Symbol:
Pglyrp1
Name:
peptidoglycan recognition protein 1
RGD ID:
621429
Description:
Predicted to enable several functions, including Hsp70 protein binding activity; peptidoglycan binding activity; and peptidoglycan immune receptor activity. Involved in regulation of circadian sleep/wake cycle, sleep. Predicted to be located in extracellular region. Predicted to be active in extracellular space. Orthologous to human PGLYRP1 (peptidoglycan recognition protein 1); INTERACTS WITH 17beta-estradiol; 17beta-estradiol 3-benzoate; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
peptidoglycan recognition protein; Pglyrp; Pgrp; PGRP-S
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 87,659,863 - 87,665,048 (+) NCBI GRCr8 mRatBN7.2 1 78,531,815 - 78,537,001 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 78,531,815 - 78,537,001 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 83,920,938 - 83,926,080 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 92,478,152 - 92,483,315 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 85,676,048 - 85,681,190 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 79,790,879 - 79,796,064 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 79,790,705 - 79,796,111 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 81,052,612 - 81,057,412 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 78,235,474 - 78,240,665 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 78,313,584 - 78,318,776 (+) NCBI Celera 1 72,998,755 - 73,003,829 (+) NCBI Celera Cytogenetic Map 1 q21 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Pglyrp1 Rat 1,2-dichloroethane decreases expression ISO Pglyrp1 (Mus musculus) 6480464 ethylene dichloride results in decreased expression of PGLYRP1 mRNA CTD PMID:28960355 Pglyrp1 Rat 1,2-dimethylhydrazine increases expression ISO Pglyrp1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of PGLYRP1 mRNA CTD PMID:22206623 Pglyrp1 Rat 1,2-dimethylhydrazine multiple interactions ISO Pglyrp1 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of PGLYRP1 mRNA] CTD PMID:22206623 Pglyrp1 Rat 17alpha-ethynylestradiol multiple interactions ISO Pglyrp1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PGLYRP1 mRNA CTD PMID:17942748 Pglyrp1 Rat 17beta-estradiol affects expression ISO Pglyrp1 (Mus musculus) 6480464 Estradiol affects the expression of PGLYRP1 mRNA CTD PMID:15598610 Pglyrp1 Rat 17beta-estradiol multiple interactions ISO PGLYRP1 (Homo sapiens) 6480464 [Estradiol co-treated with Norethindrone Acetate] results in increased expression of PGLYRP1 mRNA CTD PMID:22217510 Pglyrp1 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of PGLYRP1 mRNA CTD PMID:32145629 Pglyrp1 Rat 17beta-estradiol multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of PGLYRP1 mRNA CTD PMID:32741896 Pglyrp1 Rat 17beta-estradiol increases expression ISO Pglyrp1 (Mus musculus) 6480464 Estradiol results in increased expression of PGLYRP1 mRNA CTD PMID:15289156 Pglyrp1 Rat 17beta-estradiol 3-benzoate multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of PGLYRP1 mRNA CTD PMID:32741896 Pglyrp1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Pglyrp1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PGLYRP1 mRNA CTD PMID:17942748 Pglyrp1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of PGLYRP1 mRNA CTD PMID:32109520 and PMID:33387578 Pglyrp1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Pglyrp1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of PGLYRP1 mRNA CTD PMID:21570461 and PMID:28922406 Pglyrp1 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Pglyrp1 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Pglyrp1 Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO PGLYRP1 (Homo sapiens) 6480464 tetrabromobisphenol A results in decreased expression of PGLYRP1 mRNA CTD PMID:25461914 Pglyrp1 Rat 4,4'-sulfonyldiphenol increases expression ISO Pglyrp1 (Mus musculus) 6480464 bisphenol S results in increased expression of PGLYRP1 mRNA CTD PMID:30951980 Pglyrp1 Rat 5-fluorouracil multiple interactions ISO PGLYRP1 (Homo sapiens) 6480464 TP53 protein affects the reaction [Fluorouracil results in decreased expression of PGLYRP1 mRNA] CTD PMID:15016801 Pglyrp1 Rat 7,12-dimethyltetraphene affects expression ISO Pglyrp1 (Mus musculus) 6480464 9 more ... CTD PMID:21785161 Pglyrp1 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of PGLYRP1 mRNA CTD PMID:31881176 Pglyrp1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PGLYRP1 mRNA CTD PMID:16483693 Pglyrp1 Rat arsane increases expression ISO Pglyrp1 (Mus musculus) 6480464 Arsenic results