Advanced Search (OLGA)

Gene: Aldh1l1 (aldehyde dehydrogenase 1 family, member L1) Rattus norvegicus

Analyze

Symbol:

Aldh1l1

Name:

aldehyde dehydrogenase 1 family, member L1

RGD ID:

621294

Description:

Enables aldehyde dehydrogenase (NADP+) activity and formyltetrahydrofolate dehydrogenase activity. Involved in 10-formyltetrahydrofolate catabolic process; NADPH regeneration; and folic acid metabolic process. Located in cytosol. Part of protein-containing complex. Biomarker of cholestasis. Orthologous to human ALDH1L1 (aldehyde dehydrogenase 1 family member L1); PARTICIPATES IN altered folate cycle metabolic pathway; folate cycle metabolic pathway; folate metabolic pathway; INTERACTS WITH 1-naphthyl isothiocyanate; 17beta-estradiol; 2,2',4,4'-Tetrabromodiphenyl ether.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

10-formyltetrahydrofolate dehydrogenase; 10-FTHFDH; aldehyde dehydrogenase family 1 member L1; cytosolic 10-formyltetrahydrofolate dehydrogenase; FBP-CI; FDH; formyltetrahydrofolate dehydrogenase; Fthfd; MGC105431

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ALDH1L1 (aldehyde dehydrogenase 1 family member L1)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):	Aldh1l1 (aldehyde dehydrogenase 1 family, member L1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Aldh1l1 (aldehyde dehydrogenase 1 family member L1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ALDH1L1 (aldehyde dehydrogenase 1 family member L1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ALDH1L1 (aldehyde dehydrogenase 1 family member L1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Aldh1l1 (aldehyde dehydrogenase 1 family member L1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ALDH1L1 (aldehyde dehydrogenase 1 family member L1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ALDH1L1 (aldehyde dehydrogenase 1 family member L1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Aldh1l1 (aldehyde dehydrogenase 1 family member L1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	ALDH1L1 (aldehyde dehydrogenase 1 family member L1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Aldh1l1 (aldehyde dehydrogenase 1 family, member L1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	aldh1l1 (aldehyde dehydrogenase 1 family, member L1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	ALD2	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):	ALD3	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):	ALD4	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):	ALD5	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):	ALD6	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	CG8665	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	alh-3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	aldh1l1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	124,617,182 - 124,663,674 (+)	NCBI		GRCr8
mRatBN7.2	4	123,059,989 - 123,106,471 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	123,060,008 - 123,106,465 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	128,527,602 - 128,574,093 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	124,302,026 - 124,348,513 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	122,926,598 - 122,973,089 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	123,516,553 - 123,564,067 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	123,516,788 - 123,557,501 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	186,990,816 - 187,030,955 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Celera	4	111,983,791 - 112,029,897 (+)	NCBI		Celera
Cytogenetic Map	4	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

RGD Manual Disease Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Aldh1l1	Rat	cholestasis	treatment	IEP		15045612		RGD

Imported Disease Annotations - ClinVar

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Aldh1l1	Rat	alkaptonuria		ISO	RGD:1606025	8554872	ClinVar Annotator: match by term: Alkaptonuria	ClinVar	PMID:12501223\|PMID:19862842\|PMID:28492532
Aldh1l1	Rat	High Myopia		ISO	RGD:1606025	8554872	ClinVar Annotator: match by term: High myopia	ClinVar
Aldh1l1	Rat	Primary Lymphedema with Myelodysplasia		ISO	RGD:1606025	8554872	ClinVar Annotator: match by term: Emberger syndrome \| ClinVar Annotator: match by term: Lymphedema, primary, more ...	ClinVar	PMID:19449416\|PMID:22147895\|PMID:25741868\|PMID:26710799

Imported Disease Annotations - CTD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Aldh1l1	Rat	autism spectrum disorder		ISO	RGD:1606025	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:35663546
Aldh1l1	Rat	Experimental Liver Cirrhosis		ISO	RGD:1606025	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:15650968
Aldh1l1	Rat	Hypoxia		ISO	RGD:1606025	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:19579223
Aldh1l1	Rat	obesity		ISO	RGD:1606025	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:20882379

