	6480464	methylselenic acid results in decreased expression of SND1 mRNA	CTD	PMID:18548127
Snd1	Rat	N-nitrosodiethylamine	multiple interactions	EXP		6480464	[Diethylnitrosamine co-treated with caffeic acid phenethyl ester] results in increased expression of SND1 mRNA and [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of SND1 mRNA	CTD	PMID:17602206 and PMID:20360939
Snd1	Rat	oxaliplatin	multiple interactions	EXP		6480464	[oxaliplatin co-treated with Topotecan] results in decreased expression of SND1 mRNA	CTD	PMID:25729387
Snd1	Rat	paracetamol	affects expression	ISO	Snd1 (Mus musculus)	6480464	Acetaminophen affects the expression of SND1 mRNA	CTD	PMID:17562736
Snd1	Rat	perfluorohexanesulfonic acid	decreases expression	ISO	Snd1 (Mus musculus)	6480464	perfluorohexanesulfonic acid results in decreased expression of SND1 mRNA	CTD	PMID:37995155
Snd1	Rat	phenethyl caffeate	multiple interactions	EXP		6480464	[Diethylnitrosamine co-treated with caffeic acid phenethyl ester] results in increased expression of SND1 mRNA	CTD	PMID:20360939
Snd1	Rat	phenobarbital	increases expression	EXP		6480464	Phenobarbital results in increased expression of SND1 mRNA	CTD	PMID:12082028
Snd1	Rat	poly(I:C)	affects localization	ISO	SND1 (Homo sapiens)	6480464	Poly I-C affects the localization of SND1 protein	CTD	PMID:22240577
Snd1	Rat	pregnenolone 16alpha-carbonitrile	increases expression	EXP		6480464	Pregnenolone Carbonitrile results in increased expression of SND1 mRNA	CTD	PMID:19162173
Snd1	Rat	SB 431542	multiple interactions	ISO	SND1 (Homo sapiens)	6480464	[LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in decreased expression of SND1 protein	CTD	PMID:37664457
Snd1	Rat	senecionine	decreases expression	ISO	Snd1 (Mus musculus)	6480464	senecionine results in decreased expression of SND1 protein	CTD	PMID:35357534
Snd1	Rat	sodium arsenite	increases expression	ISO	SND1 (Homo sapiens)	6480464	sodium arsenite results in increased expression of SND1 mRNA	CTD	PMID:38568856
Snd1	Rat	sodium arsenite	multiple interactions	ISO	SND1 (Homo sapiens)	6480464	sodium arsenite inhibits the reaction [SND1 protein binds to Ribonucleotides] and sodium arsenite results in decreased expression of and results in decreased activity of SND1 protein	CTD	PMID:30528433
Snd1	Rat	sodium chloride	multiple interactions	ISO	SND1 (Homo sapiens)	6480464	[Sodium Chloride co-treated with Furaldehyde] results in decreased expression of SND1 protein more ...	CTD	PMID:38598786
Snd1	Rat	sodium dichromate	affects expression	EXP		6480464	sodium bichromate affects the expression of SND1 mRNA	CTD	PMID:22110744
Snd1	Rat	sodium dichromate	decreases expression	ISO	SND1 (Homo sapiens)	6480464	sodium bichromate results in decreased expression of SND1 mRNA	CTD	PMID:17685462
Snd1	Rat	sorafenib	decreases response to substance	ISO	SND1 (Homo sapiens)	6480464	SND1 protein results in decreased susceptibility to Sorafenib	CTD	PMID:37927237
Snd1	Rat	sulforaphane	multiple interactions	ISO	Snd1 (Mus musculus)	6480464	[sulforaphane affects the susceptibility to Oxygen] which affects the expression of SND1 mRNA	CTD	PMID:30529165
Snd1	Rat	sunitinib	increases expression	ISO	SND1 (Homo sapiens)	6480464	Sunitinib results in increased expression of SND1 mRNA	CTD	PMID:31533062
Snd1	Rat	tetrachloromethane	increases expression	ISO	Snd1 (Mus musculus)	6480464	Carbon Tetrachloride results in increased expression of SND1 mRNA	CTD	PMID:31919559
Snd1	Rat	thapsigargin	increases expression	ISO	Snd1 (Mus musculus)	6480464	Thapsigargin results in increased expression of SND1 protein	CTD	PMID:24648495
Snd1	Rat	thapsigargin	increases expression	EXP		6480464	Thapsigargin results in increased expression of SND1 protein	CTD	PMID:35544339
Snd1	Rat	thapsigargin	increases expression	ISO	SND1 (Homo sapiens)	6480464	Thapsigargin results in increased expression of SND1 mRNA	CTD	PMID:22378314 and PMID:29453283
Snd1	Rat	thioacetamide	decreases expression	EXP		6480464	Thioacetamide results in decreased expression of SND1 mRNA	CTD	PMID:34492290
Snd1	Rat	titanium dioxide	decreases expression	ISO	SND1 (Homo sapiens)	6480464	titanium dioxide results in decreased expression of SND1 protein	CTD	PMID:30910687
Snd1	Rat	titanium dioxide	decreases methylation	ISO	Snd1 (Mus musculus)	6480464	titanium dioxide results in decreased methylation of SND1 promoter	CTD	PMID:35295148
Snd1	Rat	topotecan	multiple interactions	EXP		6480464	[oxaliplatin co-treated with Topotecan] results in decreased expression of SND1 mRNA	CTD	PMID:25729387
Snd1	Rat	triptonide	increases expression	ISO	Snd1 (Mus musculus)	6480464	triptonide results in increased expression of SND1 mRNA	CTD	PMID:33045310
Snd1	Rat	trovafloxacin	decreases expression	EXP		6480464	trovafloxacin results in decreased expression of SND1 mRNA	CTD	PMID:24136188
Snd1	Rat	trovafloxacin	decreases expression	ISO	Snd1 (Mus musculus)	6480464	trovafloxacin results in decreased expression of SND1 mRNA	CTD	PMID:35537566
Snd1	Rat	tungsten	decreases expression	ISO	Snd1 (Mus musculus)	6480464	Tungsten results in decreased expression of SND1 mRNA	CTD	PMID:30912803
Snd1	Rat	tunicamycin	increases expression	ISO	SND1 (Homo sapiens)	6480464	Tunicamycin results in increased expression of SND1 mRNA	CTD	PMID:22378314 and PMID:29453283
Snd1	Rat	valproic acid	increases expression	ISO	SND1 (Homo sapiens)	6480464	Valproic Acid results in increased expression of SND1 mRNA	CTD	PMID:23179753
Snd1	Rat	valproic acid	affects expression	ISO	SND1 (Homo sapiens)	6480464	Valproic Acid affects the expression of SND1 mRNA	CTD	PMID:25979313
Snd1	Rat	vinclozolin	decreases expression	EXP		6480464	vinclozolin results in decreased expression of SND1 mRNA	CTD	PMID:23034163

