Symbol:
Gng11
Name:
G protein subunit gamma 11
RGD ID:
621515
Description:
Predicted to enable G-protein beta-subunit binding activity. Predicted to be involved in G protein-coupled receptor signaling pathway. Predicted to be part of heterotrimeric G-protein complex. Orthologous to human GNG11 (G protein subunit gamma 11); PARTICIPATES IN chemokine mediated signaling pathway; glutamate signaling pathway; INTERACTS WITH 1,2,4-trimethylbenzene; 1-naphthyl isothiocyanate; 17alpha-ethynylestradiol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
guanine nucleotide binding protein (G protein), gamma 11; guanine nucleotide binding protein gamma subunit 11; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11-like; LOC100912034
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 32,977,681 - 32,983,121 (+) NCBI GRCr8 mRatBN7.2 4 32,023,003 - 32,028,443 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 32,023,003 - 32,028,442 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 36,995,710 - 37,001,147 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 32,921,836 - 32,927,273 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 31,286,319 - 31,291,754 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 28,989,170 - 28,994,610 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 28,989,115 - 28,993,621 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 31,387,420 - 31,392,856 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 28,897,478 - 28,902,918 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 28,847,907 - 28,853,347 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 4 27,409,779 - 27,415,196 (+) NCBI Celera Cytogenetic Map 4 q13 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Gng11 Rat (S)-nicotine decreases expression ISO Gng11 (Mus musculus) 6480464 Nicotine results in decreased expression of GNG11 mRNA CTD PMID:21955143 Gng11 Rat 1,2,4-trimethylbenzene increases expression EXP 6480464 pseudocumene results in increased expression of GNG11 protein CTD PMID:17337753 Gng11 Rat 1,2-dimethylhydrazine decreases expression ISO Gng11 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of GNG11 mRNA CTD PMID:22206623 Gng11 Rat 1-naphthyl isothiocyanate decreases expression EXP 6480464 1-Naphthylisothiocyanate results in decreased expression of GNG11 mRNA CTD PMID:30723492 Gng11 Rat 17alpha-ethynylestradiol multiple interactions ISO Gng11 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of GNG11 mRNA CTD PMID:17942748 Gng11 Rat 17alpha-ethynylestradiol affects expression EXP 6480464 Ethinyl Estradiol affects the expression of GNG11 mRNA CTD PMID:26865667 Gng11 Rat 17beta-estradiol affects expression ISO GNG11 (Homo sapiens) 6480464 Estradiol affects the expression of GNG11 mRNA CTD PMID:22574217 Gng11 Rat 17beta-estradiol multiple interactions ISO GNG11 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in increased expression of GNG11 mRNA CTD PMID:20660070 Gng11 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression EXP 6480464 2 more ... CTD PMID:21394737 Gng11 Rat 2,2',5,5'-tetrachlorobiphenyl increases expression ISO GNG11 (Homo sapiens) 6480464 2 more ... CTD PMID:36804509 Gng11 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Gng11 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of GNG11 mRNA CTD PMID:24680724 Gng11 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO GNG11 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of GNG11 mRNA CTD PMID:19684285 and PMID:20106945 Gng11 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of GNG11 mRNA CTD PMID:16960034 Gng11 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Gng11 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of GNG11 mRNA CTD PMID:16960034 Gng11 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Gng11 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of GNG11 mRNA CTD PMID:19684285 Gng11 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Gng11 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of GNG11 mRNA CTD PMID:17942748 Gng11 Rat 2,4-dichlorophenol increases methylation ISO GNG11 (Homo sapiens) 6480464 2 and 4-dichlorophenol results in increased methylation of GNG11 gene CTD PMID:34523531 Gng11 