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Aldh1l1	Rat	1,1-dichloroethene	decreases expression	ISO	RGD:1614993	6480464	vinylidene chloride results in decreased expression of ALDH1L1 mRNA	CTD	PMID:26682919
Aldh1l1	Rat	1-naphthyl isothiocyanate	decreases expression	EXP		15045612	1-naphthyl isothiocyanate decreases expression of ALDH1L1 mRNA in rat liver	RGD
Aldh1l1	Rat	17alpha-ethynylestradiol	multiple interactions	ISO	RGD:1614993	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of ALDH1L1 mRNA	CTD	PMID:17942748
Aldh1l1	Rat	17beta-estradiol	multiple interactions	ISO	RGD:1606025	6480464	[Estradiol co-treated with TGFB1 protein] results in decreased expression of ALDH1L1 mRNA	CTD	PMID:30165855
Aldh1l1	Rat	17beta-estradiol	decreases expression	ISO	RGD:1614993	6480464	Estradiol results in decreased expression of ALDH1L1 mRNA	CTD	PMID:39298647
Aldh1l1	Rat	17beta-estradiol	decreases expression	EXP		6480464	Estradiol results in decreased expression of ALDH1L1 mRNA	CTD	PMID:32145629
Aldh1l1	Rat	2,2',4,4'-Tetrabromodiphenyl ether	increases expression	EXP		6480464	2,2',4,4'-tetrabromodiphenyl ether results in increased expression of ALDH1L1 mRNA	CTD	PMID:31826744
Aldh1l1	Rat	2,3,7,8-tetrabromodibenzodioxine	increases expression	ISO	RGD:1614993	6480464	2,3,7,8-tetrabromodibenzo-4-dioxin results in increased expression of ALDH1L1 protein	CTD	PMID:27604104
Aldh1l1	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	RGD:1614993	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of ALDH1L1 mRNA	CTD	PMID:17942748
Aldh1l1	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of ALDH1L1 mRNA	CTD	PMID:33387578
Aldh1l1	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of ALDH1L1 mRNA	CTD	PMID:32109520
Aldh1l1	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	RGD:1614993	6480464	Tetrachlorodibenzodioxin results in increased expression of ALDH1L1 mRNA	CTD	PMID:19770486
Aldh1l1	Rat	2,3,7,8-Tetrachlorodibenzofuran	decreases expression	EXP		6480464	2,3,7,8-tetrachlorodibenzofuran results in decreased expression of ALDH1L1 mRNA	CTD	PMID:32109520
Aldh1l1	Rat	2,4,6-trinitrotoluene	affects expression	EXP		6480464	Trinitrotoluene affects the expression of ALDH1L1 mRNA	CTD	PMID:21346803
Aldh1l1	Rat	2,4-dibromophenyl 2,4,5-tribromophenyl ether	affects expression	ISO	RGD:1614993	6480464	2,2',4,4',5-brominated diphenyl ether affects the expression of ALDH1L1 mRNA	CTD	PMID:38648751
Aldh1l1	Rat	2,4-dinitrotoluene	affects expression	EXP		6480464	2,4-dinitrotoluene affects the expression of ALDH1L1 mRNA	CTD	PMID:21346803
Aldh1l1	Rat	2,6-dinitrotoluene	affects expression	EXP		6480464	2,6-dinitrotoluene affects the expression of ALDH1L1 mRNA	CTD	PMID:21346803
Aldh1l1	Rat	3,4-methylenedioxymethamphetamine	increases expression	ISO	RGD:1614993	6480464	N-Methyl-3,4-methylenedioxyamphetamine results in increased expression of ALDH1L1 mRNA	CTD	PMID:20188158
Aldh1l1	Rat	3-isobutyl-1-methyl-7H-xanthine	multiple interactions	ISO	RGD:1606025	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in increased expression more ...	CTD	PMID:28628672
Aldh1l1	Rat	3H-1,2-dithiole-3-thione	increases expression	EXP		6480464	1,2-dithiol-3-thione results in increased expression of ALDH1L1 mRNA	CTD	PMID:19162173
Aldh1l1	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	RGD:1606025	6480464	bisphenol S results in increased expression of ALDH1L1 mRNA; bisphenol S results in increased expression more ...	CTD	PMID:27685785\|PMID:34186270
Aldh1l1	Rat	4,4'-sulfonyldiphenol	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of more ...	CTD	PMID:36041667
Aldh1l1	Rat	4,4'-sulfonyldiphenol	affects expression	ISO	RGD:1614993	6480464	bisphenol S affects the expression of ALDH1L1 mRNA	CTD	PMID:39298647
Aldh1l1	Rat	4,4'-sulfonyldiphenol	decreases expression	ISO	RGD:1614993	6480464	bisphenol S results in decreased expression of ALDH1L1 mRNA	CTD	PMID:30951980
Aldh1l1	Rat	4-amino-2,6-dinitrotoluene	affects expression	EXP		6480464	4-amino-2,6-dinitrotoluene affects the expression of ALDH1L1 mRNA	CTD	PMID:21346803
Aldh1l1	Rat	4-hydroxyphenyl retinamide	decreases expression	ISO	RGD:1614993	6480464	Fenretinide results in decreased expression of ALDH1L1 mRNA	CTD	PMID:28973697
Aldh1l1	Rat	5-methyltetrahydrofolic acid	decreases abundance	ISO	RGD:1606025	6480464	ALDH1L1 protein results in decreased abundance of 5-methyltetrahydrofolate	CTD	PMID:16627483
Aldh1l1	Rat	6-propyl-2-thiouracil	decreases expression	EXP		6480464	Propylthiouracil results in decreased expression of ALDH1L1 mRNA	CTD	PMID:36843608
Aldh1l1	Rat	acetamide	decreases expression	EXP		6480464	acetamide results in decreased expression of ALDH1L1 mRNA	CTD	PMID:31881176
Aldh1l1	Rat	acrolein	multiple interactions	ISO	RGD:1606025	6480464	[Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of more ...	CTD	PMID:32699268
Aldh1l1	Rat	acrylamide	increases expression	ISO	RGD:1606025	6480464	Acrylamide results in increased expression of ALDH1L1 mRNA	CTD	PMID:32763439
Aldh1l1	Rat	actinomycin D	multiple interactions	ISO	RGD:1606025	6480464	[Dactinomycin co-treated with nutlin 3] results in increased expression of ALDH1L1 mRNA	CTD	PMID:38460933
Aldh1l1	Rat	aflatoxin B1	affects expression	ISO	RGD:1606025	6480464	Aflatoxin B1 affects the expression of ALDH1L1 protein	CTD	PMID:20106945
Aldh1l1	Rat	aflatoxin B1	decreases expression	ISO	RGD:1606025	6480464	Aflatoxin B1 results in decreased expression of ALDH1L1 mRNA	CTD	PMID:27153756
Aldh1l1	Rat	aflatoxin B1	decreases methylation	ISO	RGD:1606025	6480464	Aflatoxin B1 results in decreased methylation of ALDH1L1 gene; Aflatoxin B1 results in decreased methylation more ...	CTD	PMID:27153756\|PMID:30157460
Aldh1l1	Rat	aflatoxin B1	decreases expression	ISO	RGD:1614993	6480464	Aflatoxin B1 results in decreased expression of ALDH1L1 mRNA	CTD	PMID:19770486
Aldh1l1	Rat	alpha-pinene	multiple interactions	ISO	RGD:1606025	6480464	[Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of more ...	CTD	PMID:32699268
Aldh1l1	Rat	atrazine	affects methylation	EXP		6480464	Atrazine affects the methylation of ALDH1L1 gene	CTD	PMID:28931070
Aldh1l1	Rat	azathioprine	increases expression	ISO	RGD:1606025	6480464	Azathioprine results in increased expression of ALDH1L1 mRNA	CTD	PMID:22623647
Aldh1l1	Rat	benzo[a]pyrene	increases expression	ISO	RGD:1614993	6480464	Benzo(a)pyrene results in increased expression of ALDH1L1 mRNA	CTD	PMID:19770486
Aldh1l1	Rat	benzo[a]pyrene	decreases expression	ISO	RGD:1606025	6480464	Benzo(a)pyrene results in decreased expression of ALDH1L1 mRNA; Benzo(a)pyrene results in decreased expression of ALDH1L1 more ...	CTD	PMID:32234424\|PMID:32717239
Aldh1l1	Rat	benzo[a]pyrene	increases methylation	ISO	RGD:1614993	6480464	Benzo(a)pyrene results in increased methylation of ALDH1L1 exon; Benzo(a)pyrene results in increased methylation of ALDH1L1 more ...	CTD	PMID:27901495
Aldh1l1	Rat	benzo[a]pyrene	decreases methylation	ISO	RGD:1606025	6480464	Benzo(a)pyrene results in decreased methylation of ALDH1L1 5' UTR; Benzo(a)pyrene results in decreased methylation of more ...	CTD	PMID:27901495
Aldh1l1	Rat	benzo[a]pyrene	increases expression	ISO	RGD:1606025	6480464	Benzo(a)pyrene results in increased expression of ALDH1L1 mRNA; Benzo(a)pyrene results in increased expression of ALDH1L1 more ...	CTD	PMID:21632981\|PMID:33278487
Aldh1l1	Rat	benzo[e]pyrene	decreases methylation	ISO	RGD:1606025	6480464	benzo(e)pyrene results in decreased methylation of ALDH1L1 intron	CTD	PMID:30157460
Aldh1l1	Rat	bis(2-ethylhexyl) phthalate	increases expression	ISO	RGD:1614993	6480464	Diethylhexyl Phthalate results in increased expression of ALDH1L1 mRNA; Diethylhexyl Phthalate results in increased expression more ...	CTD	PMID:36356568
Aldh1l1	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of ALDH1L1 mRNA	CTD	PMID:25181051
Aldh1l1	Rat	bisphenol A	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of more ...	CTD	PMID:36041667
Aldh1l1	Rat	bisphenol A	decreases expression	ISO	RGD:1606025	6480464	bisphenol A results in decreased expression of ALDH1L1 protein	CTD	PMID:34186270
Aldh1l1	Rat	bisphenol A	increases expression	ISO	RGD:1614993	6480464	bisphenol A results in increased expression of ALDH1L1 mRNA	CTD	PMID:33221593
Aldh1l1	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of ALDH1L1 mRNA	CTD	PMID:32145629
Aldh1l1	Rat	bisphenol A	affects expression	ISO	RGD:1606025	6480464	bisphenol A affects the expression of ALDH1L1 mRNA	CTD	PMID:30903817
Aldh1l1	Rat	bisphenol AF	increases expression	ISO	RGD:1606025	6480464	bisphenol AF results in increased expression of ALDH1L1 protein	CTD	PMID:34186270
Aldh1l1	Rat	Bisphenol B	increases expression	ISO	RGD:1606025	6480464	bisphenol B results in increased expression of ALDH1L1 protein	CTD	PMID:34186270
Aldh1l1	Rat	bisphenol F	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of more ...	CTD	PMID:36041667
Aldh1l1	Rat	bisphenol F	increases expression	ISO	RGD:1606025	6480464	bisphenol F results in increased expression of ALDH1L1 protein	CTD	PMID:34186270
Aldh1l1	Rat	Brodifacoum	increases expression	EXP		6480464	bromfenacoum results in increased expression of ALDH1L1 protein	CTD	PMID:28903499
Aldh1l1	Rat	cadmium dichloride	decreases expression	EXP		6480464	Cadmium Chloride results in decreased expression of ALDH1L1 mRNA	CTD	PMID:25993096
Aldh1l1	Rat	camptothecin	increases expression	ISO	RGD:1606025	6480464	Camptothecin results in increased expression of ALDH1L1 mRNA	CTD	PMID:38460933
Aldh1l1	Rat	carbon nanotube	decreases expression	ISO	RGD:1614993	6480464	Nanotubes, Carbon results in decreased expression of ALDH1L1 mRNA	CTD	PMID:25620056
Aldh1l1	Rat	CGP 52608	multiple interactions	ISO	RGD:1606025	6480464	CGP 52608 promotes the reaction [RORA protein binds to ALDH1L1 gene]	CTD	PMID:28238834
Aldh1l1	Rat	chromium(6+)	affects expression	ISO	RGD:1614993	6480464	chromium hexavalent ion affects the expression of ALDH1L1 mRNA	CTD	PMID:28472532
Aldh1l1	Rat	clofibrate	decreases expression	EXP		6480464	Clofibrate results in decreased expression of ALDH1L1 mRNA; Clofibrate results in decreased expression of ALDH1L1 more ...	CTD	PMID:12851107\|PMID:16470657
Aldh1l1	Rat	clofibric acid	affects expression	EXP		6480464	Clofibric Acid affects the expression of ALDH1L1 mRNA	CTD	PMID:17602206
Aldh1l1	Rat	cobalt dichloride	increases expression	EXP		6480464	cobaltous chloride results in increased expression of ALDH1L1 mRNA	CTD	PMID:24386269
Aldh1l1	Rat	copper(II) chloride	increases expression	ISO	RGD:1614993	6480464	cupric chloride results in increased expression of ALDH1L1 mRNA	CTD	PMID:17211630
Aldh1l1	Rat	copper(II) sulfate	decreases expression	ISO	RGD:1606025	6480464	Copper Sulfate results in decreased expression of ALDH1L1 mRNA	CTD	PMID:19549813
Aldh1l1	Rat	cyclosporin A	decreases expression	ISO	RGD:1606025	6480464	Cyclosporine results in decreased expression of ALDH1L1 mRNA	CTD	PMID:20106945\|PMID:25562108
Aldh1l1	Rat	dexamethasone	increases expression	ISO	RGD:1606025	6480464	Dexamethasone results in increased expression of ALDH1L1 mRNA	CTD	PMID:25047013
Aldh1l1	Rat	dexamethasone	multiple interactions	ISO	RGD:1606025	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in increased expression more ...	CTD	PMID:28628672
Aldh1l1	Rat	dibutyl phthalate	decreases expression	EXP		6480464	Dibutyl Phthalate results in decreased expression of ALDH1L1 mRNA	CTD	PMID:21266533\|PMID:21745491
Aldh1l1	Rat	diiodine	multiple interactions	EXP		6480464	[Iodine deficiency co-treated with sodium perchlorate] results in decreased expression of ALDH1L1 protein	CTD	PMID:30090431
Aldh1l1	Rat	diquat	increases expression	ISO	RGD:1614993	6480464	Diquat results in increased expression of ALDH1L1 mRNA	CTD	PMID:36851058
Aldh1l1	Rat	elemental selenium	affects expression	EXP		6480464	Selenium affects the expression of ALDH1L1 protein	CTD	PMID:19351701
Aldh1l1	Rat	endosulfan	increases expression	EXP		6480464	Endosulfan results in increased expression of ALDH1L1 mRNA	CTD	PMID:29391264
Aldh1l1	Rat	ethanol	decreases activity	EXP		6480464	Ethanol results in decreased activity of ALDH1L1 protein	CTD	PMID:16385189
Aldh1l1	Rat	ethanol	increases expression	ISO	RGD:1614993	6480464	Ethanol results in increased expression of ALDH1L1 mRNA	CTD	PMID:30319688
Aldh1l1	Rat	ethanol	multiple interactions	EXP		6480464	Folic Acid affects the reaction [Ethanol results in decreased activity of ALDH1L1 protein]	CTD	PMID:16385189
Aldh1l1	Rat	ethanol	decreases expression	EXP		6480464	Ethanol results in decreased expression of ALDH1L1 mRNA	CTD	PMID:17920746
Aldh1l1	Rat	flutamide	increases expression	EXP		6480464	Flutamide results in increased expression of ALDH1L1 mRNA	CTD	PMID:24136188
Aldh1l1	Rat	folic acid	increases degradation	ISO	RGD:1606025	6480464	ALDH1L1 protein results in increased degradation of Folic Acid	CTD	PMID:16627483
Aldh1l1	Rat	folic acid	affects activity	EXP		6480464	Folic Acid affects the activity of ALDH1L1 protein	CTD	PMID:16385189
Aldh1l1	Rat	folic acid	multiple interactions	EXP		6480464	Folic Acid affects the reaction [Ethanol results in decreased activity of ALDH1L1 protein]	CTD	PMID:16385189
Aldh1l1	Rat	glafenine	decreases expression	EXP		6480464	Glafenine results in decreased expression of ALDH1L1 mRNA	CTD	PMID:24136188
Aldh1l1	Rat	hydrazine	decreases expression	EXP		6480464	hydrazine results in decreased expression of ALDH1L1 protein	CTD	PMID:15370871
Aldh1l1	Rat	indometacin	multiple interactions	ISO	RGD:1606025	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in increased expression more ...	CTD	PMID:28628672
Aldh1l1	Rat	iodide salt	increases expression	EXP		6480464	Iodides deficiency results in increased expression of ALDH1L1 protein	CTD	PMID:26795019
Aldh1l1	Rat	leflunomide	decreases expression	ISO	RGD:1606025	6480464	leflunomide results in decreased expression of ALDH1L1 mRNA	CTD	PMID:28988120
Aldh1l1	Rat	lipopolysaccharide	multiple interactions	ISO	RGD:1606025	6480464	[S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of ALDH1L1 mRNA; [S-(1,2-dichlorovinyl)cysteine more ...	CTD	PMID:35811015
Aldh1l1	Rat	methapyrilene	decreases methylation	ISO	RGD:1606025	6480464	Methapyrilene results in decreased methylation of ALDH1L1 intron	CTD	PMID:30157460
Aldh1l1	Rat	microcystin-LR	increases phosphorylation	ISO	RGD:1614993	6480464	cyanoginosin LR results in increased phosphorylation of ALDH1L1 protein	CTD	PMID:18000846
Aldh1l1	Rat	N-nitrosomorpholine	affects expression	EXP		6480464	N-nitrosomorpholine affects the expression of ALDH1L1 protein	CTD	PMID:19716841
Aldh1l1	Rat	nefazodone	increases expression	EXP		6480464	nefazodone results in increased expression of ALDH1L1 mRNA	CTD	PMID:24136188
Aldh1l1	Rat	nickel atom	decreases expression	ISO	RGD:1606025	6480464	Nickel results in decreased expression of ALDH1L1 mRNA	CTD	PMID:24768652\|PMID:25583101
Aldh1l1	Rat	Nutlin-3	multiple interactions	ISO	RGD:1606025	6480464	[Dactinomycin co-treated with nutlin 3] results in increased expression of ALDH1L1 mRNA	CTD	PMID:38460933
Aldh1l1	Rat	okadaic acid	increases phosphorylation	ISO	RGD:1614993	6480464	Okadaic Acid results in increased phosphorylation of ALDH1L1 protein	CTD	PMID:18000846
Aldh1l1	Rat	okadaic acid	decreases expression	ISO	RGD:1606025	6480464	Okadaic Acid results in decreased expression of ALDH1L1 mRNA; Okadaic Acid results in decreased expression more ...	CTD	PMID:38832940
Aldh1l1	Rat	oxaliplatin	multiple interactions	EXP		6480464	[oxaliplatin co-treated with Topotecan] results in decreased expression of ALDH1L1 mRNA	CTD	PMID:25729387
Aldh1l1	Rat	ozone	multiple interactions	ISO	RGD:1606025	6480464	[Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of more ...	CTD	PMID:32699268
Aldh1l1	Rat	p-toluidine	increases expression	EXP		6480464	4-toluidine results in increased expression of ALDH1L1 mRNA	CTD	PMID:27638505
Aldh1l1	Rat	paracetamol	affects expression	ISO	RGD:1614993	6480464	Acetaminophen affects the expression of ALDH1L1 mRNA	CTD	PMID:17562736
Aldh1l1	Rat	paracetamol	decreases expression	ISO	RGD:1606025	6480464	Acetaminophen results in decreased expression of ALDH1L1 mRNA	CTD	PMID:29067470
Aldh1l1	Rat	paracetamol	multiple interactions	ISO	RGD:1614993	6480464	[CTH gene mutant form results in increased susceptibility to Acetaminophen] which results in decreased expression more ...	CTD	PMID:25499718
Aldh1l1	Rat	perfluorooctane-1-sulfonic acid	increases expression	EXP		6480464	perfluorooctane sulfonic acid results in increased expression of ALDH1L1 mRNA	CTD	PMID:19162173
Aldh1l1	Rat	perfluorooctane-1-sulfonic acid	decreases expression	ISO	RGD:1614993	6480464	perfluorooctane sulfonic acid results in decreased expression of ALDH1L1 mRNA	CTD	PMID:20936131
Aldh1l1	Rat	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	RGD:1614993	6480464	PPARA protein promotes the reaction [perfluorooctane sulfonic acid results in decreased expression of ALDH1L1 mRNA]	CTD	PMID:20936131
Aldh1l1	Rat	perfluorooctane-1-sulfonic acid	affects expression	ISO	RGD:1614993	6480464	perfluorooctane sulfonic acid affects the expression of ALDH1L1 mRNA	CTD	PMID:19429403
Aldh1l1	Rat	perfluorooctanoic acid	affects expression	ISO	RGD:1614993	6480464	perfluorooctanoic acid affects the expression of ALDH1L1 mRNA	CTD	PMID:19429403
Aldh1l1	Rat	perfluorooctanoic acid	decreases expression	EXP		6480464	perfluorooctanoic acid results in decreased expression of ALDH1L1 mRNA; perfluorooctanoic acid results in decreased expression more ...	CTD	PMID:19162173\|PMID:34958885
Aldh1l1	Rat	perfluorooctanoic acid	multiple interactions	ISO	RGD:1614993	6480464	PPARA protein promotes the reaction [perfluorooctanoic acid results in decreased expression of ALDH1L1 mRNA]	CTD	PMID:18467677
Aldh1l1	Rat	perfluorooctanoic acid	decreases expression	ISO	RGD:1614993	6480464	perfluorooctanoic acid results in decreased expression of ALDH1L1 mRNA	CTD	PMID:18467677
Aldh1l1	Rat	phenobarbital	increases expression	EXP		6480464	Phenobarbital results in increased expression of ALDH1L1 mRNA	CTD	PMID:19162173
Aldh1l1	Rat	phenobarbital	decreases expression	ISO	RGD:1614993	6480464	Phenobarbital results in decreased expression of ALDH1L1 protein	CTD	PMID:35881160
Aldh1l1	Rat	phenobarbital	decreases expression	ISO	RGD:1606025	6480464	Phenobarbital results in decreased expression of ALDH1L1 protein	CTD	PMID:35881160
Aldh1l1	Rat	pirinixic acid	decreases expression	ISO	RGD:1614993	6480464	pirinixic acid results in decreased expression of ALDH1L1 mRNA	CTD	PMID:17426115
Aldh1l1	Rat	pirinixic acid	decreases expression	EXP		6480464	pirinixic acid results in decreased expression of ALDH1L1 mRNA	CTD	PMID:19162173
Aldh1l1	Rat	pregnenolone 16alpha-carbonitrile	increases expression	EXP		6480464	Pregnenolone Carbonitrile results in increased expression of ALDH1L1 mRNA	CTD	PMID:19162173
Aldh1l1	Rat	pregnenolone 16alpha-carbonitrile	decreases expression	ISO	RGD:1614993	6480464	Pregnenolone Carbonitrile results in decreased expression of ALDH1L1 mRNA	CTD	PMID:27413110
Aldh1l1	Rat	progesterone	increases expression	EXP		6480464	Progesterone results in increased expression of ALDH1L1 mRNA	CTD	PMID:20726854
Aldh1l1	Rat	propanal	decreases expression	ISO	RGD:1606025	6480464	propionaldehyde results in decreased expression of ALDH1L1 mRNA	CTD	PMID:26079696
Aldh1l1	Rat	pyrazinecarboxamide	increases expression	EXP		6480464	Pyrazinamide results in increased expression of ALDH1L1 mRNA	CTD	PMID:22431067
Aldh1l1	Rat	quinolin-8-ol	increases expression	ISO	RGD:1606025	6480464	Oxyquinoline results in increased expression of ALDH1L1 mRNA	CTD	PMID:21632981
Aldh1l1	Rat	rotenone	decreases expression	EXP		6480464	Rotenone results in decreased expression of ALDH1L1 mRNA	CTD	PMID:28374803
Aldh1l1	Rat	S-(1,2-dichlorovinyl)-L-cysteine	multiple interactions	ISO	RGD:1606025	6480464	[S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of ALDH1L1 mRNA; [S-(1,2-dichlorovinyl)cysteine more ...	CTD	PMID:35811015
Aldh1l1	Rat	S-(1,2-dichlorovinyl)-L-cysteine	increases expression	ISO	RGD:1606025	6480464	S-(1,2-dichlorovinyl)cysteine results in increased expression of ALDH1L1 mRNA	CTD	PMID:35811015
Aldh1l1	Rat	selenium atom	affects expression	EXP		6480464	Selenium affects the expression of ALDH1L1 protein	CTD	PMID:19351701
Aldh1l1	Rat	silicon dioxide	decreases expression	ISO	RGD:1606025	6480464	Silicon Dioxide analog results in decreased expression of ALDH1L1 mRNA	CTD	PMID:25895662
Aldh1l1	Rat	sodium arsenite	increases expression	ISO	RGD:1606025	6480464	sodium arsenite results in increased expression of ALDH1L1 mRNA	CTD	PMID:21457566
Aldh1l1	Rat	sodium dichromate	decreases expression	EXP		6480464	sodium bichromate results in decreased expression of ALDH1L1 mRNA	CTD	PMID:25993096
Aldh1l1	Rat	sodium perchlorate	multiple interactions	EXP		6480464	[Iodine deficiency co-treated with sodium perchlorate] results in decreased expression of ALDH1L1 protein	CTD	PMID:30090431
Aldh1l1	Rat	succimer	multiple interactions	ISO	RGD:1614993	6480464	[Succimer binds to Magnetite Nanoparticles] which results in increased expression of ALDH1L1 mRNA	CTD	PMID:21641980
Aldh1l1	Rat	sulindac	multiple interactions	EXP		6480464	[Sulindac co-treated with lipopolysaccharide, E coli O55-B5] affects the expression of ALDH1L1 mRNA	CTD	PMID:20371263
Aldh1l1	Rat	tetrachloromethane	affects expression	ISO	RGD:1614993	6480464	Carbon Tetrachloride affects the expression of ALDH1L1 mRNA; Carbon Tetrachloride affects the expression of ALDH1L1 more ...	CTD	PMID:17109383
Aldh1l1	Rat	tetrachloromethane	decreases expression	EXP		6480464	Carbon Tetrachloride results in decreased expression of ALDH1L1 mRNA	CTD	PMID:31150632
Aldh1l1	Rat	tetrachloromethane	decreases expression	ISO	RGD:1614993	6480464	Carbon Tetrachloride results in decreased expression of ALDH1L1 mRNA; Carbon Tetrachloride results in decreased expression more ...	CTD	PMID:15650968\|PMID:27339419\|PMID:31919559
Aldh1l1	Rat	tetraphene	decreases expression	ISO	RGD:1614993	6480464	benz(a)anthracene results in decreased expression of ALDH1L1 mRNA	CTD	PMID:26377693
Aldh1l1	Rat	thioacetamide	decreases expression	EXP		6480464	Thioacetamide results in decreased expression of ALDH1L1 mRNA	CTD	PMID:23411599\|PMID:34492290
Aldh1l1	Rat	titanium dioxide	decreases expression	ISO	RGD:1614993	6480464	titanium dioxide results in decreased expression of ALDH1L1 mRNA	CTD	PMID:23557971
Aldh1l1	Rat	tolcapone	increases expression	EXP		6480464	tolcapone results in increased expression of ALDH1L1 mRNA	CTD	PMID:24136188
Aldh1l1	Rat	topotecan	multiple interactions	EXP		6480464	[oxaliplatin co-treated with Topotecan] results in decreased expression of ALDH1L1 mRNA	CTD	PMID:25729387
Aldh1l1	Rat	topotecan	decreases expression	EXP		6480464	Topotecan results in decreased expression of ALDH1L1 mRNA	CTD	PMID:25729387
Aldh1l1	Rat	trichloroethene	increases expression	ISO	RGD:1614993	6480464	Trichloroethylene results in increased expression of ALDH1L1 mRNA	CTD	PMID:19254012
Aldh1l1	Rat	trichloroethene	increases expression	EXP		6480464	Trichloroethylene results in increased expression of ALDH1L1 mRNA	CTD	PMID:33387578
Aldh1l1	Rat	Triptolide	decreases expression	ISO	RGD:1614993	6480464	triptolide results in decreased expression of ALDH1L1 mRNA	CTD	PMID:32835833
Aldh1l1	Rat	troglitazone	increases expression	ISO	RGD:1614993	6480464	troglitazone results in increased expression of ALDH1L1 mRNA	CTD	PMID:28973697
Aldh1l1	Rat	valproic acid	decreases expression	ISO	RGD:1606025	6480464	Valproic Acid results in decreased expression of ALDH1L1 mRNA	CTD	PMID:29154799
Aldh1l1	Rat	valproic acid	increases methylation	ISO	RGD:1606025	6480464	Valproic Acid results in increased methylation of ALDH1L1 gene	CTD	PMID:29154799