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Snd1	Rat	miRNA catabolic process	involved_in	IEA	UniProtKB:Q7KZF4 and ensembl:ENSP00000346762	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Snd1	Rat	miRNA catabolic process	involved_in	ISO	SND1 (Homo sapiens)	1624291	PMID:28546213	RGD	PMID:28546213
Snd1	Rat	mRNA catabolic process	involved_in	IEA	UniRule:UR000907752	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Snd1	Rat	mRNA catabolic process	involved_in	IBA	PANTHER:PTN000266557 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Snd1	Rat	positive regulation of DNA-templated transcription	involved_in	IEA	GO:0003713	1600115	GO_REF:0000108	GOC	GO_REF:0000108
Snd1	Rat	regulation of cell cycle process	involved_in	IEA	UniProtKB:Q7KZF4 and ensembl:ENSP00000346762	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Snd1	Rat	regulation of cell cycle process	involved_in	ISO	SND1 (Homo sapiens)	1624291	PMID:28546213	RGD	PMID:28546213
Snd1	Rat	regulatory ncRNA-mediated gene silencing	involved_in	IEA	InterPro:IPR016685	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Snd1	Rat	regulatory ncRNA-mediated gene silencing	involved_in	IEA	UniRule:UR000907752	1600115	GO_REF:0000104	UniProt	GO_REF:0000104

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Snd1	Rat	cytoplasm	located_in	IEA	UniProtKB:Q78PY7 and ensembl:ENSMUSP00000001460	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Snd1	Rat	cytoplasm	located_in	IEA	UniProtKB-SubCell:SL-0086	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Snd1	Rat	cytoplasm	located_in	IEA	UniProtKB-KW:KW-0963	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Snd1	Rat	cytoplasm	located_in	ISO	Snd1 (Mus musculus)	1624291	PMID:23571754	RGD	PMID:23571754
Snd1	Rat	cytosol	located_in	IEA	UniRule:UR000907752	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Snd1	Rat	cytosol	located_in	IEA	UniProtKB:Q7KZF4 and ensembl:ENSP00000346762	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Snd1	Rat	cytosol	located_in	IEA	UniProtKB:A0A140VK49 and ensembl:ENSP00000346762	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Snd1	Rat	cytosol	is_active_in	IBA	PANTHER:PTN000266557 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Snd1	Rat	cytosol	located_in	ISO	SND1 (Homo sapiens)	1624291		RGD	GO_REF:0000052
Snd1	Rat	dense body	located_in	IEA	UniProtKB:Q78PY7 and ensembl:ENSMUSP00000001460	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Snd1	Rat	dense body	located_in	ISO	Snd1 (Mus musculus)	1624291	PMID:23571754	RGD	PMID:23571754
Snd1	Rat	melanosome	located_in	IEA	UniProtKB-SubCell:SL-0161	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Snd1	Rat	nucleus	is_active_in	IBA	FB:FBgn0035121 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Snd1	Rat	nucleus	located_in	IEA	UniProtKB-KW:KW-0539	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Snd1	Rat	nucleus	located_in	IEA	UniProtKB-SubCell:SL-0191	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Snd1	Rat	nucleus	located_in	ISO	Snd1 (Mus musculus)	1624291	PMID:23571754	RGD	PMID:23571754
Snd1	Rat	nucleus	located_in	IEA	UniProtKB:Q78PY7 and ensembl:ENSMUSP00000001460	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Snd1	Rat	RNAi effector complex	part_of	IEA	InterPro:IPR016685	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Snd1	Rat	endonuclease activity	enables	ISO	SND1 (Homo sapiens)	1624291	PMID:18453631	RGD	PMID:18453631
Snd1	Rat	endonuclease activity	enables	IEA	UniProtKB:Q7KZF4 and ensembl:ENSP00000346762	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Snd1	Rat	endonuclease activity	enables	IEA	UniProtKB-KW:KW-0255	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Snd1	Rat	endonuclease activity, active with either ribo- or deoxyribonucleic acids and producing 3'-phosphomonoesters	enables	IEA	EC:3.1.31.1	1600115	GO_REF:0000003	UniProt	GO_REF:0000003
Snd1	Rat	hydrolase activity	enables	IEA	UniProtKB-KW:KW-0378	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Snd1	Rat	nuclease activity	enables	IEA	InterPro:IPR002071	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Snd1	Rat	nuclease activity	enables	IEA	UniProtKB-KW:KW-0540	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Snd1	Rat	nuclease activity	enables	IBA	FB:FBgn0035121 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Snd1	Rat	nucleic acid binding	enables	IEA	InterPro:IPR002071	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Snd1	Rat	protein binding	enables	ISO	Snd1 (Mus musculus)	1624291	PR:Q9JMB7 more ...	RGD	PMID:20937909 and PMID:24981741
Snd1	Rat	protein binding	enables	IPI	UniProtKB:Q9QZ81	8693368	PMID:24882364	ParkinsonsUK-UCL
Snd1	Rat	protein binding	enables	ISO	SND1 (Homo sapiens)	1624291	UniProtKB:Q13283 more ...	RGD	PMID:20643132 more ...
Snd1	Rat	protein binding	enables	IPI	UniProtKB:Q9R0N3	8693368	PMID:24882364	ParkinsonsUK-UCL
Snd1	Rat	RISC complex binding	enables	IEA	UniProtKB:Q7KZF4 and ensembl:ENSP00000346762	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Snd1	Rat	RISC complex binding	enables	ISO	SND1 (Homo sapiens)	1624291	PMID:28546213	RGD	PMID:28546213
Snd1	Rat	RNA binding	enables	ISO	SND1 (Homo sapiens)	1624291	PMID:18453631	RGD	PMID:18453631
Snd1	Rat	RNA binding	enables	IEA	UniProtKB:Q7KZF4 and ensembl:ENSP00000346762	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Snd1	Rat	RNA binding	enables	IBA	PANTHER:PTN000266557 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Snd1	Rat	RNA binding	enables	IEA	UniRule:UR000907752	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Snd1	Rat	RNA endonuclease activity	enables	ISO	SND1 (Homo sapiens)	1624291	PMID:28546213	RGD	PMID:28546213
Snd1	Rat	RNA endonuclease activity	enables	IEA	UniProtKB:Q7KZF4 and ensembl:ENSP00000346762	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Snd1	Rat	RNA endonuclease activity	enables	IEA	UniRule:UR000907752	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Snd1	Rat	transcription coactivator activity		TAS		1549446		RGD