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of GNG11 mRNA CTD PMID:21346803 Gng11 Rat 2-hydroxypropanoic acid decreases expression ISO GNG11 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of GNG11 mRNA CTD PMID:30851411 Gng11 Rat 2-methylcholine affects expression ISO GNG11 (Homo sapiens) 6480464 beta-methylcholine affects the expression of GNG11 mRNA CTD PMID:21179406 Gng11 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO GNG11 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of GNG11 mRNA CTD PMID:28628672 Gng11 Rat 4,4'-diaminodiphenylmethane decreases expression ISO Gng11 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of GNG11 mRNA CTD PMID:18648102 Gng11 Rat 4,4'-sulfonyldiphenol increases expression ISO Gng11 (Mus musculus) 6480464 bisphenol S results in increased expression of GNG11 mRNA CTD PMID:30951980 Gng11 Rat 4-hydroxyphenyl retinamide increases expression ISO Gng11 (Mus musculus) 6480464 Fenretinide results in increased expression of GNG11 mRNA CTD PMID:28973697 Gng11 Rat 4-hydroxyphenyl retinamide decreases expression ISO GNG11 (Homo sapiens) 6480464 Fenretinide results in decreased expression of GNG11 mRNA CTD PMID:16671099 Gng11 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of GNG11 mRNA CTD PMID:24780913 Gng11 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of GNG11 mRNA CTD PMID:28959563 Gng11 Rat aflatoxin B1 affects expression ISO GNG11 (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of GNG11 protein CTD PMID:20106945 Gng11 Rat aflatoxin B1 increases methylation ISO GNG11 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of GNG11 promoter CTD PMID:30157460 Gng11 Rat aflatoxin B1 increases expression ISO GNG11 (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of GNG11 mRNA CTD PMID:22100608 Gng11 Rat all-trans-retinoic acid increases expression ISO GNG11 (Homo sapiens) 6480464 Tretinoin results in increased expression of GNG11 mRNA CTD PMID:21934132 Gng11 Rat all-trans-retinoic acid decreases expression ISO GNG11 (Homo sapiens) 6480464 Tretinoin results in decreased expression of GNG11 mRNA CTD PMID:23724009 Gng11 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of GNG11 mRNA CTD PMID:35163327 Gng11 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of GNG11 mRNA CTD PMID:16483693 Gng11 Rat antirheumatic drug increases expression ISO GNG11 (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of GNG11 mRNA CTD PMID:24449571 Gng11 Rat aristolochic acid A decreases expression ISO GNG11 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of GNG11 mRNA CTD PMID:33212167 Gng11 Rat Aroclor 1254 increases expression ISO Gng11 (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in increased expression of GNG11 mRNA CTD PMID:23650126 Gng11 Rat arsenite(3-) decreases expression ISO Gng11 (Mus musculus) 6480464 arsenite results in decreased expression of GNG11 mRNA CTD PMID:33053406 Gng11 Rat arsenite(3-) multiple interactions ISO GNG11 (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to GNG11 mRNA] CTD PMID:32406909 Gng11 Rat belinostat increases expression ISO GNG11 (Homo sapiens) 6480464 belinostat results in increased expression of GNG11 mRNA CTD PMID:26272509 Gng11 Rat benzene decreases expression ISO GNG11 (Homo sapiens) 6480464 Benzene results in decreased expression of GNG11 mRNA CTD PMID:19162166 Gng11 Rat benzo[a]pyrene increases expression ISO GNG11 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of GNG11 mRNA CTD PMID:20064835 more ... Gng11 Rat benzo[a]pyrene increases methylation ISO GNG11 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of GNG11 promoter CTD PMID:27901495 Gng11 Rat benzo[a]pyrene decreases expression ISO Gng11 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of GNG11 mRNA CTD PMID:21569818 Gng11 Rat benzo[a]pyrene diol epoxide I increases expression ISO GNG11 (Homo sapiens) 6480464 7 more ... CTD PMID:20382639 Gng11 Rat bis(2-ethylhexyl) phthalate increases expression ISO GNG11 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in increased expression of GNG11 mRNA CTD PMID:31163220 Gng11 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Gng11 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of GNG11 mRNA CTD PMID:34319233 