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Aldh1l1	Rat	10-formyltetrahydrofolate catabolic process	involved_in	IEA	ARBA:ARBA00033803	1600115	GO_REF:0000117	UniProt	GO_REF:0000117
Aldh1l1	Rat	10-formyltetrahydrofolate catabolic process	involved_in	IEA	UniProtKB:O75891\|ensembl:ENSP00000377083	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Aldh1l1	Rat	10-formyltetrahydrofolate catabolic process	involved_in	IEA	UniProtKB:Q8R0Y6\|ensembl:ENSMUSP00000114304	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Aldh1l1	Rat	10-formyltetrahydrofolate catabolic process	involved_in	IEA	InterPro:IPR011407	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Aldh1l1	Rat	10-formyltetrahydrofolate catabolic process	involved_in	ISO	RGD:1614993	1624291	PMID:31624291	RGD	PMID:31624291
Aldh1l1	Rat	10-formyltetrahydrofolate catabolic process	involved_in	IEA	UniRule:UR000128455	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Aldh1l1	Rat	10-formyltetrahydrofolate catabolic process	involved_in	IMP		150521656	PMID:10585460	UniProt
Aldh1l1	Rat	10-formyltetrahydrofolate catabolic process	involved_in	ISO	RGD:1606025	1624291	PMID:19933275	RGD	PMID:19933275
Aldh1l1	Rat	10-formyltetrahydrofolate catabolic process	involved_in	IDA		632027	PMID:1848231	UniProt
Aldh1l1	Rat	folic acid metabolic process	involved_in	IDA		632027	PMID:1848231	UniProt
Aldh1l1	Rat	NADPH regeneration	involved_in	IEA	UniProtKB:O75891\|ensembl:ENSP00000377083	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Aldh1l1	Rat	NADPH regeneration	involved_in	IDA		632027	PMID:1848231	UniProt
Aldh1l1	Rat	NADPH regeneration	involved_in	ISO	RGD:1606025	1624291	PMID:19933275	RGD	PMID:19933275
Aldh1l1	Rat	one-carbon metabolic process	involved_in	IEA	UniProtKB-KW:KW-0554	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Aldh1l1	Rat	one-carbon metabolic process	involved_in	IEA	InterPro:IPR011407	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Aldh1l1	Rat	tetrahydrofolate biosynthetic process		TAS		1547843		RGD
Aldh1l1	Rat	tetrahydrofolate interconversion	involved_in	IEA	UniProtKB:Q8R0Y6\|ensembl:ENSMUSP00000114304	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Aldh1l1	Rat	tetrahydrofolate interconversion	involved_in	ISO	RGD:1614993	1624291	PMID:7972060	RGD	PMID:7972060