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Assignment of SND1, the gene encoding coactivator p100, to human chromosome 7q31.3 and rat chromosome 4q23 by in situ hybridization.	Lienard P, etal., Cytogenet Cell Genet 2000;90(3-4):253-4.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	Synaptotagmin 11 interacts with components of the RNA-induced silencing complex RISC in clonal pancreatic beta-cells.	Milochau A, etal., FEBS Lett. 2014 Jun 27;588(14):2217-22. doi: 10.1016/j.febslet.2014.05.031. Epub 2014 May 29.
5.	GOA pipeline	RGD automated data pipeline
6.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:12477932	PMID:15489334	PMID:16210410	PMID:16798076	PMID:17341622	PMID:18453631	PMID:18614015	PMID:20458337	PMID:22658674	PMID:22681889	PMID:23376562	PMID:23571754
PMID:25468996	PMID:28546213	PMID:30053369	PMID:31505169	PMID:35320827	PMID:36803376	PMID:37749650

Snd1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	58,060,689 - 58,459,926 (+)	NCBI		GRCr8
mRatBN7.2	4	57,095,205 - 57,494,501 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	57,095,208 - 57,530,843 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	62,078,458 - 62,478,049 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	57,994,397 - 58,393,503 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	56,396,509 - 56,796,112 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	55,772,377 - 56,171,669 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	55,772,377 - 56,171,668 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	55,519,828 - 55,919,018 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	55,350,745 - 55,761,185 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	55,601,827 - 56,012,017 (+)	NCBI
Celera	4	52,206,130 - 52,605,087 (+)	NCBI		Celera
Cytogenetic Map	4	q22	NCBI

SND1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	127,652,194 - 128,092,593 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	127,652,194 - 128,092,609 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	7	127,292,248 - 127,732,645 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	127,079,438 - 127,519,895 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	7	126,886,184 - 127,326,609	NCBI
Celera	7	122,095,937 - 122,536,062 (+)	NCBI		Celera
Cytogenetic Map	7	q32.1	NCBI
HuRef	7	121,653,109 - 122,093,584 (+)	NCBI		HuRef
CHM1_1	7	127,225,497 - 127,665,960 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	7	128,963,877 - 129,404,259 (+)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	126,675,657 - 127,115,790 (+)	NCBI

Snd1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	28,480,332 - 28,935,161 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	28,475,138 - 28,935,161 (+)	Ensembl		GRCm39 Ensembl
GRCm38	6	28,480,337 - 28,935,162 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	28,475,139 - 28,935,162 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	6	28,430,348 - 28,838,832 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	6	28,430,358 - 28,838,842 (+)	NCBI		MGSCv36	mm8
Celera	6	28,487,574 - 28,897,021 (+)	NCBI		Celera
Cytogenetic Map	6	A3.3	NCBI
cM Map	6	11.99	NCBI