Gng11 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of GNG11 mRNA CTD PMID:25181051 and PMID:34947998 Gng11 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of GNG11 mRNA CTD PMID:33296240 Gng11 Rat bisphenol A decreases expression ISO GNG11 (Homo sapiens) 6480464 bisphenol A results in decreased expression of GNG11 mRNA CTD PMID:29275510 Gng11 Rat bisphenol A increases expression ISO Gng11 (Mus musculus) 6480464 bisphenol A results in increased expression of GNG11 mRNA CTD PMID:30951980 more ... Gng11 Rat bisphenol A affects methylation ISO Gng11 (Mus musculus) 6480464 bisphenol A affects the methylation of GNG11 promoter CTD PMID:27334623 Gng11 Rat bisphenol A multiple interactions ISO GNG11 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of GNG11 mRNA CTD PMID:28628672 Gng11 Rat bisphenol F increases expression ISO Gng11 (Mus musculus) 6480464 bisphenol F results in increased expression of GNG11 mRNA CTD PMID:30951980 Gng11 Rat bleomycin A5 decreases expression ISO GNG11 (Homo sapiens) 6480464 bleomycetin results in decreased expression of GNG11 mRNA CTD PMID:21040473 Gng11 Rat cadmium dichloride increases expression ISO GNG11 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of GNG11 mRNA CTD PMID:38568856 Gng11 Rat carbamazepine affects expression ISO GNG11 (Homo sapiens) 6480464 Carbamazepine affects the expression of GNG11 mRNA CTD PMID:25979313 Gng11 Rat carbon nanotube decreases expression ISO Gng11 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 Gng11 Rat chromium(6+) multiple interactions ISO GNG11 (Homo sapiens) 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in increased expression of GNG11 mRNA CTD PMID:38479592 Gng11 Rat cisplatin decreases expression ISO GNG11 (Homo sapiens) 6480464 Cisplatin results in decreased expression of GNG11 mRNA CTD PMID:27392435 Gng11 Rat cobalt dichloride decreases expression ISO GNG11 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of GNG11 mRNA CTD PMID:19320972 and PMID:19376846 Gng11 Rat copper(II) chloride increases expression ISO GNG11 (Homo sapiens) 6480464 cupric chloride results in increased expression of GNG11 mRNA CTD PMID:38568856 Gng11 Rat copper(II) sulfate decreases expression ISO GNG11 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of GNG11 mRNA CTD PMID:19549813 Gng11 Rat crocidolite asbestos increases expression ISO GNG11 (Homo sapiens) 6480464 Asbestos and Crocidolite results in increased expression of GNG11 mRNA CTD PMID:28056339 and PMID:29523930 Gng11 Rat crocidolite asbestos decreases expression ISO Gng11 (Mus musculus) 6480464 Asbestos and Crocidolite results in decreased expression of GNG11 mRNA CTD PMID:29279043 Gng11 Rat dexamethasone multiple interactions ISO GNG11 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of GNG11 mRNA CTD PMID:28628672 Gng11 Rat dioxygen multiple interactions ISO Gng11 (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of GNG11 mRNA CTD PMID:30529165 Gng11 Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of GNG11 mRNA CTD PMID:25152437 Gng11 Rat diuron increases expression EXP 6480464 Diuron results in increased expression of GNG11 mRNA CTD PMID:21551480 Gng11 Rat dorsomorphin multiple interactions ISO GNG11 (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Gng11 Rat doxorubicin increases expression ISO GNG11 (Homo sapiens) 6480464 Doxorubicin results in increased expression of GNG11 mRNA CTD PMID:29803840 Gng11 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of GNG11 mRNA CTD PMID:29391264 Gng11 Rat ethanol decreases expression ISO Gng11 (Mus musculus) 6480464 Ethanol results in decreased expression of GNG11 mRNA CTD PMID:21955143 Gng11 Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of GNG11 mRNA CTD PMID:24136188 Gng11 Rat furan increases expression EXP 6480464 furan results in increased expression of GNG11 mRNA CTD PMID:27387713 Gng11 Rat genistein decreases expression ISO GNG11 (Homo sapiens) 6480464 Genistein results in decreased expression of GNG11 mRNA CTD PMID:26865667 Gng11 Rat indoles decreases expression EXP 6480464 Indoles results in decreased expression of GNG11 mRNA CTD PMID:20521778 Gng11 Rat indometacin multiple interactions ISO GNG11 