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Aldh1l1	Rat	cytoplasm	located_in	IEA	UniProtKB-KW:KW-0963	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Aldh1l1	Rat	cytoplasm	located_in	IEA	InterPro:IPR011407	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Aldh1l1	Rat	cytosol	located_in	ISO	RGD:1606025\|UniProtKB:O75891-1\|UniProtKB:O75891-2\|UniProtKB:O75891-3\|UniProtKB:O75891-4	1624291		RGD	GO_REF:0000052
Aldh1l1	Rat	cytosol	located_in	IEA	UniProtKB:O75891\|ensembl:ENSP00000377083	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Aldh1l1	Rat	cytosol	located_in	IDA		632027	PMID:1848231	UniProt
Aldh1l1	Rat	cytosol	is_active_in	IEA	UniProtKB:Q8R0Y6\|ensembl:ENSMUSP00000114304	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Aldh1l1	Rat	cytosol	is_active_in	ISO	RGD:1614993	1624291	PMID:31624291, PMID:7972060	RGD	PMID:31624291\|PMID:7972060
Aldh1l1	Rat	cytosol	located_in	IEA	UniProtKB-SubCell:SL-0091	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Aldh1l1	Rat	mitochondrion	located_in	ISO	RGD:1606025	9068941	PMID:34800366	FlyBase	PMID:34800366
Aldh1l1	Rat	protein-containing complex		IDA		2303511		RGD