Snd1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955479	8,692,674 - 9,154,272 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955479	8,692,674 - 9,124,504 (+)	NCBI	ChiLan1.0	ChiLan1.0

SND1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	164,510,961 - 164,947,682 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	16,521,212 - 16,957,933 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	7	119,647,536 - 120,084,110 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	7	132,302,137 - 132,738,223 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	132,302,235 - 132,738,223 (+)	Ensembl	panpan1.1		panPan2

SND1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	14	8,265,051 - 8,685,864 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	14	8,265,358 - 8,731,453 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	14	7,951,749 - 8,378,679 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	14	8,032,186 - 8,459,388 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	14	8,032,186 - 8,459,395 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	14	8,236,633 - 8,663,618 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	14	7,977,467 - 8,397,957 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	14	8,124,243 - 8,551,828 (-)	NCBI		UU_Cfam_GSD_1.0

Snd1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	53,724,823 - 54,135,956 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936479	14,848,463 - 15,260,014 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936479	14,848,438 - 15,259,735 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SND1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	18	20,261,476 - 20,653,590 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	18	20,261,473 - 20,653,621 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	18	21,272,313 - 21,657,281 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SND1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	21	96,467,289 - 96,907,278 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	21	96,467,319 - 96,911,145 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666042	6,499,119 - 6,939,868 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Snd1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624783	7,845,945 - 8,311,823 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624783	7,874,701 - 8,311,622 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Snd1
1558 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	339
Count of miRNA genes:	175
Interacting mature miRNAs:	217
Transcripts:	ENSRNOT00000047698, ENSRNOT00000048252
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2302371	Stl22	Serum triglyceride level QTL 22	5.15		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	5218294	57114705	Rat
2303585	Bw86	Body weight QTL 86	4		body mass (VT:0001259)	body weight (CMO:0000012)	4	14678065	59678065	Rat
5685012	Bmd87	Bone mineral density QTL 87	5.1		tibia mineral mass (VT:1000283)	bone mineral content (CMO:0001554)	4	56647776	78882945	Rat
1358352	Srcrt3	Stress Responsive Cort QTL 3	2.29		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	38465774	146803430	Rat
61445	Strs3	Sensitivity to stroke QTL 3	3		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	4	40433388	85433388	Rat
6893678	Bw108	Body weight QTL 108	2.6	0.006	body mass (VT:0001259)	body weight (CMO:0000012)	4	43457976	88457976	Rat
5685009	Bmd86	Bone mineral density QTL 86	3.7		tibia mineral mass (VT:1000283)	bone mineral density (CMO:0001226)	4	56647776	78882945	Rat
10755501	Bp390	Blood pressure QTL 390	2.5		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	4	26775591	168368347	Rat
1331807	Rf31	Renal function QTL 31	2.988		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	4	39524264	74726312	Rat
8552782	Vie1	Viral induced encephalitis QTL 1	26.4		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	4	34430484	82490359	Rat
634311	Sach7	Saccharin preference QTL 7			taste sensitivity trait (VT:0001986)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	4	57114432	81266970	Rat
1358363	Sradr3	Stress Responsive Adrenal Weight QTL 3	6.19		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	4	57486946	102486946	Rat
631261	Tcas3	Tongue tumor susceptibility QTL 3	6.88		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	4	10814170	91360527	Rat
2312567	Glom19	Glomerulus QTL 19	1.9	0.006	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	4	45456990	146803430	Rat
10450825	Scl78	Serum cholesterol level QTL 78	3.7	0.01	blood VLDL cholesterol amount (VT:0005144)	blood low density lipoprotein cholesterol level (CMO:0000053)	4	49178116	57114705	Rat
61336	Bp21	Blood pressure QTL 21	4.6		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	57114705	78881294	Rat
2313401	Anxrr27	Anxiety related response QTL 27			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	4	17933508	62933508	Rat
10450821	Scl77	Serum cholesterol level QTL 77	4.1	0.01	blood VLDL cholesterol amount (VT:0005144)	blood high density lipoprotein cholesterol level (CMO:0000052)	4	49178116	57114705	Rat
8655961	Kidm43	Kidney mass QTL 43	18		kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	4	36303261	103194984	Rat
10450818	Scl76	Serum cholesterol level QTL 76	3.6	0.01	blood VLDL cholesterol amount (VT:0005144)	blood high density lipoprotein cholesterol level (CMO:0000052)	4	49178116	57114705	Rat
1354612	Foco1	Food consumption QTL 1	8.87		eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	4	44463908	148090542	Rat
6909128	Pancm4	Pancreatic morphology QTL 4	11.35		pancreas mass (VT:0010144)	pancreas wet weight (CMO:0000626)	4	26907285	75585128	Rat
2303168	Bp330	Blood pressure QTL 330	4.25	0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	5214602	146446691	Rat
8552801	Bw143	Body weight QTL 143	7.3		body mass (VT:0001259)	change in body weight to body weight ratio (CMO:0002216)	4	34430484	82490359	Rat
61475	Aia2	Adjuvant induced arthritis QTL 2	5.8		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	39505275	73892441	Rat
8694439	Bw168	Body weight QTL 168	9.57	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	4	40433414	85433414	Rat
61412	Pia2	Pristane induced arthritis QTL 2	3.9		joint integrity trait (VT:0010548)	post-insult time to onset of experimental arthritis (CMO:0001450)	4	21333343	62278020	Rat
8655906	Rf60	Renal function QTL 60	3.8		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	4	29494195	81006281	Rat
619616	Bp79	Blood pressure QTL 79		0.0292	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	5214602	78882945	Rat
1576305	Emca6	Estrogen-induced mammary cancer QTL 6	5.8		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	4	44463720	155883716	Rat
7387227	Uae40	Urinary albumin excretion QTL 40	2.9	0.0052	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	4	17946999	62946999	Rat
6909122	Insul22	Insulin level QTL 22	4.63		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	4	26907285	75585128	Rat
8552809	Vie5	Viral induced encephalitis QTL 5	25.3		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	4	34430484	82490359	Rat
1358203	Stl19	Serum triglyceride level QTL 19	2.8	0.002	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	5218294	65958103	Rat
1354660	Salc1	Saline consumption QTL 1	11.26		drinking behavior trait (VT:0001422)	saline drink intake rate (CMO:0001627)	4	44463908	148090542	Rat
1641833	Alc21	Alcohol consumption QTL 21	8.6	0.0001	drinking behavior trait (VT:0001422)	ethanol drink intake rate (CMO:0001407)	4	56698790	126192555	Rat
1298082	Stresp4	Stress response QTL 4			blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	50119848	146803430	Rat
631546	Bp86	Blood pressure QTL 86	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	57114432	91360801	Rat
1300139	Hrtrt6	Heart rate QTL 6	2.85		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	39524264	116179656	Rat
70200	Alc18	Alcohol consumption QTL 18	9.2		drinking behavior trait (VT:0001422)	ethanol intake volume to total fluid intake volume ratio (CMO:0001591)	4	56647873	149491524	Rat
12798520	Anxrr55	Anxiety related response QTL 55	4.45	0.01	locomotor behavior trait (VT:0001392)	number of rearing movements with lid-pushing in an experimental apparatus (CMO:0002715)	4	32583980	114627242	Rat
4889969	Bss96	Bone structure and strength QTL 96	4.9		tibia size trait (VT:0100001)	tibia cortical bone volume (CMO:0001725)	4	56647776	78882945	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	11320076	180699135	Rat
4889972	Bss97	Bone structure and strength QTL 97	5.6		tibia size trait (VT:0100001)	tibia total bone volume (CMO:0001724)	4	56647776	78882945	Rat