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of GNG11 mRNA CTD PMID:28628672 Gng11 Rat irinotecan multiple interactions ISO Gng11 (Mus musculus) 6480464 [PHY 906 co-treated with Irinotecan] affects the expression of GNG11 mRNA CTD PMID:32812032 Gng11 Rat ketoconazole decreases expression ISO GNG11 (Homo sapiens) 6480464 Ketoconazole results in decreased expression of GNG11 mRNA CTD PMID:36621641 Gng11 Rat lead diacetate increases expression ISO GNG11 (Homo sapiens) 6480464 lead acetate results in increased expression of GNG11 mRNA CTD PMID:38568856 Gng11 Rat melittin decreases expression ISO Gng11 (Mus musculus) 6480464 Melitten results in decreased expression of GNG11 mRNA CTD PMID:37678661 Gng11 Rat mercury dibromide increases expression ISO GNG11 (Homo sapiens) 6480464 mercuric bromide results in increased expression of GNG11 mRNA CTD PMID:26272509 Gng11 Rat methotrexate affects response to substance ISO GNG11 (Homo sapiens) 6480464 GNG11 protein affects the susceptibility to Methotrexate CTD PMID:16217747 Gng11 Rat methylmercury chloride increases expression ISO GNG11 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of GNG11 mRNA CTD PMID:28001369 Gng11 Rat methylparaben decreases expression ISO GNG11 (Homo sapiens) 6480464 methylparaben results in decreased expression of GNG11 mRNA CTD PMID:31745603 Gng11 Rat morphine decreases expression ISO Gng11 (Mus musculus) 6480464 Morphine results in decreased expression of GNG11 mRNA CTD PMID:21955143 Gng11 Rat nickel sulfate increases expression ISO GNG11 (Homo sapiens) 6480464 nickel sulfate results in increased expression of GNG11 mRNA CTD PMID:22714537 Gng11 Rat nicotine decreases expression ISO Gng11 (Mus musculus) 6480464 Nicotine results in decreased expression of GNG11 mRNA CTD PMID:21955143 Gng11 Rat nitrates multiple interactions ISO Gng11 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of GNG11 mRNA CTD PMID:35964746 Gng11 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of GNG11 mRNA CTD PMID:25729387 Gng11 Rat panobinostat multiple interactions ISO GNG11 (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of GNG11 mRNA CTD PMID:27188386 Gng11 Rat panobinostat increases expression ISO GNG11 (Homo sapiens) 6480464 panobinostat results in increased expression of GNG11 mRNA CTD PMID:26272509 Gng11 Rat paracetamol affects expression ISO Gng11 (Mus musculus) 6480464 Acetaminophen affects the expression of GNG11 mRNA CTD PMID:17562736 Gng11 Rat paracetamol increases expression ISO GNG11 (Homo sapiens) 6480464 Acetaminophen results in increased expression of GNG11 mRNA CTD PMID:29067470 Gng11 Rat paracetamol decreases expression ISO GNG11 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of GNG11 mRNA CTD PMID:26690555 Gng11 Rat perfluorohexanesulfonic acid increases expression ISO Gng11 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in increased expression of GNG11 mRNA CTD PMID:37995155 Gng11 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of GNG11 mRNA CTD PMID:35163327 Gng11 Rat phenylmercury acetate increases expression ISO GNG11 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of GNG11 mRNA CTD PMID:26272509 Gng11 Rat phenylmercury acetate multiple interactions ISO GNG11 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of GNG11 mRNA CTD PMID:27188386 Gng11 Rat pirinixic acid increases expression ISO Gng11 (Mus musculus) 6480464 pirinixic acid results in increased expression of GNG11 mRNA CTD PMID:17426115 Gng11 Rat piroxicam decreases expression ISO GNG11 (Homo sapiens) 6480464 Piroxicam results in decreased expression of GNG11 mRNA CTD PMID:21858171 Gng11 Rat progesterone multiple interactions ISO GNG11 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in increased expression of GNG11 mRNA CTD PMID:20660070 Gng11 Rat rac-lactic acid decreases expression ISO GNG11 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of GNG11 mRNA CTD PMID:30851411 Gng11 Rat SB 431542 multiple interactions ISO GNG11 (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Gng11 Rat sodium arsenite increases expression ISO GNG11 (Homo sapiens) 6480464 sodium arsenite results in increased expression of GNG11 mRNA CTD PMID:22714537 Gng11 Rat sunitinib decreases expression ISO GNG11 (Homo