in increased expression of PGLYRP1 mRNA CTD PMID:19654921 Pglyrp1 Rat arsenic atom increases expression ISO Pglyrp1 (Mus musculus) 6480464 Arsenic results in increased expression of PGLYRP1 mRNA CTD PMID:19654921 Pglyrp1 Rat benzo[a]pyrene decreases expression ISO Pglyrp1 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of PGLYRP1 mRNA CTD PMID:22228805 Pglyrp1 Rat benzo[a]pyrene decreases methylation ISO PGLYRP1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of PGLYRP1 exon CTD PMID:27901495 Pglyrp1 Rat benzo[a]pyrene affects expression ISO Pglyrp1 (Mus musculus) 6480464 Benzo(a)pyrene affects the expression of PGLYRP1 mRNA CTD PMID:22342234 Pglyrp1 Rat benzo[b]fluoranthene increases expression ISO Pglyrp1 (Mus musculus) 6480464 benzo(b)fluoranthene results in increased expression of PGLYRP1 mRNA CTD PMID:26377693 Pglyrp1 Rat bis(2-ethylhexyl) phthalate increases expression ISO Pglyrp1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of PGLYRP1 mRNA CTD PMID:33754040 Pglyrp1 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of PGLYRP1 gene CTD PMID:28505145 Pglyrp1 Rat bisphenol A increases expression ISO Pglyrp1 (Mus musculus) 6480464 bisphenol A results in increased expression of PGLYRP1 mRNA CTD PMID:32156529 Pglyrp1 Rat bisphenol A multiple interactions ISO PGLYRP1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of PGLYRP1 gene CTD PMID:31601247 Pglyrp1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PGLYRP1 mRNA CTD PMID:32145629 Pglyrp1 Rat captan decreases expression ISO Pglyrp1 (Mus musculus) 6480464 Captan results in decreased expression of PGLYRP1 mRNA CTD PMID:31558096 Pglyrp1 Rat carbon nanotube increases expression ISO Pglyrp1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:27106021 Pglyrp1 Rat carnosic acid decreases expression ISO Pglyrp1 (Mus musculus) 6480464 salvin results in decreased expression of PGLYRP1 protein CTD PMID:35926579 Pglyrp1 Rat chlordecone increases expression ISO Pglyrp1 (Mus musculus) 6480464 Chlordecone results in increased expression of PGLYRP1 mRNA CTD PMID:33711761 Pglyrp1 Rat choline multiple interactions ISO Pglyrp1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of PGLYRP1 mRNA CTD PMID:20938992 Pglyrp1 Rat cisplatin decreases expression ISO PGLYRP1 (Homo sapiens) 6480464 Cisplatin results in decreased expression of PGLYRP1 mRNA CTD PMID:27392435 Pglyrp1 Rat copper atom multiple interactions ISO Pglyrp1 (Mus musculus) 6480464 [ATP7A gene mutant form results in increased abundance of Copper] which results in decreased expression of PGLYRP1 mRNA CTD PMID:15467011 Pglyrp1 Rat copper(0) multiple interactions ISO Pglyrp1 (Mus musculus) 6480464 [ATP7A gene mutant form results in increased abundance of Copper] which results in decreased expression of PGLYRP1 mRNA CTD PMID:15467011 Pglyrp1 Rat crocidolite asbestos increases expression ISO Pglyrp1 (Mus musculus) 6480464 Asbestos and Crocidolite results in increased expression of PGLYRP1 mRNA CTD PMID:29279043 Pglyrp1 Rat Dibutyl phosphate affects expression ISO PGLYRP1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of PGLYRP1 mRNA CTD PMID:37042841 Pglyrp1 Rat diethylstilbestrol decreases expression ISO Pglyrp1 (Mus musculus) 6480464 Diethylstilbestrol results in decreased expression of PGLYRP1 mRNA CTD PMID:15171707 Pglyrp1 Rat diethylstilbestrol increases expression ISO Pglyrp1 (Mus musculus) 6480464 Diethylstilbestrol results in increased expression of PGLYRP1 mRNA CTD PMID:15289156 Pglyrp1 Rat dioxygen multiple interactions EXP 6480464 [Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in increased expression of PGLYRP1 mRNA CTD PMID:33729688 Pglyrp1 Rat fenthion increases expression ISO Pglyrp1 (Mus musculus) 6480464 Fenthion results in increased expression of PGLYRP1 mRNA CTD PMID:34813904 Pglyrp1 Rat flavonoids increases expression EXP 6480464 Flavonoids results in increased expression of PGLYRP1 mRNA CTD PMID:18035473 Pglyrp1 Rat folic acid multiple interactions ISO Pglyrp1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of PGLYRP1 mRNA more ... CTD PMID:20938992 and PMID:22206623 Pglyrp1 Rat fulvestrant multiple interactions ISO PGLYRP1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of PGLYRP1 gene CTD PMID:31601247 Pglyrp1 Rat genistein increases expression ISO Pglyrp1 (Mus musculus) 6480464 Genistein results in increased expression of PGLYRP1 mRNA CTD PMID:15289156 Pglyrp1 Rat hexachlorobenzene increases expression EXP 6480464 Hexachlorobenzene results in increased expression of PGLYRP1 mRNA CTD PMID:15159207 Pglyrp1 Rat hydrogen sulfide increases expression ISO Pglyrp1 (Mus musculus) 6480464 Hydrogen Sulfide results in increased expression of PGLYRP1 mRNA CTD PMID:31843631 Pglyrp1 Rat L-methionine multiple interactions ISO Pglyrp1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of PGLYRP1 mRNA CTD PMID:20938992 Pglyrp1 Rat lead(0) affects methylation ISO PGLYRP1 (Homo sapiens) 6480464 Lead affects the methylation of PGLYRP1 gene CTD PMID:31636367 Pglyrp1 Rat metacetamol decreases expression ISO Pglyrp1 (Mus musculus) 6480464 3-hydroxyacetanilide results in decreased expression of PGLYRP1 mRNA CTD PMID:18544908 Pglyrp1 Rat methidathion increases expression ISO Pglyrp1 (Mus musculus) 6480464 methidathion results in increased expression of PGLYRP1 mRNA CTD PMID:34813904 Pglyrp1 Rat nickel sulfate increases expression ISO Pglyrp1 (Mus musculus) 6480464 nickel sulfate results in increased expression of PGLYRP1 mRNA CTD PMID:16166746 Pglyrp1 Rat nitrofen increases expression EXP 6480464 nitrofen results in increased expression of PGLYRP1 mRNA CTD PMID:33484710 Pglyrp1 Rat ozone multiple interactions ISO Pglyrp1 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of PGLYRP1 mRNA CTD PMID:34911549 Pglyrp1 Rat paracetamol increases expression ISO Pglyrp1 (Mus musculus) 6480464 Acetaminophen results in increased expression of PGLYRP1 mRNA CTD PMID:18544908 Pglyrp1 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of PGLYRP1 mRNA CTD PMID:33387578 Pglyrp1 Rat paracetamol decreases expression ISO PGLYRP1 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of PGLYRP1 mRNA CTD PMID:26690555 Pglyrp1 Rat paraquat increases expression ISO Pglyrp1 (Mus musculus) 6480464 Paraquat results in increased expression of PGLYRP1 mRNA CTD PMID:21463325 Pglyrp1 Rat pirinixic acid decreases expression ISO Pglyrp1 (Mus musculus) 6480464 pirinixic acid results in decreased expression of PGLYRP1 mRNA CTD PMID:17426115 Pglyrp1 Rat progesterone affects expression ISO Pglyrp1 (Mus musculus) 6480464 Progesterone affects the expression of PGLYRP1 mRNA CTD PMID:17251523 Pglyrp1 Rat progesterone increases expression ISO Pglyrp1 (Mus musculus) 6480464 Progesterone results in increased expression of PGLYRP1 mRNA CTD PMID:21549006 Pglyrp1 Rat sodium arsenite decreases expression ISO Pglyrp1 (Mus musculus) 6480464 sodium arsenite results in decreased expression of PGLYRP1 protein CTD PMID:29044176 Pglyrp1 Rat sodium fluoride increases expression ISO Pglyrp1 (Mus musculus) 6480464 Sodium Fluoride results in increased expression of PGLYRP1 mRNA CTD PMID:27862939 Pglyrp1 Rat testosterone multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of PGLYRP1 mRNA CTD PMID:32741896 Pglyrp1 Rat titanium dioxide increases expression ISO Pglyrp1 (Mus musculus) 6480464 titanium dioxide results in increased expression of PGLYRP1 mRNA CTD PMID:29264374 Pglyrp1 Rat titanium dioxide affects expression ISO Pglyrp1 (Mus musculus) 6480464 titanium dioxide affects the expression of PGLYRP1 mRNA CTD PMID:23557971 Pglyrp1 Rat trimellitic anhydride decreases expression ISO Pglyrp1 (Mus musculus) 6480464 trimellitic anhydride results in decreased expression of PGLYRP1 mRNA CTD PMID:16141432 and PMID:19042947 Pglyrp1 Rat triphenyl phosphate affects expression ISO PGLYRP1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of PGLYRP1 mRNA CTD PMID:37042841 Pglyrp1 Rat triptonide increases expression ISO Pglyrp1 (Mus musculus) 6480464 triptonide results in increased expression of PGLYRP1 mRNA CTD PMID:33045310 Pglyrp1 Rat tungsten decreases expression ISO Pglyrp1 (Mus musculus) 6480464 Tungsten results in decreased expression of PGLYRP1 mRNA CTD PMID:30912803 Pglyrp1 Rat valproic acid increases methylation ISO PGLYRP1 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of PGLYRP1 gene CTD PMID:29154799
1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 17beta-estradiol 3-benzoate (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 4,4'-sulfonyldiphenol (ISO) 5-fluorouracil (ISO) 7,12-dimethyltetraphene (ISO) acetamide (EXP) ammonium chloride (EXP) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) captan (ISO) carbon nanotube (ISO) carnosic acid (ISO) chlordecone (ISO) choline (ISO) cisplatin (ISO) copper atom (ISO) copper(0) (ISO) crocidolite asbestos (ISO) Dibutyl phosphate (ISO) diethylstilbestrol (ISO) dioxygen (EXP) fenthion (ISO) flavonoids (EXP) folic acid (ISO) fulvestrant (ISO) genistein (ISO) hexachlorobenzene (EXP) hydrogen sulfide (ISO) L-methionine (ISO) lead(0) (ISO) metacetamol (ISO) methidathion (ISO) nickel sulfate (ISO) nitrofen (EXP) ozone (ISO) paracetamol (EXP,ISO) paraquat (ISO) pirinixic acid (ISO) progesterone (ISO) sodium arsenite (ISO) sodium fluoride (ISO) testosterone (EXP) titanium dioxide (ISO) trimellitic anhydride (ISO) triphenyl phosphate (ISO) triptonide (ISO) tungsten (ISO) valproic acid (ISO)