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Aldh1l1	Rat	aldehyde dehydrogenase (NAD+) activity	enables	ISO	RGD:1614993	1624291	PMID:7972060	RGD	PMID:7972060
Aldh1l1	Rat	aldehyde dehydrogenase (NAD+) activity	enables	IEA	UniProtKB:Q8R0Y6\|ensembl:ENSMUSP00000114304	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Aldh1l1	Rat	aldehyde dehydrogenase (NAD+) activity	enables	IBA	FB:FBgn0012036\|MGI:1353450\|MGI:1861722\|PANTHER:PTN000192421\|RGD:2087\|RGD:620252\|RGD:68409\|RGD:69219\|SGD:S000000875\|SGD:S000005901\|UniProtKB:P00352\|UniProtKB:P05091\|UniProtKB:P08157\|UniProtKB:P17445\|UniProtKB:P48644\|UniProtKB:P49189\|UniProtKB:Q43274\|UniProtKB:Q4WCK7	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Aldh1l1	Rat	aldehyde dehydrogenase (NADP+) activity	enables	IDA		8553346	PMID:17302434	UniProt
Aldh1l1	Rat	aldehyde dehydrogenase [NAD(P)+] activity		IDA		632027		RGD
Aldh1l1	Rat	catalytic activity	enables	IEA	InterPro:IPR011034	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Aldh1l1	Rat	formyltetrahydrofolate dehydrogenase activity		TAS		1547843		RGD
Aldh1l1	Rat	formyltetrahydrofolate dehydrogenase activity	enables	IEA	UniProtKB:Q8R0Y6\|ensembl:ENSMUSP00000114304	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Aldh1l1	Rat	formyltetrahydrofolate dehydrogenase activity	enables	IEA	UniProtKB:O75891\|ensembl:ENSP00000377083	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Aldh1l1	Rat	formyltetrahydrofolate dehydrogenase activity	enables	IBA	MGI:1340024\|MGI:2444680\|PANTHER:PTN000916306\|RGD:621294\|UniProtKB:O75891\|UniProtKB:Q3SY69\|ZFIN:ZDB-GENE-100519-4	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Aldh1l1	Rat	formyltetrahydrofolate dehydrogenase activity	enables	IEA	UniRule:UR000128455	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Aldh1l1	Rat	formyltetrahydrofolate dehydrogenase activity	enables	ISO	RGD:1614993	1624291	PMID:31624291, PMID:7972060	RGD	PMID:31624291\|PMID:7972060
Aldh1l1	Rat	formyltetrahydrofolate dehydrogenase activity	enables	IDA		632027	PMID:1848231	UniProt
Aldh1l1	Rat	formyltetrahydrofolate dehydrogenase activity	enables	IEA	InterPro:IPR011407	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Aldh1l1	Rat	formyltetrahydrofolate dehydrogenase activity	enables	ISO	RGD:1606025	1624291	PMID:19933275	RGD	PMID:19933275
Aldh1l1	Rat	formyltetrahydrofolate dehydrogenase activity	enables	IMP		150521656	PMID:10585460	UniProt
Aldh1l1	Rat	formyltetrahydrofolate dehydrogenase activity	enables	IEA	EC:1.5.1.6	1600115	GO_REF:0000003	UniProt	GO_REF:0000003
Aldh1l1	Rat	formyltetrahydrofolate dehydrogenase activity	enables	IEA	RHEA:10180	1600115	GO_REF:0000116	RHEA	GO_REF:0000116
Aldh1l1	Rat	formyltetrahydrofolate dehydrogenase activity	enables	IEA	ARBA:ARBA00033854	1600115	GO_REF:0000117	UniProt	GO_REF:0000117
Aldh1l1	Rat	oxidoreductase activity	enables	IEA	InterPro:IPR015590\|InterPro:IPR016160\|InterPro:IPR016161\|InterPro:IPR016162\|InterPro:IPR029510	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Aldh1l1	Rat	oxidoreductase activity	enables	IEA	UniProtKB-KW:KW-0560	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Aldh1l1	Rat	oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor	enables	IEA	ARBA:ARBA00028482	1600115	GO_REF:0000117	UniProt	GO_REF:0000117
Aldh1l1	Rat	oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor	enables	IEA	InterPro:IPR016163	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Aldh1l1	Rat	protein binding	enables	ISO	RGD:1606025	1624291	UniProtKB:Q3SY69 PMID:28514442, PMID:33961781	RGD	PMID:28514442\|PMID:33961781
Aldh1l1	Rat	protein binding	enables	ISO	RGD:1614993	1624291	PR:E9Q9D5 PMID:23055941	RGD	PMID:23055941
Aldh1l1	Rat	protein binding	enables	ISO	RGD:1606025,UniProtKB:O75891-4	1624291	UniProtKB:Q92624 PMID:32296183	RGD	PMID:32296183
Aldh1l1	Rat	protein-containing complex binding		IDA		2303511		RGD

Molecular Pathway Annotations Click to see Annotation Detail View

RGD Manual Annotations

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Aldh1l1	Rat	altered folate cycle metabolic pathway		ISO	RGD:1606025	7242562		RGD
Aldh1l1	Rat	folate cycle metabolic pathway		ISO	RGD:1606025	7242562		RGD
Aldh1l1	Rat	folate mediated one-carbon metabolic pathway		TAS		1547843		RGD
Aldh1l1	Rat	folate metabolic pathway		TAS		1547843		RGD

Imported Annotations - SMPDB

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Aldh1l1	Rat	folate metabolic pathway		ISO	RGD:1606025	10402751		SMPDB	SMP:00053
Aldh1l1	Rat	hereditary folate malabsorption pathway		ISO	RGD:1606025	10402751		SMPDB	SMP:00724
Aldh1l1	Rat	methotrexate pharmacodynamics pathway		ISO	RGD:1606025	10402751		SMPDB	SMP:00432

Imported Annotations - KEGG (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Aldh1l1	Rat	folate mediated one-carbon metabolic pathway		IEA		6907045		KEGG	rno:00670

Disease Annotations Click to see Annotation Detail View

alkaptonuria (ISO)

autism spectrum disorder (ISO)

cholestasis (IEP)

Experimental Liver Cirrhosis (ISO)

High Myopia (ISO)

Hypoxia (ISO)

obesity (ISO)

Primary Lymphedema with Myelodysplasia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,1-dichloroethene (ISO)

1-naphthyl isothiocyanate (EXP)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP,ISO)

2,2',4,4'-Tetrabromodiphenyl ether (EXP)

2,3,7,8-tetrabromodibenzodioxine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2,4,6-trinitrotoluene (EXP)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

3,4-methylenedioxymethamphetamine (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

3H-1,2-dithiole-3-thione (EXP)

4,4'-sulfonyldiphenol (EXP,ISO)

4-amino-2,6-dinitrotoluene (EXP)

4-hydroxyphenyl retinamide (ISO)

5-methyltetrahydrofolic acid (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

acrolein (ISO)

acrylamide (ISO)

actinomycin D (ISO)

aflatoxin B1 (ISO)

alpha-pinene (ISO)

atrazine (EXP)

azathioprine (ISO)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

Bisphenol B (ISO)

bisphenol F (EXP,ISO)

Brodifacoum (EXP)

cadmium dichloride (EXP)

camptothecin (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

chromium(6+) (ISO)

clofibrate (EXP)

clofibric acid (EXP)

cobalt dichloride (EXP)

copper(II) chloride (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

dexamethasone (ISO)

dibutyl phthalate (EXP)

diiodine (EXP)

diquat (ISO)

elemental selenium (EXP)

endosulfan (EXP)

ethanol (EXP,ISO)

flutamide (EXP)

folic acid (EXP,ISO)

glafenine (EXP)

hydrazine (EXP)

indometacin (ISO)

iodide salt (EXP)

leflunomide (ISO)

lipopolysaccharide (ISO)

methapyrilene (ISO)

microcystin-LR (ISO)

N-nitrosomorpholine (EXP)

nefazodone (EXP)

nickel atom (ISO)

Nutlin-3 (ISO)

okadaic acid (ISO)

oxaliplatin (EXP)

ozone (ISO)

p-toluidine (EXP)

paracetamol (ISO)

perfluorooctane-1-sulfonic acid (EXP,ISO)

perfluorooctanoic acid (EXP,ISO)

phenobarbital (EXP,ISO)

pirinixic acid (EXP,ISO)

pregnenolone 16alpha-carbonitrile (EXP,ISO)

progesterone (EXP)

propanal (ISO)

pyrazinecarboxamide (EXP)

quinolin-8-ol (ISO)

rotenone (EXP)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

selenium atom (EXP)

silicon dioxide (ISO)

sodium arsenite (ISO)

sodium dichromate (EXP)

sodium perchlorate (EXP)

succimer (ISO)

sulindac (EXP)

tetrachloromethane (EXP,ISO)

tetraphene (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

tolcapone (EXP)

topotecan (EXP)

trichloroethene (EXP,ISO)

Triptolide (ISO)

troglitazone (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

10-formyltetrahydrofolate catabolic process (IDA,IEA,IMP,ISO)

folic acid metabolic process (IDA)

NADPH regeneration (IDA,IEA,ISO)

one-carbon metabolic process (IEA)

tetrahydrofolate biosynthetic process (TAS)

tetrahydrofolate interconversion (IEA,ISO)

Cellular Component

cytoplasm (IEA)

cytosol (IDA,IEA,ISO)

mitochondrion (ISO)

protein-containing complex (IDA)

Molecular Function

aldehyde dehydrogenase (NAD+) activity (IBA,IEA,ISO)

aldehyde dehydrogenase (NADP+) activity (IDA)

aldehyde dehydrogenase [NAD(P)+] activity (IDA)

catalytic activity (IEA)

formyltetrahydrofolate dehydrogenase activity (IBA,IDA,IEA,IMP,ISO,TAS)

oxidoreductase activity (IEA)

oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor (IEA)

protein binding (ISO)

protein-containing complex binding (IDA)