D4Mit2

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	4	58,079,875 - 58,080,146 (+)	Marker Load Pipeline
mRatBN7.2	4	57,114,432 - 57,114,705 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	55,791,564 - 55,791,834	NCBI	Rnor6.0
Rnor_5.0	4	55,539,015 - 55,539,285	UniSTS	Rnor5.0
RGSC_v3.4	4	55,369,931 - 55,370,202	RGD	RGSC3.4
RGSC_v3.4	4	55,369,932 - 55,370,202	UniSTS	RGSC3.4
RGSC_v3.1	4	55,620,765 - 55,621,035	RGD
RH 3.4 Map	4	304.7	RGD
RH 3.4 Map	4	304.7	UniSTS
Cytogenetic Map	4	q23	UniSTS

STS-H23117

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	57,435,072 - 57,435,232 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	56,112,213 - 56,112,372	NCBI	Rnor6.0
Rnor_5.0	4	55,859,589 - 55,859,748	UniSTS	Rnor5.0
RGSC_v3.4	4	55,699,803 - 55,699,962	UniSTS	RGSC3.4
Celera	4	52,545,610 - 52,545,769	UniSTS
Cytogenetic Map	4	q23	UniSTS
Cytogenetic Map	4	q22	UniSTS

RH144306

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	57,418,468 - 57,418,568 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	56,095,609 - 56,095,708	NCBI	Rnor6.0
Rnor_5.0	4	55,842,985 - 55,843,084	UniSTS	Rnor5.0
RGSC_v3.4	4	55,683,199 - 55,683,298	UniSTS	RGSC3.4
Celera	4	52,529,006 - 52,529,105	UniSTS
RH 3.4 Map	4	302.11	UniSTS
Cytogenetic Map	4	q23	UniSTS

AI176053

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	57,096,493 - 57,096,633 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	55,773,627 - 55,773,766	NCBI	Rnor6.0
Rnor_5.0	4	55,521,078 - 55,521,217	UniSTS	Rnor5.0
RGSC_v3.4	4	55,351,995 - 55,352,134	UniSTS	RGSC3.4
Celera	4	52,207,380 - 52,207,519	UniSTS
RH 3.4 Map	4	306.0	UniSTS
Cytogenetic Map	4	q23	UniSTS

AW528121

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	57,418,816 - 57,419,049 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	56,095,957 - 56,096,189	NCBI	Rnor6.0
Rnor_5.0	4	55,843,333 - 55,843,565	UniSTS	Rnor5.0
RGSC_v3.4	4	55,683,547 - 55,683,779	UniSTS	RGSC3.4
Celera	4	52,529,354 - 52,529,586	UniSTS
RH 3.4 Map	4	306.3	UniSTS
Cytogenetic Map	4	q23	UniSTS

AU049569

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	57,270,003 - 57,270,163 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	55,947,122 - 55,947,281	NCBI	Rnor6.0
Rnor_5.0	4	55,694,569 - 55,694,728	UniSTS	Rnor5.0
Celera	4	52,380,512 - 52,380,671	UniSTS
Cytogenetic Map	4	q23	UniSTS