Pglyrp1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 87,659,863 - 87,665,048 (+) NCBI GRCr8 mRatBN7.2 1 78,531,815 - 78,537,001 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 78,531,815 - 78,537,001 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 83,920,938 - 83,926,080 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 92,478,152 - 92,483,315 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 85,676,048 - 85,681,190 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 79,790,879 - 79,796,064 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 79,790,705 - 79,796,111 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 81,052,612 - 81,057,412 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 78,235,474 - 78,240,665 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 78,313,584 - 78,318,776 (+) NCBI Celera 1 72,998,755 - 73,003,829 (+) NCBI Celera Cytogenetic Map 1 q21 NCBI
PGLYRP1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 19 46,019,153 - 46,023,053 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 19 46,019,153 - 46,023,053 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 19 46,522,411 - 46,526,311 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 19 51,214,281 - 51,218,163 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 19 51,214,280 - 51,218,163 NCBI Celera 19 43,327,424 - 43,331,569 (-) NCBI Celera Cytogenetic Map 19 q13.32 NCBI HuRef 19 42,950,408 - 42,954,553 (-) NCBI HuRef CHM1_1 19 46,524,786 - 46,528,931 (-) NCBI CHM1_1 T2T-CHM13v2.0 19 48,846,608 - 48,850,508 (-) NCBI T2T-CHM13v2.0
Pglyrp1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 18,618,615 - 18,624,363 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 18,605,256 - 18,624,384 (+) Ensembl GRCm39 Ensembl GRCm38 7 18,884,690 - 18,890,438 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 18,871,331 - 18,890,459 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 19,470,039 - 19,475,787 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 18,043,212 - 18,048,960 (+) NCBI MGSCv36 mm8 Celera 7 16,300,004 - 16,301,170 (+) NCBI Celera Cytogenetic Map 7 A3 NCBI cM Map 7 9.38 NCBI
Pglyrp1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955574 424,142 - 427,540 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955574 424,046 - 427,675 (-) NCBI ChiLan1.0 ChiLan1.0
PGLYRP1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 20 52,189,551 - 52,193,385 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 19 54,060,654 - 54,064,596 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 19 43,033,080 - 43,037,726 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 19 51,569,275 - 51,573,764 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 19 51,569,275 - 51,573,764 (-) Ensembl panpan1.1 panPan2
PGLYRP1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 1 109,614,404 - 109,618,242 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 1 109,614,437 - 109,618,242 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 1 109,097,721 - 109,101,584 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 1 110,145,349 - 110,149,427 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 1 110,105,232 - 110,149,439 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 1 109,821,146 - 109,825,013 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 1 109,455,876 - 109,459,739 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 1 110,324,620 - 110,328,483 (+) NCBI UU_Cfam_GSD_1.0
Pglyrp1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409349 17,969,780 - 17,973,488 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936706 2,315,132 - 2,320,796 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936706 2,317,137 - 2,320,993 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PGLYRP1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 52,318,531 - 52,322,638 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 52,318,544 - 52,322,504 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 47,708,977 - 47,712,942 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PGLYRP1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 6 39,474,077 - 39,478,635 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 6 39,474,170 - 39,477,914 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666073 19,118,432 - 19,122,570 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Pglyrp1
.