Molecular Pathway Annotations Click to see Annotation Detail View

altered folate cycle metabolic pathway (ISO)

folate cycle metabolic pathway (ISO)

folate mediated one-carbon metabolic pathway (IEA,TAS)

folate metabolic pathway (ISO,TAS)

hereditary folate malabsorption pathway (ISO)

methotrexate pharmacodynamics pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	The crystal structure of the hydrolase domain of 10-formyltetrahydrofolate dehydrogenase: mechanism of hydrolysis and its interplay with the dehydrogenase domain.	Chumanevich AA, etal., J Biol Chem 2004 Apr 2;279(14):14355-64. Epub 2004 Jan 16.
2.	Isolation and characterization of cDNA clones for rat liver 10-formyltetrahydrofolate dehydrogenase.	Cook RJ, etal., J Biol Chem 1991 Mar 15;266(8):4965-73.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Exploration of Hepatoprotective Effect of Gentiopicroside on Alpha-Naphthylisothiocyanate-Induced Cholestatic Liver Injury in Rats by Comprehensive Proteomic and Metabolomic Signatures.	Han H, etal., Cell Physiol Biochem. 2018;49(4):1304-1319. doi: 10.1159/000493409. Epub 2018 Sep 17.
5.	KEGG: Kyoto Encyclopedia of Genes and Genomes	KEGG
6.	Rat liver 10-formyltetrahydrofolate dehydrogenase, carbamoyl phosphate synthetase 1 and betaine homocysteine S-methytransferase were co-purified on Kunitz-type soybean trypsin inhibitor-coupled sepharose CL-4B.	Kim HS, etal., J Biochem Mol Biol. 2007 Jul 31;40(4):604-9.
7.	Aspartate 142 is involved in both hydrolase and dehydrogenase catalytic centers of 10-formyltetrahydrofolate dehydrogenase.	Krupenko SA and Wagner C, J Biol Chem. 1999 Dec 10;274(50):35777-84. doi: 10.1074/jbc.274.50.35777.
8.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
10.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
11.	GOA pipeline	RGD automated data pipeline
12.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
13.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
14.	Polymorphisms in 1-carbon metabolism, epigenetics and folate-related pathologies.	Stover PJ J Nutrigenet Nutrigenomics. 2011;4(5):293-305. doi: 10.1159/000334586. Epub 2012 Feb 22.
15.	Crystal structures of the carboxyl terminal domain of rat 10-formyltetrahydrofolate dehydrogenase: implications for the catalytic mechanism of aldehyde dehydrogenases.	Tsybovsky Y, etal., Biochemistry. 2007 Mar 20;46(11):2917-29. Epub 2007 Feb 16.

Additional References at PubMed

PMID:3392008	PMID:7822273	PMID:12477932	PMID:16396499	PMID:18614015	PMID:19056867	PMID:20498374	PMID:21238436	PMID:23376485	PMID:23533145	PMID:34800366	PMID:35013550
PMID:36675153

Genomics

Comparative Map Data

Aldh1l1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	124,617,182 - 124,663,674 (+)	NCBI		GRCr8
mRatBN7.2	4	123,059,989 - 123,106,471 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	123,060,008 - 123,106,465 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	128,527,602 - 128,574,093 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	124,302,026 - 124,348,513 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	122,926,598 - 122,973,089 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	123,516,553 - 123,564,067 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	123,516,788 - 123,557,501 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	186,990,816 - 187,030,955 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Celera	4	111,983,791 - 112,029,897 (+)	NCBI		Celera
Cytogenetic Map	4	q34	NCBI

ALDH1L1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	126,103,570 - 126,197,945 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	126,103,562 - 126,197,994 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	3	125,822,413 - 125,900,029 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	127,305,098 - 127,382,175 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	3	124,246,087 - 124,323,172 (-)	NCBI		Celera
Cytogenetic Map	3	q21.3	NCBI
HuRef	3	123,202,976 - 123,280,599 (-)	NCBI		HuRef
CHM1_1	3	125,785,177 - 125,862,716 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	3	128,835,963 - 128,930,120 (-)	NCBI		T2T-CHM13v2.0

Aldh1l1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	90,527,751 - 90,576,153 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	90,463,409 - 90,577,185 (+)	Ensembl		GRCm39 Ensembl
GRCm38	6	90,550,768 - 90,599,171 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	90,486,427 - 90,600,203 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	6	90,500,842 - 90,549,165 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	6	90,516,352 - 90,564,675 (+)	NCBI		MGSCv36	mm8
Celera	6	92,439,210 - 92,482,963 (+)	NCBI		Celera
Cytogenetic Map	6	D1	NCBI
cM Map	6	40.16	NCBI

Aldh1l1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955421	21,420,147 - 21,527,037 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955421	21,420,264 - 21,506,004 (-)	NCBI	ChiLan1.0	ChiLan1.0

ALDH1L1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	124,047,200 - 124,124,841 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	124,051,981 - 124,129,620 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	123,166,630 - 123,244,257 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	130,484,862 - 130,562,958 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	130,484,862 - 130,562,934 (-)	Ensembl	panpan1.1		panPan2

ALDH1L1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	52,722 - 99,180 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	20	61,349 - 99,160 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	318,809 - 429,721 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	291,997 - 402,986 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	288,804 - 402,864 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	23,804 - 134,696 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	354,338 - 463,492 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	313,350 - 422,524 (-)	NCBI		UU_Cfam_GSD_1.0

Aldh1l1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404942	19,186,039 - 19,234,700 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936898	456,521 - 484,282 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936898	456,299 - 484,681 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ALDH1L1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	53,748,653 - 53,794,706 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	7	53,748,585 - 53,794,777 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

ALDH1L1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	22	54,848,868 - 54,933,415 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	22	54,848,901 - 54,934,629 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666041	111,375,948 - 111,461,164 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Aldh1l1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624773	385,594 - 468,270 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624773	385,583 - 468,270 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Aldh1l1
232 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	131
Count of miRNA genes:	108
Interacting mature miRNAs:	112
Transcripts:	ENSRNOT00000075042
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1582232	Gluco25	Glucose level QTL 25	3.6	0.0023	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	85253748	148090731	Rat
631689	Scl4	Serum cholesterol level QTL 4	1.9	0.008	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	4	95174120	140174120	Rat
1358352	Srcrt3	Stress Responsive Cort QTL 3	2.29		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	38465774	146803430	Rat
1578655	Bmd11	Bone mineral density QTL 11	11		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	4	90850165	135850165	Rat
1300116	Hrtrt5	Heart rate QTL 5	3.76		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	116179486	151161268	Rat
10755501	Bp390	Blood pressure QTL 390	2.5		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	4	26775591	168368347	Rat
61330	Eau1	Experimental allergic uveoretinitis QTL 1		0.0003	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	4	70362013	132642728	Rat
731165	Uae21	Urinary albumin excretion QTL 21	2.4	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	4	106649412	151649412	Rat
737821	Hcar9	Hepatocarcinoma resistance QTL 9	3.7		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	4	109866907	167139601	Rat
1549832	Bss3	Bone structure and strength QTL 3	11		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	4	109827074	154827074	Rat
70177	Xhs1	X-ray hypersensitivity QTL 1	25.1		intestine integrity trait (VT:0010554)	post-insult time to onset of moribundity (CMO:0001896)	4	82798864	152731274	Rat
61476	Aia3	Adjuvant induced arthritis QTL 3	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	86730991	131730991	Rat
1641919	Alc22	Alcohol consumption QTL 22		0.0005	drinking behavior trait (VT:0001422)	ethanol drink intake rate (CMO:0001407)	4	81192555	126192555	Rat
1354660	Salc1	Saline consumption QTL 1	11.26		drinking behavior trait (VT:0001422)	saline drink intake rate (CMO:0001627)	4	44463908	148090542	Rat
1298082	Stresp4	Stress response QTL 4			blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	50119848	146803430	Rat
1578670	Bss14	Bone structure and strength QTL 14	16.4		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	4	87327165	132327165	Rat
70201	Gcr1	Gastric cancer resistance QTL 1	2.7		stomach morphology trait (VT:0000470)	stomach tumor susceptibility score (CMO:0002043)	4	120260281	147278687	Rat
70200	Alc18	Alcohol consumption QTL 18	9.2		drinking behavior trait (VT:0001422)	ethanol intake volume to total fluid intake volume ratio (CMO:0001591)	4	56647873	149491524	Rat
1331759	Hrtrt13	Heart rate QTL 13	3.54628		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	110275411	168266883	Rat
724535	Cm18	Cardiac mass QTL 18	2.6		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	4	118856416	163856416	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	11320076	180699135	Rat
1578662	Bss15	Bone structure and strength QTL 15	19.6		femur width (VT:1000666)	femoral neck width (CMO:0001695)	4	87327165	132327165	Rat
2302049	Pia32	Pristane induced arthritis QTL 32	5.1	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin G-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002112)	4	105789505	150789505	Rat
6478763	Anxrr46	Anxiety related response QTL 46		0.07428	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	110870972	155870972	Rat
6478760	Anxrr45	Anxiety related response QTL 45		0.06717	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	110870972	155870972	Rat
1331802	Srn5	Serum renin concentration QTL 5	3.045		renin activity (VT:0005581)	plasma renin activity level (CMO:0000116)	4	119428175	157578333	Rat
738009	Sach4	Saccharine consumption QTL 4	4.9	0.000016	consumption behavior trait (VT:0002069)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	4	59948935	154902892	Rat
2312567	Glom19	Glomerulus QTL 19	1.9	0.006	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	4	45456990	146803430	Rat
738015	Pia9	Pristane induced arthritis QTL 9	4.5	0.048	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	80694870	125694870	Rat
7207480	Bss105	Bone structure and strength QTL 105	8.1		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	4	109827074	154827074	Rat
634335	Anxrr16	Anxiety related response QTL 16	7.22		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	4	93308457	167139447	Rat
631646	Stl4	Serum triglyceride level QTL 4	6.5	0.0001	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	4	73169846	132642728	Rat
634334	Xhs3	X-ray hypersensitivity QTL 3	10		intestine integrity trait (VT:0010554)	post-insult time to onset of moribundity (CMO:0001896)	4	84728680	129854654	Rat
61406	Scwia1	Streptococcal cell wall induced arthritis QTL 1	2.3		joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	4	106805662	151805662	Rat
1354612	Foco1	Food consumption QTL 1	8.87		eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	4	44463908	148090542	Rat
2303168	Bp330	Blood pressure QTL 330	4.25	0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	5214602	146446691	Rat
738031	Alc14	Alcohol consumption QTL 14	7.6	0.00003	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	59948935	154902892	Rat
1576316	Ept5	Estrogen-induced pituitary tumorigenesis QTL 5	3.8		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	4	83428419	177635233	Rat
631662	Hcar2	Hepatocarcinoma resistance QTL 2	3.1	0.0003	liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	4	78878504	123878504	Rat
1576305	Emca6	Estrogen-induced mammary cancer QTL 6	5.8		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	4	44463720	155883716	Rat
61418	Pia5	Pristane induced arthritis QTL 5	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	62277855	128289560	Rat
738016	Alc16	Alcohol consumption QTL 16	3.6	0.00015	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	59948935	154902892	Rat
1358202	Gluco11	Glucose level QTL 11	2.4	0.02	adipocyte glucose uptake trait (VT:0004185)	absolute change in adipocyte glucose uptake (CMO:0000873)	4	85379421	167139601	Rat
1641833	Alc21	Alcohol consumption QTL 21	8.6	0.0001	drinking behavior trait (VT:0001422)	ethanol drink intake rate (CMO:0001407)	4	56698790	126192555	Rat
631674	Iddm14	Insulin dependent diabetes mellitus QTL 14			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	4	64528739	157573521	Rat
2293840	Kiddil9	Kidney dilation QTL 9	2.9		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	4	120926564	148090731	Rat
12798519	Anxrr54	Anxiety related response QTL 54	2.54	0.05	locomotor behavior trait (VT:0001392)	distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493)	4	114627026	159627026	Rat
12798523	Anxrr56	Anxiety related response QTL 56	2.83	0.05	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	85253748	150276390	Rat
61434	Cia3	Collagen induced arthritis QTL 3	4.8		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	103194656	148194656	Rat
12798527	Anxrr58	Anxiety related response QTL 58	4.11	0.05	locomotor behavior trait (VT:0001392)	distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493)	4	119463257	147278687	Rat

Markers in Region

D4Got298

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	123,069,574 - 123,069,704 (-)	MAPPER	mRatBN7.2
Rnor_6.0	4	123,552,272 - 123,552,401	NCBI	Rnor6.0
Rnor_5.0	4	186,995,660 - 186,995,789	UniSTS	Rnor5.0
Celera	4	111,993,064 - 111,993,193	UniSTS

RH127817

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	123,106,251 - 123,106,446 (-)	MAPPER	mRatBN7.2
Rnor_6.0	4	123,516,578 - 123,516,772	NCBI	Rnor6.0
Rnor_5.0	4	187,030,736 - 187,030,930	UniSTS	Rnor5.0
Celera	4	112,029,678 - 112,029,872	UniSTS
RH 3.4 Map	4	733.42	UniSTS

BI284419

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	123,075,227 - 123,075,424 (-)	MAPPER	mRatBN7.2
Rnor_6.0	4	123,546,495 - 123,546,691	NCBI	Rnor6.0
Rnor_5.0	4	187,001,242 - 187,001,438	UniSTS	Rnor5.0
Celera	4	111,998,717 - 111,998,913	UniSTS
RH 3.4 Map	4	733.52	UniSTS

Aldh1l1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	123,078,906 - 123,078,974 (-)	MAPPER	mRatBN7.2
Rnor_6.0	4	123,542,962 - 123,543,029	NCBI	Rnor6.0
Rnor_5.0	4	187,004,610 - 187,004,677	UniSTS	Rnor5.0

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_022547	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039108319	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063286665	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC089101	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473957	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M59861	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000075042 ⟹ ENSRNOP00000065882

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	123,060,008 - 123,106,464 (+)	Ensembl
Rnor_6.0 Ensembl	4	123,516,788 - 123,557,501 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000085966 ⟹ ENSRNOP00000071405

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	123,060,008 - 123,106,464 (+)	Ensembl
Rnor_6.0 Ensembl	4	123,516,788 - 123,557,501 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000096748 ⟹ ENSRNOP00000089314

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	123,060,008 - 123,106,464 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000105191 ⟹ ENSRNOP00000088467

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	123,060,008 - 123,106,465 (+)	Ensembl

RefSeq Acc Id:

NM_022547 ⟹ NP_071992

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	124,617,220 - 124,663,674 (+)	NCBI
mRatBN7.2	4	123,060,017 - 123,106,471 (+)	NCBI
Rnor_6.0	4	123,516,553 - 123,564,067 (-)	NCBI
Rnor_5.0	4	186,990,816 - 187,030,955 (+)	NCBI
Celera	4	111,983,791 - 112,029,897 (+)	RGD

Sequence:

show sequence

CCCGTCTGGGAGCTCGCGGTTCCTGTGCTGACTCTCAAAGGGCTGACTGACCCTCGCACCTAGC
AGGTACTTCTGGATTGCAAGTCCAGGGTTCTGGGCCGGTGACCCTGTTTTCTCTACTTCCTGTC
TTTGACCTTGGGTACCTTCCAACCCACTGTTGCCATGAAGATTGCAGTAATCGGACAGAGCCTG
TTTGGCCAGGAGGTTTACTGCCAGCTGAGGAAGGAGGGCCACGAGGTGGTGGGTGTGTTCACAA
TCCCAGACAAGGATGGGAAAGCAGACCCCCTGGGCCTGGAGGCTGAGAAGGATGGCCGTGCCGT
GTTCAAGTTTCCTCGGTGGCGTGCTCGGGGACAGGCTCTGCCCGAGGTGGTGGCCAAATACCAG
GCTCTGGGTGCAGAGCTCAATGTGCTTCCCTTCTGCAGCCAGTTCATACCCATGGAGGTCATTA
ATGCCCCCAGGCACGGCTCCATCATCTACCATCCATCCCTGCTACCCAGGCATCGAGGGGCTTC
GGCCATCAACTGGACCCTCATTCATGGAGATAAGAAAGGAGGCTTCACCATCTTCTGGGCTGAT
GATGGCCTGGACACTGGTGACCTTCTGCTGCAGAAGGAGTGTGAGGTGCTTCCAGATGACACCG
TGAGCACGCTGTACAATCGTTTCCTCTTCCCAGAGGGCATCAAAGGGATGGTTCAGGCTGTGCG
ACTGATCGCAGAGGGTACAGCCCCCCGCTGCCCCCAGTCTGAGGAAGGAGCCACCTATGAGGGC
ATTCAGAAGAAGGAGACAGCCAAGATCAATTGGGACCAGCCAGCAGAGGCCATTCACAACTGGA
TCCGTGGGAATGACAAGGTGCCAGGTGCCTGGACAGAGGCTTGTGGGCAGAAGCTGACATTTTT
CAACTCGACACTCAACACTTCAGGACTGTCAACCCAGGGAGAAGCTTTACCCATCCCAGGAGCC
CATCGTCCAGGCGTGGTCACCAAAGCAGGACTCATCCTCTTTGGGAATGAGCATAGAATGTTGC
TGGTGAAGAACATCCAGCTGGAAGATGGCAAGATGATGCCAGCCTCCCAGTTCTTCAAGGGGTC
CGCTAGCAGTGACCTGGAGCTGACAGAGGCGGAGTTGGCCACGGCGGAGGCTGTGCGGAGCTCT
TGGATGCGAATCCTGCCGAACGTCCCAGAGGTGGAAGACTCTACAGATTTCTTCAAGTCAGGAG
CTGCTTCTGTAGATGTTGTGAGGCTGGTGGAGGAAGTGAAGGAGCTGTGTGACGGGCTGGAGTT
AGAAAATGAAGACGTTTACATGGCCACCACCTTTAGGGAGTTTATCCAGCTCCTAGTGAGGAAG
CTGAGAGGGGAGGACGACGAGAGCGAGTGTGTCATTAACTACGTGGAAAGGGCAGTGAACAAGC
TGACTCTCCAAATGCCCTACCAGCTCTTCATAGGCGGCGAGTTCGTGGACGCTGAGGGCTCTAA
GACCTACAATACCATCAACCCAACGGATGGAAGTGTCATCTGCCAGGTGTCCCTGGCTCAGGTG
AGCGATGTTGACAAGGCAGTGGCAGCAGCAAAGGAAGCCTTCGAGAACGGACTGTGGGGAAAGA
TAAATGCTCGTGACCGGGGCCGGCTCCTGTACAGGTTGGCGGATGTCATGGAGCAGCACCAGGA
AGAGCTAGCCACCATTGAGGCCCTGGATCGAGGTGCCGTCTACACGCTGGCCCTGAAGACGCAC
GTGGGCATGTCCATCCAGACCTTCCGGTACTTTGCTGGCTGGTGTGATAAGATCCAGGGTGCCA
CCATCCCCATCAACCAGGCTAGACCCAACCGCAACCTGACCTTGACCAAGAAGGAACCTGTTGG
GGTCTGTGGCATTGTCATCCCCTGGAACTATCCCTTAATGATGCTATCCTGGAAGACTGCAGCC
TGCCTGGCGGCTGGGAACACCGTGGTGATCAAGCCTGCCCAGGTGACCCCACTCACAGCCTTGA
AGTTTGCCGAGCTGACACTGAAGGCTGGCATTCCCAAGGGTGTGGTCAACATCCTCCCAGGATC
TGGATCCCTGGTTGGCCAGAGACTCTCAGACCACCCTGATGTGAGGAAAATAGGGTTCACAGGC
TCCACGGAGGTGGGGAAACACATCATGAAAAGCTGTGCTCTGAGCAACGTGAAGAAAGTCTCCC
TGGAGCTGGGTGGAAAGTCACCCCTTATCATATTTGCTGACTGCGACCTCAACAAGGCCGTGCA
GATGGGCATGAGCTCCGTTTTCTTCAACAAAGGGGAGAACTGCATTGCGGCAGGCCGGCTCTTT
GTGGAGGAGTCCATCCACAACCAGTTTGTGCAGAAAGTGGTGGAGGAGGTGGAGAAGATGAAAA
TCGGCAATCCCCTGGAGAGGGACACCAATCATGGCCCGCAGAACCATGAGGCCCACCTGAGGAA
GCTAGTGGAGTATTGCCAACGTGGTGTGAAGGAAGGGGCCACACTGGTCTGTGGTGGGAACCAA
GTCCCAAGGCCAGGATTCTTCTTTCAGCCAACCGTCTTCACAGACGTAGAGGACCACATGTACA
TCGCTAAGGAGGAGTCCTTTGGGCCCATCATGATCATCTCTCGGTTTGCTGATGGGGATGTGGA
TGCTGTGCTGTCCCGGGCCAATGCCACAGAATTTGGCCTGGCCTCTGGGGTCTTCACCCGCGAT
ATCAACAAGGCCCTGTATGTCAGTGACAAACTGCAGGCAGGCACTGTGTTCATCAACACGTATA
ACAAGACTGATGTGGCCGCACCTTTTGGAGGATTCAAGCAATCTGGATTTGGCAAAGACCTGGG
AGAGGCAGCCCTGAATGAGTACCTGCGGATCAAGACTGTGACTTTTGAGTACTGAAGCCAAGTC
TGTGATATTTCTCCTGTACCCTGTTGCCTCCCCTCAGGGAGCCCTGGCCCCTGTCTGGTGTCTT
AGCACCCTCCTGTCCCCAACACTGTTCCCTTCAGCTGCTGGAGCTATCAGTGTGGACCCCTGCT
GGTGACAGGACACCTCCGGACAATTGGAAGTGGTTCCAAGTGGAGTGAGCAGTCATGTCCCGGA
TGAATAAAGGTTGTGAGCAGAAGTCACCTGCAAAAAA