sapiens) 6480464 Sunitinib results in decreased expression of GNG11 mRNA CTD PMID:31533062 Gng11 Rat temozolomide decreases expression ISO GNG11 (Homo sapiens) 6480464 Temozolomide results in decreased expression of GNG11 mRNA CTD PMID:31758290 Gng11 Rat tetrachloromethane decreases expression ISO Gng11 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of GNG11 mRNA CTD PMID:31919559 Gng11 Rat titanium dioxide decreases expression ISO Gng11 (Mus musculus) 6480464 titanium dioxide results in decreased expression of GNG11 mRNA CTD PMID:27760801 Gng11 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of GNG11 mRNA CTD PMID:25729387 Gng11 Rat tributylstannane increases expression EXP 6480464 tributyltin results in increased expression of GNG11 mRNA CTD PMID:21683754 Gng11 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of GNG11 mRNA CTD PMID:33387578 Gng11 Rat trichostatin A increases expression ISO GNG11 (Homo sapiens) 6480464 trichostatin A results in increased expression of GNG11 mRNA CTD PMID:24935251 and PMID:26272509 Gng11 Rat trichostatin A multiple interactions ISO GNG11 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of GNG11 mRNA CTD PMID:27188386 Gng11 Rat triphenyl phosphate affects expression ISO GNG11 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of GNG11 mRNA CTD PMID:37042841 Gng11 Rat undecane increases expression EXP 6480464 undecane results in increased expression of GNG11 protein CTD PMID:17337753 Gng11 Rat valproic acid affects expression ISO GNG11 (Homo sapiens) 6480464 Valproic Acid affects the expression of GNG11 mRNA CTD PMID:25979313 Gng11 Rat valproic acid multiple interactions ISO GNG11 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of GNG11 mRNA CTD PMID:27188386 Gng11 Rat valproic acid increases expression ISO GNG11 (Homo sapiens) 6480464 Valproic Acid results in increased expression of GNG11 mRNA CTD PMID:23179753 more ... Gng11 Rat valproic acid decreases expression ISO GNG11 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of GNG11 mRNA CTD PMID:29154799 Gng11 Rat valproic acid increases methylation ISO GNG11 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of GNG11 gene CTD PMID:29154799 Gng11 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of GNG11 mRNA CTD PMID:19015723 Gng11 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of GNG11 mRNA CTD PMID:23034163 Gng11 Rat vorinostat multiple interactions ISO GNG11 (Homo sapiens) 6480464 [NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of GNG11 mRNA CTD PMID:27188386 Gng11 Rat vorinostat increases expression ISO GNG11 (Homo sapiens) 6480464 vorinostat results in increased expression of GNG11 mRNA CTD PMID:26272509 and PMID:27188386 Gng11 Rat zinc sulfate decreases expression ISO GNG11 (Homo sapiens) 6480464 Zinc Sulfate results in decreased expression of GNG11 mRNA CTD PMID:12756304
Imported Annotations - KEGG (archival)
(S)-nicotine (ISO) 1,2,4-trimethylbenzene (EXP) 1,2-dimethylhydrazine (ISO) 1-naphthyl isothiocyanate (EXP) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dichlorophenol (ISO) 2,6-dinitrotoluene (EXP) 2-hydroxypropanoic acid (ISO) 2-methylcholine (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) acrylamide (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) alpha-Zearalanol (EXP) ammonium chloride (EXP) antirheumatic drug (ISO) aristolochic acid A (ISO) Aroclor 1254 (ISO) arsenite(3-) (ISO) belinostat (ISO) benzene (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) bleomycin A5 (ISO) cadmium dichloride (ISO) carbamazepine (ISO) carbon nanotube (ISO) chromium(6+) (ISO) cisplatin (ISO) cobalt dichloride (ISO) copper(II) chloride (ISO) copper(II) sulfate (ISO) crocidolite asbestos (ISO) dexamethasone (ISO) dioxygen (ISO) diuron (EXP) dorsomorphin (ISO) doxorubicin (ISO) endosulfan (EXP) ethanol (ISO) flutamide (EXP) furan (EXP) genistein (ISO) indoles (EXP) indometacin (ISO) irinotecan (ISO) ketoconazole (ISO) lead diacetate (ISO) melittin (ISO) mercury dibromide (ISO) methotrexate (ISO) methylmercury chloride (ISO) methylparaben (ISO) morphine (ISO) nickel sulfate (ISO) nicotine (ISO) nitrates (ISO) oxaliplatin (EXP) panobinostat (ISO) paracetamol (ISO) perfluorohexanesulfonic acid (ISO) perfluorooctanoic acid (EXP) phenylmercury acetate (ISO) pirinixic acid (ISO) piroxicam (ISO) progesterone (ISO) rac-lactic acid (ISO) SB 431542 (ISO) sodium arsenite (ISO) sunitinib (ISO) temozolomide (ISO) tetrachloromethane (ISO) titanium dioxide (ISO) topotecan (EXP) tributylstannane (EXP) trichloroethene (EXP) trichostatin A (ISO) triphenyl phosphate (ISO) undecane (EXP) valproic acid (ISO) vinclozolin (EXP) vorinostat (ISO) zinc sulfate (ISO)
Gng11 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 32,977,681 - 32,983,121 (+) NCBI GRCr8 mRatBN7.2 4 32,023,003 - 32,028,443 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 32,023,003 - 32,028,442 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 36,995,710 - 37,001,147 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 32,921,836 - 32,927,273 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 31,286,319 - 31,291,754 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 28,989,170 - 28,994,610 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 28,989,115 - 28,993,621 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 31,387,420 - 31,392,856 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 28,897,478 - 28,902,918 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 28,847,907 - 28,853,347 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 4 27,409,779 - 27,415,196 (+) NCBI Celera Cytogenetic Map 4 q13 NCBI
GNG11 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 7 93,921,735 - 93,928,610 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 7 93,921,735 - 93,928,610 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 7 93,551,047 - 93,557,922 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 7 93,388,952 - 93,393,762 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 7 93,195,749 - 93,200,475 NCBI Celera 7 88,249,318 - 88,254,128 (+) NCBI Celera Cytogenetic Map 7 q21.3 NCBI HuRef 7 88,158,590 - 88,163,399 (+) NCBI HuRef CHM1_1 7 93,481,248 - 93,486,058 (+) NCBI CHM1_1 T2T-CHM13v2.0 7 95,157,662 - 95,164,537 (+) NCBI T2T-CHM13v2.0 CRA_TCAGchr7v2 7 92,880,183 - 92,884,993 (+) NCBI
Gng11 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 6 4,003,987 - 4,008,445 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 6 4,003,904 - 4,008,445 (+) Ensembl GRCm39 Ensembl GRCm38 6 4,003,987 - 4,008,445 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 6 4,003,904 - 4,008,445 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 6 3,953,987 - 3,958,445 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 6 3,953,987 - 3,958,445 (+) NCBI MGSCv36 mm8 Celera 6 4,150,596 - 4,155,058 (+) NCBI Celera Cytogenetic Map 6 A1 NCBI cM Map 6 1.81 NCBI
Gng11 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955432 10,664,170 - 10,668,953 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955432 10,664,251 - 10,668,749 (+) NCBI ChiLan1.0 ChiLan1.0
GNG11 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 6 111,757,939 - 111,763,065 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 7 160,022,679 - 160,027,706 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 7 85,870,321 - 85,875,309 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 7 99,461,797 - 99,466,632 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 7 99,461,797 - 99,466,632 (+) Ensembl panpan1.1 panPan2
GNG11 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 14 19,426,916 - 19,431,232 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 14 19,426,685 - 19,431,235 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 14 18,986,494 - 18,990,804 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 14 19,241,337 - 19,245,636 (+) NCBI ROS_Cfam_1.0 UMICH_Zoey_3.1 14 19,394,040 - 19,398,345 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 14 19,129,161 - 19,133,467 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 14 19,386,428 - 19,390,738 (+) NCBI UU_Cfam_GSD_1.0
Gng11
GNG11 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 9 73,721,322 - 73,726,222 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 9 73,721,327 - 73,726,229 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 9 80,762,603 - 80,767,399 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
Gng11
.
Predicted Target Of
Count of predictions: 365 Count of miRNA genes: 146 Interacting mature miRNAs: 176 Transcripts: ENSRNOT00000074048, ENSRNOT00000075326 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2302371 Stl22 Serum triglyceride level QTL 22 5.15 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 4 5218294 57114705 Rat 2303585 Bw86 Body weight QTL 86 4 body mass (VT:0001259) body weight (CMO:0000012) 4 14678065 59678065 Rat 8552906 Pigfal3 Plasma insulin-like growth factor 1 level QTL 3 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 4 10084089 55084089 Rat 1357341 Gluco5 Glucose level QTL 5 6.4 adipocyte free fatty acid secretion trait (VT:0010465) absolute change in adipocyte free fatty acid secretion per unit volume (CMO:0001446) 4 1 33250345 Rat 10755501 Bp390 Blood pressure QTL 390 2.5 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 4 26775591 168368347 Rat 1357343 Gluco4 Glucose level QTL 4 0.00002 adipocyte glucose uptake trait (VT:0004185) adipocyte maximal glucose uptake to basal glucose uptake ratio (CMO:0000874) 4 1 33250345 Rat 6478766 Anxrr47 Anxiety related response QTL 47 0.09637 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 4 10084089 55084089 Rat 70222 Eae2 Experimental allergic encephalomyelitis QTL 2 4.3 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 4 21333343 39505420 Rat 631642 Stl2 Serum triglyceride level QTL 2 3.3 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 4 5219178 56647776 Rat 6478769 Anxrr48 Anxiety related response QTL 48 0.02514 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 10084089 55084089 Rat 631261 Tcas3 Tongue tumor susceptibility QTL 3 6.88 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 4 10814170 91360527 Rat 634323 Hc2 Hypercalciuria QTL 2 2.15 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 4 210796 45210796 Rat 2313401 Anxrr27 Anxiety related response QTL 27 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 4 17933508 62933508 Rat 631209 Bw2 Body weight QTL2 4.2 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 4 9940885 44463908 Rat 8552803 Bw144 Body weight QTL 144 16 body mass (VT:0001259) change in body weight to body weight ratio (CMO:0002216) 4 22710685 34430484 Rat 6909128 Pancm4 Pancreatic morphology QTL 4 11.35 pancreas mass (VT:0010144) pancreas wet weight (CMO:0000626) 4 26907285 75585128 Rat 8694374 Bw155 Body weight QTL 155 3.39 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 4 10084089 55084089 Rat 2303168 Bp330 Blood pressure QTL 330 4.25 0.017 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 5214602 146446691 Rat 61412 Pia2 Pristane induced arthritis QTL 2 3.9 joint integrity trait (VT:0010548) post-insult time to onset of experimental arthritis (CMO:0001450) 4 21333343 62278020 Rat 6478724 Anxrr35 Anxiety related response QTL 35 0.00449 defecation behavior trait (VT:0010462) defecation measurement (CMO:0000997) 4 10084089 55084089 Rat 8655906 Rf60 Renal function QTL 60 3.8 blood creatinine amount (VT:0005328) creatinine clearance (CMO:0000765) 4 29494195 81006281 Rat 61415 Eae11 Experimental allergic encephalomyelitis QTL 11 2.9 nervous system integrity trait (VT:0010566) post-insult time to onset of experimental autoimmune encephalomyelitis (CMO:0001422) 4 1 39505420 Rat 619616 Bp79 Blood pressure QTL 79 0.0292 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 5214602 78882945 Rat 7387227 Uae40 Urinary albumin excretion QTL 40 2.9 0.0052 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 4 17946999 62946999 Rat 6909122 Insul22 Insulin level QTL 22 4.63 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 4 26907285 75585128 Rat 738021 Hcar13 Hepatocarcinoma resistance QTL 13 4.3 liver integrity trait (VT:0010547) liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464) 4 1 32584199 Rat 1358203 Stl19 Serum triglyceride level QTL 19 2.8 0.002 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 4 5218294 65958103 Rat 9590304 Scort17 Serum corticosterone level QTL 17 4.96 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 10084089 55084089 Rat 2316958 Gluco58 Glucose level QTL 58 10 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 11320076 180699135 Rat 1354665 Stl10 Serum triglyceride level QTL 10 3.57 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 4 21333343 44463908 Rat 1300141 Bp178 Blood pressure QTL 178 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 10024901 39524530 Rat
RH128150
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 32,027,165 - 32,027,368 (+) MAPPER mRatBN7.2 Rnor_6.0 4 31,391,580 - 31,391,782 NCBI Rnor6.0 Rnor_6.0 4 28,993,333 - 28,993,535 NCBI Rnor6.0 Rnor_5.0 4 28,901,641 - 28,901,843 UniSTS Rnor5.0 Rnor_5.0 4 31,295,387 - 31,295,589 UniSTS Rnor5.0 RGSC_v3.4 4 28,852,070 - 28,852,272 UniSTS RGSC3.4 Celera 4 27,413,919 - 27,414,121 UniSTS Cytogenetic Map 4 q13 UniSTS
RH133225
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 32,028,131 - 32,028,350 (+) MAPPER mRatBN7.2 Rnor_6.0 4 31,392,546 - 31,392,764 NCBI Rnor6.0 Rnor_6.0 4 28,994,299 - 28,994,517 NCBI Rnor6.0 Rnor_5.0 4 31,296,353 - 31,296,571 UniSTS Rnor5.0 Rnor_5.0 4 28,902,607 - 28,902,825 UniSTS Rnor5.0 RGSC_v3.4 4 28,853,036 - 28,853,254 UniSTS RGSC3.4 Celera 4 27,414,885 - 27,415,103 UniSTS RH 3.4 Map 4 475.01 UniSTS Cytogenetic Map 4 q13 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
12
12
62
68
60
36
12
36
12
116
48
38
20
38
24
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000074048 ⟹ ENSRNOP00000065818
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 32,023,003 - 32,028,442 (+) Ensembl Rnor_6.0 Ensembl 4 31,387,420 - 31,392,856 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000075326 ⟹ ENSRNOP00000066965
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 4 28,989,115 - 28,993,621 (+) Ensembl
RefSeq Acc Id:
NM_022396 ⟹ NP_071791
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 32,977,681 - 32,983,121 (+) NCBI mRatBN7.2 4 32,023,003 - 32,028,443 (+) NCBI Rnor_6.0 4 28,989,170 - 28,994,610 (+) NCBI Rnor_5.0 4 28,897,478 - 28,902,918 (+) NCBI RGSC_v3.4 4 28,847,907 - 28,853,347 (+) RGD Celera 4 27,409,779 - 27,415,196 (+) RGD
Sequence:
GCAGCCTTCCAGGAGCAGCCAGGAAGATGTCTCAAACTTAACCCTCTGCAAGCTGCCAGGCTAAAGGGCTGGTAGAGCCTGGAGAAGCCGCCCTGAGGTTGCTTGGAGTCTGGGAAAGGCCATCGGGA
hide sequence
RefSeq Acc Id:
NP_071791 ⟸ NM_022396
- UniProtKB:
Q4V8M0 (UniProtKB/Swiss-Prot), P61954 (UniProtKB/Swiss-Prot), A6K2B4 (UniProtKB/TrEMBL)
- Sequence:
MPALHIEDLPEKEKLKMEVEQLRKEVKLQRQQVSKCSEEIKNYIEERSGEDPLVKGIPEDKNPFKEKGSCVIS
hide sequence
Ensembl Acc Id:
ENSRNOP00000066965 ⟸ ENSRNOT00000075326
Ensembl Acc Id:
ENSRNOP00000065818 ⟸ ENSRNOT00000074048
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2021-03-09
Gng11
G protein subunit gamma 11
LOC100912034
guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11-like
Data merged from RGD:6489513
737654 PROVISIONAL
2016-03-15
Gng11
G protein subunit gamma 11
Gng11
guanine nucleotide binding protein (G protein), gamma 11
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2012-07-05
LOC100912034
guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11-like
Symbol and Name status set to provisional
70820 PROVISIONAL
2004-09-10
Gng11
guanine nucleotide binding protein (G protein), gamma 11
guanine nucleotide binding protein gamma subunit 11
Name updated
1299863 APPROVED
2002-08-07
Gng11
guanine nucleotide binding protein gamma subunit 11
Symbol and Name status set to provisional
70820 PROVISIONAL