Predicted Target Of
Count of predictions: 77 Count of miRNA genes: 70 Interacting mature miRNAs: 72 Transcripts: ENSRNOT00000018233 Prediction methods: Microtar, Rnahybrid Result types: miRGate_prediction
2313059 Bss55 Bone structure and strength QTL 55 3.2 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 631688 Hcas2 Hepatocarcinoma susceptibility QTL 2 3 0.0001 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 5925874 115540829 Rat 1578649 Bmd8 Bone mineral density QTL 8 4.9 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 1 49393172 94393172 Rat 1582234 Gluco18 Glucose level QTL 18 3.4 0.0003 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 78479925 123479925 Rat 1358359 Sradr1 Stress Responsive Adrenal Weight QTL 1 4.74 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 30882023 123479925 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 4889929 Bss87 Bone structure and strength QTL 87 6.7 tibia area (VT:1000281) tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722) 1 53895117 82174945 Rat 2313062 Bmd73 Bone mineral density QTL 73 3.9 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 1 11481312 82174945 Rat 8552900 Pigfal1 Plasma insulin-like growth factor 1 level QTL 1 7.4 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 1 34836858 79836858 Rat 1578654 Bss10 Bone structure and strength QTL 10 4 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 1 49393172 159356837 Rat 1554320 Bmd1 Bone mineral density QTL 1 12.2 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 509108 86060548 Rat 2302059 Pia36 Pristane induced arthritis QTL 36 3.8 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 1 43333002 88333002 Rat 2313065 Bss67 Bone structure and strength QTL 67 3.1 0.0001 tibia area (VT:1000281) tibia total energy absorbed before break (CMO:0001736) 1 11481312 82174945 Rat 1300121 Hrtrt1 Heart rate QTL 1 3.7 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 65789093 115540829 Rat 7421628 Bp361 Blood pressure QTL 361 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 66023617 118608521 Rat 2313069 Bss68 Bone structure and strength QTL 68 2.9 0.0001 tibia size trait (VT:0100001) tibia total energy absorbed before break (CMO:0001736) 1 11481312 82174945 Rat 631495 Bp96 Blood pressure QTL 96 4.52 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 22340647 102268831 Rat 2313075 Bss66 Bone structure and strength QTL 66 3.4 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 1 11481312 82174945 Rat 70225 Bp58 Blood pressure QTL 58 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32356093 162846471 Rat 631512 Scl6 Serum cholesterol level QTL 6 9.6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 1 72197680 90508767 Rat 2298545 Neuinf8 Neuroinflammation QTL 8 4.6 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 1 57336763 151090257 Rat 2313072 Bss53 Bone structure and strength QTL 53 4.3 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 1 43284731 118944897 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 2313078 Bss54 Bone structure and strength QTL 54 3.5 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 2313077 Bss69 Bone structure and strength QTL 69 3.5 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 1 11481312 82174945 Rat 1549903 Bp267 Blood pressure QTL 267 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 77876254 106047988 Rat 2313402 Anxrr24 Anxiety related response QTL 24 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 1 48963584 144267916 Rat 61342 Bp27 Blood pressure QTL 27 3.4 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 56732668 98773277 Rat 1300172 Bp172 Blood pressure QTL 172 3.56 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 32737273 90665040 Rat 4889962 Bss94 Bone structure and strength QTL 94 3.8 tibia area (VT:1000281) tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722) 1 49361465 82174945 Rat 61344 Bp29 Blood pressure QTL 29 7.