GDB:4585141

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	57,435,103 - 57,435,199 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	56,112,244 - 56,112,339	NCBI	Rnor6.0
Rnor_5.0	4	55,859,620 - 55,859,715	UniSTS	Rnor5.0
RGSC_v3.4	4	55,699,834 - 55,699,929	UniSTS	RGSC3.4
Celera	4	52,545,641 - 52,545,736	UniSTS
Cytogenetic Map	4	q23	UniSTS
Cytogenetic Map	4	q22	UniSTS

Lrrc4

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	57,435,855 - 57,436,803 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	56,112,996 - 56,113,943	NCBI	Rnor6.0
Rnor_5.0	4	55,860,372 - 55,861,319	UniSTS	Rnor5.0
RGSC_v3.4	4	55,700,586 - 55,701,533	UniSTS	RGSC3.4
Celera	4	52,546,393 - 52,547,340	UniSTS
Cytogenetic Map	4	q23	UniSTS
Cytogenetic Map	4	q22	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_022694	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039108324	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC127822	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC128239	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC136815	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY697864	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC072471	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473959	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U83883	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000047698 ⟹ ENSRNOP00000041531

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	57,095,265 - 57,494,491 (+)	Ensembl
Rnor_6.0 Ensembl	4	55,772,377 - 56,171,668 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000048252 ⟹ ENSRNOP00000045936

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	57,095,208 - 57,530,843 (+)	Ensembl
Rnor_6.0 Ensembl	4	55,772,627 - 56,171,390 (+)	Ensembl

RefSeq Acc Id:

NM_022694 ⟹ NP_073185

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	58,060,689 - 58,459,926 (+)	NCBI
mRatBN7.2	4	57,095,244 - 57,494,501 (+)	NCBI
Rnor_6.0	4	55,772,377 - 56,171,669 (+)	NCBI
Rnor_5.0	4	55,519,828 - 55,919,018 (+)	NCBI
RGSC_v3.4	4	55,350,745 - 55,761,185 (+)	RGD
Celera	4	52,206,130 - 52,605,087 (+)	RGD

Sequence:

show sequence

CGGCGGCCGAGATCGCGTCTCCTCTTTTGCTTCCAGTCCCGCTGCTGTTATAGTGTGCGCCTGGCGCTTCTATCCAGTCCACCGACGGTAGCCTGTCGTCCGCCTTCTCCTTGTCGCTGCAACCTCTC
ACCAGCACCGGCACCCTCTCTGACACTTCCAGTCCGGCCGGCCGCCCCACTCTCTGTCTTTCCAGCTCCACACATGGCCTCCGCGCAGAGCAGCGGCTCCTCCGGGGGACCCGCGGTCCCCACCGTGC
AACGGGGCATCGTCAAGATGGTCCTCTCTGGGTGTGCCATCATTGTCCGAGGGCAGCCCCGGGGCGGTCCGCCTCCAGAGAGGCAGATCAACCTCAGCAACATTCGAGCTGGAAATCTCGCCCGTCGG
GCAGCTGCTACGCAACCAGATGGGAAAGATACCCCAGATGAGCCCTGGGCATTTCCTGCTAGAGAGTTCCTTCGCAAGAAGCTGATTGGGAAGGAAGTCTGTTTCACGATAGAAAACAAGACTCCCCA
AGGACGAGAGTATGGAATGATCTACCTTGGAAAAGATACTAATGGGGAAAACATTGCAGAGTCGCTAGTCGCAGAAGGCTTGGCCTCCCGGAGAGAAGGCATGAGAGCCAATAACCCAGAGCAGAACC
GGCTTTCAGAATGCGAGGAACAAGCAAAGGCATCGAAGAAAGGGATGTGGAGTGAGGGGAACGGGTCACACACCATCCGGGACCTCAAGTACACCATTGAGAACCCAAGGCACTTTGTGGACTCACAC
CACCAGAAGCCTGTCAATGCTATCATTGAGCATGTTCGAGACGGCAGTGTGGTCCGGGCCCTGCTCCTTCCGGATCACTACCTTGTTACCGTCATGCTGTCAGGGATTAAGTGCCCAACCTTTCGTCG
AGAAACAGATGGTAGTGAAACACCAGAGCCCTTCGCTGCAGAAGCCAAGTTTTTCACGGAGTCTCGACTGCTTCAGAGAGATGTTCAGATCATTCTGGAGAGCTGCCATAATCAGAACATTCTGGGCA
CCATCCTTCATCCAAATGGTAACATCACTGAACTCCTCCTGAAGGAAGGTTTTGCCCGCTGTGTGGACTGGTCAATTGCAGTTTACACCCGGGGTGCAGAAAAGCTGAGGGCAGCTGAGAGGTTTGCC
AAGGAGCGTAGGCTGAGAATATGGAGAGACTATGTGCCTCCTACTGCTAATTTGGACCAAAAGGACAAGCAGTTTGTTGCCAAGGTAATGCAGGTTTTGAATGCTGATGCCATTGTTGTGAAGCTGAA
TTCTGGAGACTACAAGACCATCCACCTGTCAAGCATCCGACCACCAAGGTTGGAGGGAGACAACATACAGGATAAGAATAAGAAGCTCCGGCCCCTGTATGACATCCCCTACATGTTTGAGGCCCGGG
AATTCCTTCGCAAAAAGCTCATTGGGAAGAAGGTCAGTGTGACTGTGGACTACATTAGACCAGCCAGCCCAGCCACAGAAACAGTGCCTGCCTTTTCTGAGCGTACCTGTGCCACTGTCACCATTGGA
GGAATAAACATTGCTGAGGCCCTTGTCAGCAAAGGCCTAGCCACAGTGATCAGATACCGGCAGGATGATGACCAGAGATCTTCACACTATGATGAGCTGCTGGCTGCAGAGGCCAGAGCGATTAAGAA
TGGCAAAGGATTGCACAGCAAGAAGGAAGTGCCCATCCACCGAGTTGCAGACATTTCTGGGGACACCCAGAAAGCAAAGCAGTTCCTGCCCTTTCTTCAGCGCGCAGGCCGTTCTGAGGCTGTGGTGG
AGTATGTCTTCAGTGGCTCTCGCCTCAAGCTCTACTTACCTAAGGAGACCTGTCTCATCACCTTCCTGCTGGCAGGCATTGAATGTCCCAGAGGAGCACGAAATCTCCCAGGCTTGGTGCAGGAAGGA
GAGCCATTCAGTGAGGAAGCCACACTTTTCACCAAGGAACTAGTGCTGCAGCGAGAGGTGGAGGTGGAGGTAGAGAGCATGGATAAGGCTGGCAACTTCATTGGCTGGCTACACATGGATGGGGCTAA
CCTGTCTGTCTTGCTGGTGGAGCACGCGCTCTCCAAGGTCCACTTCACTGCTGAGCGCAGCGCCTACTATAAGCCTCTCCTGTCTGCTGAGGAAGCTGCCAAGCAGAGGAAAGAGAAGGTCTGGGCCC
ACTATGAGGAGCAGCCTGTGGAGGAGGTAATGCCTGTACTGGAAGAGAAGGAGCGCTCGGCCAGCTACAAGCCAGTGTTTGTGACCGAGATCACAGATGACCTGCATTTCTATGTGCAAGATGTGGAG
ACTGGCACCCAGCTGGAAAAACTGATGGAGAACATGCGCAGTGACATCTCCAGCCACCCTCCTGTTGAGGGTGCCTACGCCCCACGCCGGGGAGAGTTCTGCATTGCCAAATTTGTAGATGGAGAATG
GTACCGCGCCCGGGTAGAAAAAGTGGAGTCCCCTGCCAAAGTGCATGTCTTCTACATCGACTATGGCAATAGAGAGATCCTGCCATCCACCCGCCTGGGTGCCCTACCACCTGCCTTCAGCACTCGCG
TGTTGCCAGCTCAAGCCACAGAGTATGCCTTCGCCTTCATCCAGGTGCCCCAAGATGAGGACGCTCGCACAGATGCTGTGGACAGTGTGGTGCGGGACATCCAAAACACTCAGTGCCTGCTCAACGTG
GAGCACCTGAGTGCCAGCTGCCCCCATGTCACTCTGCAGTTTGCGGATTCCAAAGGTGATGTGGGGCTGGGCCTGGTGAAGGAAGGACTCGTCATGGTAGAAGTTCGGAAGGAGAAGCAGTTCCAGAA
AGTGATCACAGAGTACCTGAATGCCCAGGAATCAGCCAAGAGTGCCAGGCTGAACCTGTGGCGCTATGGCGACTTCCGAGCTGACGATGCTGATGAGTTTGGCTACAGTCGCTAAGGAGAACTTGCCT
GGCTCCCAGCACCGCTGATGCCAGACCTTCTCCCTCTGCCAGGAAGCCGTTTTCAACTCCAGACCTGGTCGGGGGAGTATAGATTGGGTCCAGCTTGCTTCAGACAGAAACCTCCTCTGTCGCGGGTA
GCATTGGAGCTGGGGTGGAGAGCCCAAGGCTTGCTGGGGCAGACCCCCTCAGTGGTACTGCCGTCCAGTCTCTCCCAGATGATTTTGTATTTTTATTTGGGGGGGGGGGGTGCTTTTTTTTAATTGTC
TTCAAATCAGGAAAGAACCATGAAAGACTGTGTGTTAGTGAAGGGTATAATCGTGACACAGAGGCAGCTGTCAGCTGGCACCCACCTCTCCCCCAGACCACCCTTCTTCCCAAGCTCTGTCCAAGTGT
TGATTATGTGACTTCTGATACATCCGTTCTCAAATTCCAGTGTGCCCATATCTGCCCCCACACCAGCCTGTTCTGTATTTAAAGCTTTTGAGACCCAATAAAATAGTACCTGCTGTCTGCAAAAAAAA
AAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039108324 ⟹ XP_038964252

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	58,060,830 - 58,459,926 (+)	NCBI
mRatBN7.2	4	57,095,205 - 57,494,494 (+)	NCBI


Protein RefSeqs	NP_073185	(Get FASTA)	NCBI Sequence Viewer
	XP_038964252	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAB41439	(Get FASTA)	NCBI Sequence Viewer
	AAH72471	(Get FASTA)	NCBI Sequence Viewer
	AAU05374	(Get FASTA)	NCBI Sequence Viewer
	EDM15198	(Get FASTA)	NCBI Sequence Viewer
	EDM15199	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000041531
	ENSRNOP00000102144
GenBank Protein	Q66X93	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_073185 ⟸ NM_022694

- UniProtKB:

P97693 (UniProtKB/Swiss-Prot), Q6IN40 (UniProtKB/Swiss-Prot), Q66X93 (UniProtKB/Swiss-Prot), A6IEB2 (UniProtKB/TrEMBL), A0A8L2QK81 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MASAQSSGSSGGPAVPTVQRGIVKMVLSGCAIIVRGQPRGGPPPERQINLSNIRAGNLARRAAATQPDGKDTPDEPWAFPAREFLRKKLIGKEVCFTIENKTPQGREYGMIYLGKDTNGENIAESLVA
EGLASRREGMRANNPEQNRLSECEEQAKASKKGMWSEGNGSHTIRDLKYTIENPRHFVDSHHQKPVNAIIEHVRDGSVVRALLLPDHYLVTVMLSGIKCPTFRRETDGSETPEPFAAEAKFFTESRLL
QRDVQIILESCHNQNILGTILHPNGNITELLLKEGFARCVDWSIAVYTRGAEKLRAAERFAKERRLRIWRDYVPPTANLDQKDKQFVAKVMQVLNADAIVVKLNSGDYKTIHLSSIRPPRLEGDNIQD
KNKKLRPLYDIPYMFEAREFLRKKLIGKKVSVTVDYIRPASPATETVPAFSERTCATVTIGGINIAEALVSKGLATVIRYRQDDDQRSSHYDELLAAEARAIKNGKGLHSKKEVPIHRVADISGDTQK
AKQFLPFLQRAGRSEAVVEYVFSGSRLKLYLPKETCLITFLLAGIECPRGARNLPGLVQEGEPFSEEATLFTKELVLQREVEVEVESMDKAGNFIGWLHMDGANLSVLLVEHALSKVHFTAERSAYYK
PLLSAEEAAKQRKEKVWAHYEEQPVEEVMPVLEEKERSASYKPVFVTEITDDLHFYVQDVETGTQLEKLMENMRSDISSHPPVEGAYAPRRGEFCIAKFVDGEWYRARVEKVESPAKVHVFYIDYGNR
EILPSTRLGALPPAFSTRVLPAQATEYAFAFIQVPQDEDARTDAVDSVVRDIQNTQCLLNVEHLSASCPHVTLQFADSKGDVGLGLVKEGLVMVEVRKEKQFQKVITEYLNAQESAKSARLNLWRYGD
FRADDADEFGYSR

hide sequence

Ensembl Acc Id:

ENSRNOP00000041531 ⟸ ENSRNOT00000047698

Ensembl Acc Id:

ENSRNOP00000045936 ⟸ ENSRNOT00000048252

RefSeq Acc Id:	XP_038964252 ⟸ XM_039108324
- Peptide Label:	isoform X1
- UniProtKB:	A0A8L2QK81 (UniProtKB/TrEMBL)

Protein Domains

TNase-like Tudor

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q66X93-F1-model_v2	AlphaFold	Q66X93	1-909	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13692915

Promoter ID:

EPDNEW_R3440

Type:

initiation region

Name:

Snd1_1

Description:

staphylococcal nuclease and tudor domain containing 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	4	55,772,398 - 55,772,458	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-45418	BioCyc
Ensembl Genes	ENSRNOG00000031173	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000047698	ENTREZGENE
	ENSRNOT00000142763	ENTREZGENE
Gene3D-CATH	2.30.30.140	UniProtKB/Swiss-Prot
	2.40.50.90	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7100501	IMAGE-MGC_LOAD
InterPro	Silence_cplx_Nase-comp_TudorSN	UniProtKB/Swiss-Prot
	SNase_OB-fold_sf	UniProtKB/Swiss-Prot
	Staphylococal_nuclease_OB-fold	UniProtKB/Swiss-Prot
	Thermonucl_AS	UniProtKB/Swiss-Prot
	Tudor	UniProtKB/Swiss-Prot
	Tudor_TDRD11	UniProtKB/Swiss-Prot
KEGG Report	rno:64635	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:91679	IMAGE-MGC_LOAD
NCBI Gene	64635	ENTREZGENE
PANTHER	EBNA2 BINDING PROTEIN P100	UniProtKB/Swiss-Prot
	STAPHYLOCOCCAL NUCLEASE DOMAIN-CONTAINING PROTEIN 1	UniProtKB/Swiss-Prot
Pfam	SNase	UniProtKB/Swiss-Prot
	TUDOR	UniProtKB/Swiss-Prot
PhenoGen	Snd1	PhenoGen
PIRSF	RISC-Tudor-SN	UniProtKB/Swiss-Prot
PROSITE	TNASE_2	UniProtKB/Swiss-Prot
	TNASE_3	UniProtKB/Swiss-Prot
	TUDOR	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000031173	RatGTEx
SMART	SNc	UniProtKB/Swiss-Prot
	TUDOR	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF50199	UniProtKB/Swiss-Prot
	Tudor/PWWP/MBT	UniProtKB/Swiss-Prot
UniProt	A0A8L2QK81	ENTREZGENE, UniProtKB/TrEMBL
	A6IEB2	ENTREZGENE, UniProtKB/TrEMBL
	D4A8Y5_RAT	UniProtKB/TrEMBL
	P97693	ENTREZGENE
	Q66X93	ENTREZGENE
	Q6IN40	ENTREZGENE
	SND1_RAT	UniProtKB/Swiss-Prot
UniProt Secondary	P97693	UniProtKB/Swiss-Prot
	Q6IN40	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-02-25	Snd1	staphylococcal nuclease and tudor domain containing 1	Snd1	staphylococcal nuclease domain containing 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-07-08	Snd1	staphylococcal nuclease domain containing 1	U83883	p105 coactivator	Symbol and Name updated	1299863	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD