Symbol:
Rpl15 (Ensembl: Rpl15l1)
Name:
ribosomal protein L15 (Ensembl:ribosomal protein L15 like 1)
RGD ID:
621181
Description:
Predicted to enable RNA binding activity. Predicted to be a structural constituent of ribosome. Involved in response to ethanol. Located in A band. Part of cytosolic large ribosomal subunit. Human ortholog(s) of this gene implicated in Diamond-Blackfan anemia 12. Orthologous to human RPL15 (ribosomal protein L15); PARTICIPATES IN ribosome biogenesis pathway; translation pathway; INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
60S ribosomal protein L15; large ribosomal subunit protein eL15; Rpl10
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
RPL15 (ribosomal protein L15) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Rpl15 (ribosomal protein L15) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Rpl15 (ribosomal protein L15) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
RPL15 (ribosomal protein L15) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
RPL15 (ribosomal protein L15) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Rpl15 (ribosomal protein L15) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
RPL15 (ribosomal protein L15) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
RPL15 (ribosomal protein L15) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Rpl15 (ribosomal protein L15) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
ALDH9A1 (aldehyde dehydrogenase 9 family member A1) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
RPL15 (ribosomal protein L15)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Rpl15 (ribosomal protein L15)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
rpl15 (ribosomal protein L15)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
rpl-15
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
RPL15A
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
RPL15B
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
RpL15
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
rpl15
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 15 9,934,663 - 9,937,946 (+) NCBI GRCr8 mRatBN7.2 15 7,503,883 - 7,507,166 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 10,227,171 - 10,228,000 (+) Ensembl mRatBN7.2 Ensembl mRatBN7.2 Ensembl 15 7,503,883 - 7,507,165 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 15 9,649,553 - 9,652,826 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 15 10,562,350 - 10,565,623 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 15 8,862,768 - 8,866,041 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 15 8,188,717 - 8,192,153 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 15 8,189,253 - 8,192,152 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 15 12,250,776 - 12,254,212 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 15 9,082,190 - 9,085,473 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 15 7,557,178 - 7,560,461 (+) NCBI Celera Cytogenetic Map 15 p16 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Rpl15 Rat (-)-epigallocatechin 3-gallate increases expression ISO RPL15 (Homo sapiens) 6480464 epigallocatechin gallate results in increased expression of RPL15 protein CTD PMID:31195006 Rpl15 Rat (1->4)-beta-D-glucan multiple interactions ISO Rpl15 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of RPL15 mRNA CTD PMID:36331819 Rpl15 Rat 1,2-dimethylhydrazine multiple interactions ISO Rpl15 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of RPL15 mRNA CTD PMID:22206623 Rpl15 Rat 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of RPL15 mRNA CTD PMID:17557909 Rpl15 Rat 17beta-estradiol decreases expression ISO Rpl15 (Mus musculus) 6480464 Estradiol results in decreased expression of RPL15 mRNA CTD PMID:39298647 Rpl15 Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Rpl15 (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Rpl15 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Rpl15 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin binds to AHR protein] which results in increased expression of RPL15 mRNA CTD PMID:16214954 Rpl15 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of RPL15 mRNA CTD PMID:33387578 Rpl15 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of RPL15 mRNA CTD PMID:32109520 and PMID:34747641 Rpl15 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of RPL15 mRNA CTD PMID:21346803 Rpl15 Rat 2,6-dimethoxyphenol multiple interactions ISO RPL15 (Homo sapiens) 6480464 [pyrogallol 1 more ... CTD PMID:38598786 Rpl15 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of RPL15 mRNA CTD PMID:21346803 Rpl15 Rat 2-nitrofluorene increases expression EXP 6480464 2-nitrofluorene results in increased expression of RPL15 mRNA CTD PMID:15890375 Rpl15 Rat 4,4'-sulfonyldiphenol increases expression ISO Rpl15 (Mus musculus) 6480464 bisphenol S results in increased expression of RPL15 mRNA CTD PMID:39298647 Rpl15 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of RPL15 mRNA CTD PMID:36041667 Rpl15 Rat 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one increases expression EXP 6480464 4-(N-methyl-N-nitrosamino)-1-(3-pyridyl)-1-butanone results in increased expression of RPL15 mRNA CTD PMID:15890375 Rpl15 Rat 4-hydroxyphenyl retinamide decreases expression ISO Rpl15 (Mus musculus) 6480464 Fenretinide results in decreased expression of RPL15 mRNA CTD PMID:28973697 Rpl15 Rat 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole affects expression EXP 6480464 Omeprazole affects the expression of RPL15 mRNA CTD PMID:19483382 Rpl15 Rat 6-propyl-2-thiouracil affects expression EXP 6480464 Propylthiouracil affects the expression of RPL15 mRNA CTD PMID:19483382 Rpl15 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of RPL15 mRNA CTD PMID:24780913 and PMID:36843608 Rpl15 Rat 7,12-dimethyltetraphene decreases expression ISO Rpl15 (Mus musculus) 6480464 9 more ... CTD PMID:38307155 Rpl15 Rat acrolein multiple interactions ISO RPL15 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of RPL15 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of RPL15 mRNA CTD PMID:32699268 Rpl15 Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of RPL15 mRNA CTD PMID:15890375 Rpl15 Rat alpha-pinene multiple interactions ISO RPL15 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of RPL15 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of RPL15 mRNA CTD PMID:32699268 Rpl15 Rat amiodarone affects expression EXP 6480464 Amiodarone affects the expression of RPL15 mRNA CTD PMID:19483382 Rpl15 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of RPL15 mRNA CTD PMID:16483693 Rpl15 Rat antirheumatic drug increases expression ISO RPL15 (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of RPL15 mRNA CTD PMID:24449571 Rpl15 Rat arsane decreases ubiquitination ISO RPL15 (Homo sapiens) 6480464 Arsenic results in decreased ubiquitination of RPL15 protein CTD PMID:35994080 Rpl15 Rat arsenic atom decreases ubiquitination ISO RPL15 (Homo sapiens) 6480464 Arsenic results in decreased ubiquitination of RPL15 protein CTD PMID:35994080 Rpl15 Rat arsenite(3-) multiple interactions ISO RPL15 (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to RPL15 mRNA] CTD PMID:32406909 Rpl15 Rat benzbromarone affects expression EXP 6480464 Benzbromarone affects the expression of RPL15 mRNA CTD PMID:19483382 Rpl15 Rat benzene-1,2,4-triol decreases expression ISO RPL15 (Homo sapiens) 6480464 hydroxyhydroquinone results in decreased expression of RPL15 mRNA CTD PMID:17572062 Rpl15 Rat benzo[a]pyrene increases expression ISO Rpl15 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of RPL15 mRNA CTD PMID:20504355 Rpl15 Rat benzo[a]pyrene diol epoxide I increases expression ISO RPL15 (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 Rpl15 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of RPL15 mRNA CTD PMID:25181051 Rpl15 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of RPL15 mRNA CTD PMID:36041667 Rpl15 Rat bisphenol A increases expression ISO RPL15 (Homo sapiens) 6480464 bisphenol A results in increased expression of RPL15 protein CTD PMID:33376534 Rpl15 Rat bisphenol A increases expression ISO Rpl15 (Mus musculus) 6480464 bisphenol A results in increased expression of RPL15 mRNA CTD PMID:32156529 and PMID:33221593 Rpl15 Rat bisphenol A affects expression ISO RPL15 (Homo sapiens) 6480464 bisphenol A affects the expression of RPL15 mRNA and bisphenol A affects the expression of RPL15 protein CTD PMID:30903817 and PMID:37567409 Rpl15 Rat bisphenol AF increases expression ISO RPL15 (Homo sapiens) 6480464 bisphenol AF results in increased expression of RPL15 protein CTD PMID:34186270 Rpl15 Rat Bisphenol B increases expression ISO RPL15 (Homo sapiens) 6480464 bisphenol B results in increased expression of RPL15 protein CTD PMID:34186270 Rpl15 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of RPL15 mRNA CTD PMID:36041667 Rpl15 Rat bromobenzene increases expression EXP 6480464 bromobenzene results in increased expression of RPL15 mRNA CTD PMID:12628495 Rpl15 Rat cannabidiol increases expression ISO RPL15 (Homo sapiens) 6480464 Cannabidiol results in increased expression of RPL15 protein CTD PMID:34122009 Rpl15 Rat carbamazepine affects expression ISO RPL15 (Homo sapiens) 6480464 Carbamazepine affects the expression of RPL15 mRNA CTD PMID:25979313 Rpl15 Rat carbon nanotube increases expression ISO Rpl15 (Mus musculus) 6480464 Nanotubes and Carbon analog results in increased expression of RPL15 mRNA CTD PMID:25554681 Rpl15 Rat chloropicrin affects expression ISO RPL15 (Homo sapiens) 6480464 chloropicrin affects the expression of RPL15 mRNA CTD PMID:26352163 Rpl15 Rat chromium(6+) affects expression ISO Rpl15 (Mus musculus) 6480464 chromium hexavalent ion affects the expression of RPL15 mRNA CTD PMID:28472532 Rpl15 Rat clofibrate affects expression EXP 6480464 Clofibrate affects the expression of RPL15 mRNA CTD PMID:19483382 Rpl15 Rat clofibrate multiple interactions ISO Rpl15 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of RPL15 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of RPL15 mRNA] CTD PMID:17585979 Rpl15 Rat cobalt dichloride increases expression ISO RPL15 (Homo sapiens) 6480464 cobaltous chloride results in increased expression of RPL15 mRNA CTD PMID:17553155 Rpl15 Rat copper(II) sulfate decreases expression ISO RPL15 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of RPL15 mRNA CTD PMID:19549813 Rpl15 Rat cylindrospermopsin increases expression ISO Rpl15 (Mus musculus) 6480464 cylindrospermopsin results in increased expression of RPL15 mRNA CTD PMID:20936652 Rpl15 Rat cypermethrin decreases expression ISO Rpl15 (Mus musculus) 6480464 cypermethrin results in decreased expression of RPL15 mRNA CTD PMID:29020013 Rpl15 Rat diethylstilbestrol increases expression EXP 6480464 Diethylstilbestrol results in increased expression of RPL15 mRNA CTD PMID:15890375 Rpl15 Rat diethylstilbestrol decreases expression ISO RPL15 (Homo sapiens) 6480464 Diethylstilbestrol results in decreased expression of RPL15 mRNA CTD PMID:36621641 Rpl15 Rat disodium selenite increases expression ISO RPL15 (Homo sapiens) 6480464 Sodium Selenite results in increased expression of RPL15 mRNA CTD PMID:18175754 Rpl15 Rat dorsomorphin multiple interactions ISO RPL15 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of RPL15 mRNA CTD PMID:27188386 Rpl15 Rat enzyme inhibitor multiple interactions ISO RPL15 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of RPL15 protein CTD PMID:23301498 Rpl15 Rat flavonoids decreases expression EXP 6480464 Flavonoids results in decreased expression of RPL15 mRNA CTD PMID:18035473 Rpl15 Rat folic acid decreases expression ISO RPL15 (Homo sapiens) 6480464 Folic Acid results in decreased expression of RPL15 mRNA CTD PMID:21867686 Rpl15 Rat folic acid multiple interactions ISO Rpl15 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of RPL15 mRNA CTD PMID:22206623 Rpl15 Rat formaldehyde decreases expression ISO RPL15 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of RPL15 mRNA CTD PMID:27664576 Rpl15 Rat FR900359 affects phosphorylation ISO RPL15 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of RPL15 protein CTD PMID:37730182 Rpl15 Rat furfural multiple interactions ISO RPL15 (Homo sapiens) 6480464 [pyrogallol 1 and 3-dimethyl ether co-treated with Furaldehyde] results in increased expression of and affects the localization of RPL15 protein CTD PMID:38598786 Rpl15 Rat inulin multiple interactions ISO Rpl15 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of RPL15 mRNA CTD PMID:36331819 Rpl15 Rat ivermectin decreases expression ISO RPL15 (Homo sapiens) 6480464 Ivermectin results in decreased expression of RPL15 protein CTD PMID:32959892 Rpl15 Rat L-ethionine affects expression EXP 6480464 Ethionine affects the expression of RPL15 mRNA CTD PMID:19483382 Rpl15 Rat Mesaconitine increases expression EXP 6480464 mesaconitine results in increased expression of RPL15 protein CTD PMID:37182599 Rpl15 Rat methamphetamine decreases expression ISO Rpl15 (Mus musculus) 6480464 Methamphetamine results in decreased expression of RPL15 mRNA CTD PMID:26307267 Rpl15 Rat methapyrilene increases expression EXP 6480464 Methapyrilene results in increased expression of RPL15 mRNA CTD PMID:15890375 Rpl15 Rat methidathion increases expression ISO Rpl15 (Mus musculus) 6480464 methidathion results in increased expression of RPL15 mRNA CTD PMID:34813904 Rpl15 Rat methylmercury chloride decreases expression ISO RPL15 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of RPL15 mRNA CTD PMID:28001369 Rpl15 Rat miconazole increases expression ISO Rpl15 (Mus musculus) 6480464 Miconazole results in increased expression of RPL15 mRNA CTD PMID:27462272 Rpl15 Rat N-nitrosodimethylamine increases expression EXP 6480464 Dimethylnitrosamine results in increased expression of RPL15 mRNA CTD PMID:15890375 Rpl15 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of RPL15 mRNA CTD PMID:24136188 Rpl15 Rat nickel atom multiple interactions ISO Rpl15 (Mus musculus) 6480464 MT1 affects the reaction [Nickel affects the expression of RPL15 mRNA] and MT2 affects the reaction [Nickel affects the expression of RPL15 mRNA] CTD PMID:16166738 Rpl15 Rat nimesulide increases expression EXP 6480464 nimesulide results in increased expression of RPL15 mRNA CTD PMID:24136188 Rpl15 Rat omeprazole affects expression EXP 6480464 Omeprazole affects the expression of RPL15 mRNA CTD PMID:19483382 Rpl15 Rat ozone multiple interactions ISO RPL15 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of RPL15 mRNA more ... CTD PMID:32699268 Rpl15 Rat ozone decreases expression EXP 6480464 Ozone results in decreased expression of RPL15 protein CTD PMID:33146391 Rpl15 Rat paracetamol multiple interactions ISO Rpl15 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of RPL15 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of RPL15 mRNA] CTD PMID:17585979 Rpl15 Rat paracetamol affects expression ISO Rpl15 (Mus musculus) 6480464 Acetaminophen affects the expression of RPL15 mRNA CTD PMID:17562736 Rpl15 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Rpl15 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of RPL15 mRNA more ... CTD PMID:36331819 Rpl15 Rat perfluorooctanoic acid increases expression EXP 6480464 perfluorooctanoic acid results in increased expression of RPL15 mRNA CTD PMID:19162173 Rpl15 Rat piperonyl butoxide increases expression EXP 6480464 Piperonyl Butoxide results in increased expression of RPL15 mRNA CTD PMID:15890375 Rpl15 Rat pirinixic acid affects expression EXP 6480464 pirinixic acid affects the expression of RPL15 mRNA CTD PMID:19483382 Rpl15 Rat pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of RPL15 mRNA CTD PMID:15890375 and PMID:19162173 Rpl15 Rat pregnenolone 16alpha-carbonitrile increases expression ISO Rpl15 (Mus musculus) 6480464 Pregnenolone Carbonitrile results in increased expression of RPL15 mRNA CTD PMID:28903501 Rpl15 Rat quercetin increases expression ISO RPL15 (Homo sapiens) 6480464 Quercetin results in increased expression of RPL15 mRNA CTD PMID:21632981 Rpl15 Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of RPL15 protein CTD PMID:35544339 Rpl15 Rat SB 431542 multiple interactions ISO RPL15 (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 and PMID:37664457 Rpl15 Rat silicon dioxide increases expression ISO RPL15 (Homo sapiens) 6480464 Silicon Dioxide results in increased expression of RPL15 mRNA CTD PMID:25351596 Rpl15 Rat sodium arsenite multiple interactions ISO RPL15 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of and results in increased activity of RPL15 protein CTD PMID:30528433 Rpl15 Rat sodium chloride multiple interactions ISO RPL15 (Homo