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 78350581 123350581 Rat 1358192 Ept13 Estrogen-induced pituitary tumorigenesis QTL 13 3.4 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 77494165 122494165 Rat 2313094 Bss58 Bone structure and strength QTL 58 3.7 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 1 43284731 118944897 Rat 6903308 Scl36 Serum cholesterol QTL 36 2 0.0125 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 53863041 90532583 Rat 2313092 Bmd72 Bone mineral density QTL 72 2.5 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 1 11481312 82174945 Rat 2300164 Bmd44 Bone mineral density QTL 44 5.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 1 56949932 101949932 Rat 2313099 Bss56 Bone structure and strength QTL 56 2.4 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 1 43284731 118944897 Rat 2313098 Bmd70 Bone mineral density QTL 70 3.6 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 1 43284731 118944897 Rat 2313097 Bss70 Bone structure and strength QTL 70 3.5 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 1 11481312 82174945 Rat 9589820 Insglur3 Insulin/glucose ratio QTL 3 10.75 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 1 34836858 79836858 Rat 152025249 Scl82 Serum cholesterol level QTL 82 4.77 blood cholesterol amount (VT:0000180) 1 50343510 99980958 Rat 10054135 Gmadr2 Adrenal mass QTL 2 1.97 0.0129 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 77857876 122857876 Rat 7411712 Strs4 Sensitivity to stroke QTL 4 8.7 cerebrum integrity trait (VT:0010549) percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932) 1 78430536 123430536 Rat 4889919 Bss86 Bone structure and strength QTL 86 4.1 tibia area (VT:1000281) tibia midshaft total cross-sectional area (CMO:0001715) 1 53895117 82174945 Rat 8552948 Pigfal11 Plasma insulin-like growth factor 1 level QTL 11 4.7 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 1 34836858 79836858 Rat 2313051 Bss57 Bone structure and strength QTL 57 3.7 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 1 43284731 118944897 Rat 61433 Cia2 Collagen induced arthritis QTL 2 5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 1 78430754 91209302 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
87
86
55
25
55
6
214
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000018233 ⟹ ENSRNOP00000018233
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 78,531,815 - 78,537,001 (+) Ensembl Rnor_6.0 Ensembl 1 79,790,705 - 79,796,111 (+) Ensembl
RefSeq Acc Id:
NM_053373 ⟹ NP_445825
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 87,659,863 - 87,665,048 (+) NCBI mRatBN7.2 1 78,531,815 - 78,537,001 (+) NCBI Rnor_6.0 1 79,790,879 - 79,796,064 (+) NCBI Rnor_5.0 1 81,052,612 - 81,057,412 (+) NCBI RGSC_v3.4 1 78,235,474 - 78,240,665 (+) RGD Celera 1 72,998,755 - 73,003,829 (+) RGD
Sequence:
CGTGTGCAGCACGTCCAGCATGTTGTTTGCCTGGGCTCCCTTCCCTGCCCTCCTGGGCCTGGCAGACTCCTGCTGTTTCGTCGTGCCCCGCAGTGAGTGGAAGGCCCTGCCATCCGAGTGCTCCAAGG
hide sequence
RefSeq Acc Id:
NP_445825 ⟸ NM_053373
- Peptide Label:
precursor
- UniProtKB:
Q9JLN4 (UniProtKB/Swiss-Prot), A6J8I2 (UniProtKB/TrEMBL), G3V7R2 (UniProtKB/TrEMBL)
- Sequence:
MLFAWAPFPALLGLADSCCFVVPRSEWKALPSECSKGLKKPVRYVVISHTAGSFCSSPDSCEQQARNVQLYQMKQLGWCDVAYNFLIGEDGHVYEGRGWTIKGDHTGPIWNPMSIGITFMGDYSHRVP
hide sequence
Ensembl Acc Id:
ENSRNOP00000018233 ⟸ ENSRNOT00000018233
RGD ID: 13689751 Promoter ID: EPDNEW_R275 Type: single initiation site Name: Pglyrp1_1 Description: peptidoglycan recognition protein 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 79,790,861 - 79,790,921 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2004-09-10
Pglyrp1
peptidoglycan recognition protein 1
Pglyrp
peptidoglycan recognition protein
Symbol and Name updated
1299863 APPROVED
2004-02-26
Pglyrp
peptidoglycan recognition protein
Symbol and Name status set to approved
625702 APPROVED
2002-08-07
Pglyrp
peptidoglycan recognition protein
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_function
binds to peptidoglycan (PG) or live bacteria
724610
gene_regulation
induced in brain by sleep deprivation
724610