hide sequence

RefSeq Acc Id:

XM_039108319 ⟹ XP_038964247

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	124,617,182 - 124,661,502 (+)	NCBI
mRatBN7.2	4	123,059,989 - 123,104,299 (+)	NCBI

RefSeq Acc Id:

XM_063286665 ⟹ XP_063142735

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	124,617,182 - 124,663,668 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_071992	(Get FASTA)	NCBI Sequence Viewer
	XP_038964247	(Get FASTA)	NCBI Sequence Viewer
	XP_063142735	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA70429	(Get FASTA)	NCBI Sequence Viewer
	AAH89101	(Get FASTA)	NCBI Sequence Viewer
	EDL91355	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000065882
	ENSRNOP00000089314.1
GenBank Protein	P28037	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_071992 ⟸ NM_022547

- UniProtKB:

P28037 (UniProtKB/Swiss-Prot), Q5HZB2 (UniProtKB/Swiss-Prot), A0A0G2K0D8 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MKIAVIGQSLFGQEVYCQLRKEGHEVVGVFTIPDKDGKADPLGLEAEKDGRAVFKFPRWRARGQ
ALPEVVAKYQALGAELNVLPFCSQFIPMEVINAPRHGSIIYHPSLLPRHRGASAINWTLIHGDK
KGGFTIFWADDGLDTGDLLLQKECEVLPDDTVSTLYNRFLFPEGIKGMVQAVRLIAEGTAPRCP
QSEEGATYEGIQKKETAKINWDQPAEAIHNWIRGNDKVPGAWTEACGQKLTFFNSTLNTSGLST
QGEALPIPGAHRPGVVTKAGLILFGNEHRMLLVKNIQLEDGKMMPASQFFKGSASSDLELTEAE
LATAEAVRSSWMRILPNVPEVEDSTDFFKSGAASVDVVRLVEEVKELCDGLELENEDVYMATTF
REFIQLLVRKLRGEDDESECVINYVERAVNKLTLQMPYQLFIGGEFVDAEGSKTYNTINPTDGS
VICQVSLAQVSDVDKAVAAAKEAFENGLWGKINARDRGRLLYRLADVMEQHQEELATIEALDRG
AVYTLALKTHVGMSIQTFRYFAGWCDKIQGATIPINQARPNRNLTLTKKEPVGVCGIVIPWNYP
LMMLSWKTAACLAAGNTVVIKPAQVTPLTALKFAELTLKAGIPKGVVNILPGSGSLVGQRLSDH
PDVRKIGFTGSTEVGKHIMKSCALSNVKKVSLELGGKSPLIIFADCDLNKAVQMGMSSVFFNKG
ENCIAAGRLFVEESIHNQFVQKVVEEVEKMKIGNPLERDTNHGPQNHEAHLRKLVEYCQRGVKE
GATLVCGGNQVPRPGFFFQPTVFTDVEDHMYIAKEESFGPIMIISRFADGDVDAVLSRANATEF
GLASGVFTRDINKALYVSDKLQAGTVFINTYNKTDVAAPFGGFKQSGFGKDLGEAALNEYLRIK
TVTFEY

hide sequence

Ensembl Acc Id:

ENSRNOP00000065882 ⟸ ENSRNOT00000075042

Ensembl Acc Id:

ENSRNOP00000071405 ⟸ ENSRNOT00000085966

RefSeq Acc Id:	XP_038964247 ⟸ XM_039108319
- Peptide Label:	isoform X2
- UniProtKB:	A0A0G2K0D8 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000089314 ⟸ ENSRNOT00000096748

Ensembl Acc Id:

ENSRNOP00000088467 ⟸ ENSRNOT00000105191

RefSeq Acc Id:	XP_063142735 ⟸ XM_063286665
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I6GG93 (UniProtKB/TrEMBL), A0A0G2K0D8 (UniProtKB/TrEMBL)

Protein Domains

Carrier

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P28037-F1-model_v2	AlphaFold	P28037	1-902	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621294	AgrOrtholog
BioCyc Gene	G2FUF-43731	BioCyc
Ensembl Genes	ENSRNOG00000047023	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000075042	ENTREZGENE
	ENSRNOT00000096748.1	UniProtKB/Swiss-Prot
Gene3D-CATH	1.10.1200.10	UniProtKB/Swiss-Prot
	3.10.25.10	UniProtKB/Swiss-Prot
	Aldehyde Dehydrogenase, Chain A, domain 1	UniProtKB/Swiss-Prot
	Aldehyde Dehydrogenase, Chain A, domain 2	UniProtKB/Swiss-Prot
	Formyl transferase, N-terminal domain	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7306458	IMAGE-MGC_LOAD
InterPro	10_FTHF_DH	UniProtKB/Swiss-Prot
	ACP-like_sf	UniProtKB/Swiss-Prot
	Ald_DH/histidinol_DH	UniProtKB/Swiss-Prot
	Ald_DH_C	UniProtKB/Swiss-Prot
	Ald_DH_CS_CYS	UniProtKB/Swiss-Prot
	Ald_DH_CS_GLU	UniProtKB/Swiss-Prot
	Ald_DH_N	UniProtKB/Swiss-Prot
	Aldehyde_DH_dom	UniProtKB/Swiss-Prot
	Formyl_trans_C	UniProtKB/Swiss-Prot
	Formyl_trans_C_sf	UniProtKB/Swiss-Prot
	Formyl_transf_N	UniProtKB/Swiss-Prot
	Formyl_transf_N_sf	UniProtKB/Swiss-Prot
	Formyl_transferase-like_C_sf	UniProtKB/Swiss-Prot
	GART_AS	UniProtKB/Swiss-Prot
	PP-bd_ACP	UniProtKB/Swiss-Prot
KEGG Report	rno:64392	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:105431	IMAGE-MGC_LOAD
NCBI Gene	64392	ENTREZGENE
PANTHER	ALDEHYDE DEHYDROGENASE-RELATED	UniProtKB/Swiss-Prot
Pfam	Aldedh	UniProtKB/Swiss-Prot
	Formyl_trans_C	UniProtKB/Swiss-Prot
	Formyl_trans_N	UniProtKB/Swiss-Prot
PharmGKB	ALDH1L1	RGD
PhenoGen	Aldh1l1	PhenoGen
PIRSF	10-FTHFDH	UniProtKB/Swiss-Prot
PROSITE	ALDEHYDE_DEHYDR_CYS	UniProtKB/Swiss-Prot
	ALDEHYDE_DEHYDR_GLU	UniProtKB/Swiss-Prot
	CARRIER	UniProtKB/Swiss-Prot
	GART	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000047023	RatGTEx
Superfamily-SCOP	SSF47336	UniProtKB/Swiss-Prot
	SSF50486	UniProtKB/Swiss-Prot
	SSF53328	UniProtKB/Swiss-Prot
	SSF53720	UniProtKB/Swiss-Prot
UniProt	A0A0G2K0D8	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6GG93	ENTREZGENE, UniProtKB/TrEMBL
	AL1L1_RAT	UniProtKB/Swiss-Prot
	M0R8T2_RAT	UniProtKB/TrEMBL
	P28037	ENTREZGENE
	Q5HZB2	ENTREZGENE
UniProt Secondary	Q5HZB2	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-02-19	Aldh1l1	aldehyde dehydrogenase 1 family, member L1	Fthfd	formyltetrahydrofolate dehydrogenase	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Fthfd	formyltetrahydrofolate dehydrogenase		10-formyltetrahydrofolate dehydrogenase	Name updated	1299863	APPROVED
2002-08-07	Fthfd	10-formyltetrahydrofolate dehydrogenase			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_cellular_localization	localized to the cytosol
gene_domains	contains two putative catalytic domains: phosphoribosylglycinamide formyltransferase and aldehyde dehydrogenase (NADP+)	632027
gene_expression	expressed in liver	632027
gene_protein	902 amino acids; Mr 99,015
gene_protein	902 amino acids; 99 kDa	632027

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)