sapiens) 6480464 [Sodium Chloride co-treated with pyrogallol 1 and 3-dimethyl ether] results in increased expression of and affects the localization of RPL15 protein CTD PMID:38598786 Rpl15 Rat sodium dichromate increases expression EXP 6480464 sodium bichromate results in increased expression of RPL15 mRNA CTD PMID:22561333 Rpl15 Rat sodium fluoride decreases expression ISO Rpl15 (Mus musculus) 6480464 Sodium Fluoride results in decreased expression of RPL15 protein CTD PMID:28918527 Rpl15 Rat sunitinib increases expression ISO RPL15 (Homo sapiens) 6480464 Sunitinib results in increased expression of RPL15 mRNA CTD PMID:31533062 Rpl15 Rat thioacetamide affects expression EXP 6480464 Thioacetamide affects the expression of RPL15 mRNA CTD PMID:19483382 Rpl15 Rat tolcapone affects binding EXP 6480464 tolcapone binds to RPL15 protein CTD PMID:19783845 Rpl15 Rat triphenyl phosphate affects expression ISO RPL15 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of RPL15 mRNA CTD PMID:37042841 Rpl15 Rat uranium atom affects expression ISO RPL15 (Homo sapiens) 6480464 Uranium affects the expression of RPL15 mRNA CTD PMID:15672453 Rpl15 Rat valproic acid affects expression ISO Rpl15 (Mus musculus) 6480464 Valproic Acid affects the expression of RPL15 mRNA CTD PMID:17963808 Rpl15 Rat valproic acid multiple interactions ISO RPL15 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of RPL15 mRNA CTD PMID:27188386 Rpl15 Rat valproic acid affects expression ISO RPL15 (Homo sapiens) 6480464 Valproic Acid affects the expression of RPL15 mRNA CTD PMID:23179753 and PMID:25979313 Rpl15 Rat valproic acid increases expression ISO RPL15 (Homo sapiens) 6480464 Valproic Acid results in increased expression of RPL15 mRNA CTD PMID:25192806 and PMID:28001369 Rpl15 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of RPL15 mRNA CTD PMID:23034163 Rpl15 Rat vinclozolin decreases methylation EXP 6480464 vinclozolin results in decreased methylation of RPL15 gene CTD PMID:31682807
(-)-epigallocatechin 3-gallate (ISO) (1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (EXP) 2,6-dimethoxyphenol (ISO) 2,6-dinitrotoluene (EXP) 2-nitrofluorene (EXP) 4,4'-sulfonyldiphenol (EXP,ISO) 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one (EXP) 4-hydroxyphenyl retinamide (ISO) 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP) 6-propyl-2-thiouracil (EXP) 7,12-dimethyltetraphene (ISO) acrolein (ISO) aflatoxin B1 (EXP) alpha-pinene (ISO) amiodarone (EXP) ammonium chloride (EXP) antirheumatic drug (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) benzbromarone (EXP) benzene-1,2,4-triol (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (EXP) bromobenzene (EXP) cannabidiol (ISO) carbamazepine (ISO) carbon nanotube (ISO) chloropicrin (ISO) chromium(6+) (ISO) clofibrate (EXP,ISO) cobalt dichloride (ISO) copper(II) sulfate (ISO) cylindrospermopsin (ISO) cypermethrin (ISO) diethylstilbestrol (EXP,ISO) disodium selenite (ISO) dorsomorphin (ISO) enzyme inhibitor (ISO) flavonoids (EXP) folic acid (ISO) formaldehyde (ISO) FR900359 (ISO) furfural (ISO) inulin (ISO) ivermectin (ISO) L-ethionine (EXP) Mesaconitine (EXP) methamphetamine (ISO) methapyrilene (EXP) methidathion (ISO) methylmercury chloride (ISO) miconazole (ISO) N-nitrosodimethylamine (EXP) nefazodone (EXP) nickel atom (ISO) nimesulide (EXP) omeprazole (EXP) ozone (EXP,ISO) paracetamol (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP) piperonyl butoxide (EXP) pirinixic acid (EXP) pregnenolone 16alpha-carbonitrile (ISO) quercetin (ISO) rotenone (EXP) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sodium chloride (ISO) sodium dichromate (EXP) sodium fluoride (ISO) sunitinib (ISO) thioacetamide (EXP) tolcapone (EXP) triphenyl phosphate (ISO) uranium atom (ISO) valproic acid (ISO) vinclozolin (EXP)
1.
Structures of the human and Drosophila 80S ribosome.
Anger AM, etal., Nature. 2013 May 2;497(7447):80-5. doi: 10.1038/nature12104.
2.
The primary structure of rat ribosomal protein L15.
Chang YL, etal., Biochem Biophys Res Commun 1994 May 30;201(1):108-14.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
Effect of ethanol on hepatic ribosomal proteins and mRNA.
Haviryaji KS, etal., Mol Cell Biochem. 1992 Oct 7;115(2):143-7.
5.
An overview of pre-ribosomal RNA processing in eukaryotes.
Henras AK, etal., Wiley Interdiscip Rev RNA. 2015 Mar-Apr;6(2):225-42. doi: 10.1002/wrna.1269. Epub 2014 Oct 27.
6.
Immunological localization of ribosomes in striated rat muscle. Evidence for myofibrillar association and ontological changes in the subsarcolemmal:myofibrillar distribution.
Horne Z and Hesketh J, Biochem J. 1990 May 15;268(1):231-6.
7.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
9.
GOA pipeline
RGD automated data pipeline
10.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
11.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
12.
Comprehensive gene review and curation
RGD comprehensive gene curation
13.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
14.
Isolation of eukaryotic ribosomal proteins. Purification and characterization of 60 S ribosomal subunit proteins L3, L6, L7', L8, L10, L15, L17, L18, L19, L23', L25, L27', L28, L29, L31, L32, L34, L35, L36, L36', and L37'.
Tsurugi K, etal., J Biol Chem. 1977 Jun 10;252(11):3961-9.
Rpl15 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 15 9,934,663 - 9,937,946 (+) NCBI GRCr8 mRatBN7.2 15 7,503,883 - 7,507,166 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 10,227,171 - 10,228,000 (+) Ensembl mRatBN7.2 Ensembl mRatBN7.2 Ensembl 15 7,503,883 - 7,507,165 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 15 9,649,553 - 9,652,826 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 15 10,562,350 - 10,565,623 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 15 8,862,768 - 8,866,041 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 15 8,188,717 - 8,192,153 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 15 8,189,253 - 8,192,152 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 15 12,250,776 - 12,254,212 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 15 9,082,190 - 9,085,473 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 15 7,557,178 - 7,560,461 (+) NCBI Celera Cytogenetic Map 15 p16 NCBI
RPL15 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 23,916,545 - 23,924,631 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 23,916,591 - 23,924,374 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 23,958,036 - 23,966,122 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 23,933,643 - 23,937,338 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 3 23,933,642 - 23,937,334 NCBI Celera 3 23,894,829 - 23,898,524 (+) NCBI Celera Cytogenetic Map 3 p24.2 NCBI HuRef 3 23,904,389 - 23,911,124 (+) NCBI HuRef CHM1_1 3 23,910,110 - 23,917,002 (+) NCBI CHM1_1 T2T-CHM13v2.0 3 23,921,321 - 23,929,407 (+) NCBI T2T-CHM13v2.0
Rpl15 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 14 4,198,710 - 4,201,873 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 14 4,198,305 - 4,201,873 (+) Ensembl GRCm39 Ensembl GRCm38 14 18,267,823 - 18,270,986 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 14 18,267,823 - 18,271,391 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 14 19,100,337 - 19,103,500 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 9 21,935,943 - 21,959,487 (-) NCBI MGSCv36 mm8 Celera 14 13,960,053 - 13,963,216 (-) NCBI Celera Cytogenetic Map 14 A1 NCBI cM Map 14 7.08 NCBI
Rpl15 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955430 15,766,465 - 15,769,239 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955430 15,766,465 - 15,769,239 (+) NCBI ChiLan1.0 ChiLan1.0
RPL15 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 23,877,684 - 23,880,508 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 23,882,529 - 23,885,280 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 23,829,041 - 23,832,838 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 24,152,223 - 24,156,509 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 3 24,152,479 - 24,157,337 (+) Ensembl panpan1.1 panPan2
RPL15 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 23 19,825,622 - 19,829,807 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 23 19,825,622 - 19,829,807 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 23 19,823,714 - 19,827,899 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 23 20,138,613 - 20,142,803 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 23 20,138,623 - 20,142,770 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 23 19,947,937 - 19,952,126 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 23 20,057,167 - 20,061,348 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 23 20,166,279 - 20,170,467 (-) NCBI UU_Cfam_GSD_1.0
Rpl15 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 182,433,258 - 182,437,239 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936473 15,571,912 - 15,576,462 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936473 15,571,897 - 15,575,812 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
RPL15 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 10,716,002 - 10,719,952 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 10,716,373 - 10,719,959 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 12,164,825 - 12,167,957 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
RPL15 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 15 68,596,897 - 68,599,575 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 15 68,596,968 - 68,599,389 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666041 41,720,551 - 41,723,247 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Rpl15
.
Predicted Target Of
Count of predictions: 28 Count of miRNA genes: 24 Interacting mature miRNAs: 25 Transcripts: ENSRNOT00000010759 Prediction methods: Microtar, Rnahybrid Result types: miRGate_prediction
1641913 Colcr2 Colorectal carcinoma resistance QTL 2 6.57 0.0197 intestine integrity trait (VT:0010554) poorly differentiated malignant colorectal tumor number (CMO:0002076) 15 2266368 22711984 Rat 10401805 Kidm51 Kidney mass QTL 51 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 15 306329 45306329 Rat 1582251 Gluco24 Glucose level QTL 24 3.2 0.0008 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 15 5530756 50530756 Rat 5684946 Bss98 Bone structure and strength QTL 98 3.9 0.0026 tibia strength trait (VT:1000284) tibia ultimate force (CMO:0001734) 15 1058250 14481294 Rat 1354657 Despr13 Despair related QTL 13 0.0022 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 15 1 29912054 Rat 1641887 Alcrsp14 Alcohol response QTL 14 response to alcohol trait (VT:0010489) brain neurotensin receptor 1 density (CMO:0002068) 15 1 42356671 Rat 2298549 Neuinf12 Neuroinflammation QTL 12 3.5 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 15 1 55302115 Rat 731170 Pur3 Proteinuria QTL 3 2.3 0.0005 urine protein amount (VT:0005160) urine protein excretion rate (CMO:0000759) 15 1 41686771 Rat 8552920 Pigfal8 Plasma insulin-like growth factor 1 level QTL 8 3 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 15 1 34723002 Rat 738017 Hcas7 Hepatocarcinoma susceptibility QTL 7 2.91 liver integrity trait (VT:0010547) liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464) 15 2266368 46921453 Rat 8694361 Abfw6 Abdominal fat weight QTL 6 10.2 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 15 1 34723002 Rat 9589149 Insul29 Insulin level QTL 29 9.06 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 15 1 34723002 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000010759 ⟹ ENSRNOP00000010759
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 7,503,883 - 7,507,165 (+) Ensembl Rnor_6.0 Ensembl 15 8,189,253 - 8,192,152 (+) Ensembl
RefSeq Acc Id:
NM_139114 ⟹ NP_620814
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 9,934,663 - 9,937,946 (+) NCBI mRatBN7.2 15 7,503,883 - 7,507,166 (+) NCBI Rnor_6.0 15 8,188,717 - 8,192,153 (+) NCBI Rnor_5.0 15 12,250,776 - 12,254,212 (+) NCBI RGSC_v3.4 15 9,082,190 - 9,085,473 (+) RGD Celera 15 7,557,178 - 7,560,461 (+) RGD
Sequence:
GTGGGGGAGGAGCCACAAAAGGGATTGTGGGAGAAAGGCTTCTTCCTTTCCTCTAGTGGCAGCCATCAGGTGAGCCAAGATGGGTGCATACAAATACATCCAGGAGCTGTGGAGGAAGAAGCAGTCCG
hide sequence
RefSeq Acc Id:
NP_620814 ⟸ NM_139114
- UniProtKB:
P61314 (UniProtKB/Swiss-Prot), A6K036 (UniProtKB/TrEMBL), A0A8I6A471 (UniProtKB/TrEMBL)
- Sequence:
MGAYKYIQELWRKKQSDVMRFLLRVRCWQYRQLSALHRAPRPTRPDKARRLGYKAKQGYVIYRIRVRRGGRKRPVPKGATYGKPVHHGVNQLKFARSLQSVAEERAGRHCGALRVLNSYWVGEDSTYK
hide sequence
Ensembl Acc Id:
ENSRNOP00000010759 ⟸ ENSRNOT00000010759
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2004-02-26
Rpl15
ribosomal protein L15
Symbol and Name status set to approved
625702 APPROVED
2002-08-07
Rpl15
ribosomal protein L15
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_domains
contains the hexapeptide TYKFFE, that is also present in the amyloidogenic glycoprotein A4
633840
gene_other
gene may be present in 13-15 copies
633840
