Symbol:
Akap8
Name:
A-kinase anchoring protein 8
RGD ID:
620832
Description:
Enables double-stranded DNA binding activity; protein kinase A regulatory subunit binding activity; and zinc ion binding activity. Predicted to be involved in several processes, including cellular response to lipopolysaccharide; cellular response to prostaglandin E stimulus; and negative regulation of tumor necrosis factor production. Predicted to act upstream of or within mitotic chromosome condensation. Located in nuclear matrix. Orthologous to human AKAP8 (A-kinase anchoring protein 8); PARTICIPATES IN protein kinase A (PKA) signaling pathway; INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dibromophenyl 2,4,5-tribromophenyl ether.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
A kinase (PRKA) anchor protein 8; A kinase anchor protein 8; A-kinase anchor protein 8; A-kinase anchor protein 95 kDa; AKAP 95; AKAP-8; Akap95
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
AKAP8 (A-kinase anchoring protein 8) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Akap8 (A kinase anchor protein 8) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Akap8 (A-kinase anchoring protein 8) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
AKAP8 (A-kinase anchoring protein 8) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
AKAP8 (A-kinase anchoring protein 8) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Akap8 (A-kinase anchoring protein 8) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
AKAP8 (A-kinase anchoring protein 8) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
AKAP8 (A-kinase anchoring protein 8) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Akap8 (A-kinase anchoring protein 8) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
AKAP8 (A-kinase anchoring protein 8)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Akap8 (A kinase anchor protein 8)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 11,966,769 - 11,983,056 (-) NCBI GRCr8 mRatBN7.2 7 11,316,224 - 11,332,523 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 11,316,228 - 11,332,399 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 14,134,699 - 14,150,843 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 16,012,121 - 16,028,265 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 13,883,649 - 13,899,780 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 14,323,298 - 14,339,953 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 14,324,104 - 14,351,918 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 14,477,683 - 14,493,949 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 12,873,303 - 12,889,333 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 12,873,301 - 12,889,308 (-) NCBI Celera 7 9,427,350 - 9,443,479 (-) NCBI Celera Cytogenetic Map 7 q11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Akap8 Rat 1,2-dimethylhydrazine decreases expression ISO Akap8 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of AKAP8 mRNA CTD PMID:22206623 Akap8 Rat 17alpha-ethynylestradiol increases expression ISO Akap8 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of AKAP8 mRNA CTD PMID:17942748 Akap8 Rat 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of AKAP8 mRNA CTD PMID:17557909 Akap8 Rat 17alpha-ethynylestradiol affects expression ISO Akap8 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of AKAP8 mRNA CTD PMID:17555576 Akap8 Rat 17alpha-ethynylestradiol multiple interactions ISO Akap8 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in decreased expression of AKAP8 mRNA CTD PMID:17942748 Akap8 Rat 17beta-estradiol decreases expression ISO Akap8 (Mus musculus) 6480464 Estradiol results in decreased expression of AKAP8 mRNA CTD PMID:39298647 Akap8 Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO Akap8 (Mus musculus) 6480464 2 more ... CTD PMID:31388691 Akap8 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Akap8 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in decreased expression of AKAP8 mRNA CTD PMID:17942748 Akap8 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of AKAP8 mRNA CTD PMID:33387578 Akap8 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Akap8 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of AKAP8 mRNA CTD PMID:21570461 Akap8 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether decreases expression EXP 6480464 2 more ... CTD PMID:19954255 Akap8 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of AKAP8 mRNA CTD PMID:21346803 Akap8 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of AKAP8 mRNA CTD PMID:21346803 Akap8 Rat 2-palmitoylglycerol increases expression ISO AKAP8 (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of AKAP8 mRNA CTD PMID:37199045 Akap8 Rat 3,3',4,4'-tetrachlorobiphenyl multiple interactions ISO Akap8 (Mus musculus) 6480464 3 more ... CTD PMID:19467301 Akap8 Rat 3H-1,2-dithiole-3-thione decreases expression EXP 6480464 1 and 2-dithiol-3-thione results in decreased expression of AKAP8 mRNA CTD PMID:19162173 Akap8 Rat aflatoxin B1 increases expression ISO Akap8 (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of AKAP8 mRNA CTD PMID:19770486 Akap8 Rat aflatoxin B1 increases methylation ISO AKAP8 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of AKAP8 exon CTD PMID:30157460 Akap8 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of AKAP8 mRNA CTD PMID:16483693 Akap8 Rat Aroclor 1254 decreases expression ISO Akap8 (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of AKAP8 mRNA CTD PMID:23650126 Akap8 Rat arsane affects methylation ISO AKAP8 (Homo sapiens) 6480464 Arsenic affects the methylation of AKAP8 gene CTD PMID:25304211 Akap8 Rat arsenic atom affects methylation ISO AKAP8 (Homo sapiens) 6480464 Arsenic affects the methylation of AKAP8 gene CTD PMID:25304211 Akap8 Rat arsenous acid decreases expression ISO Akap8 (Mus musculus) 6480464 Arsenic Trioxide results in decreased expression of AKAP8 mRNA CTD PMID:35676786 Akap8 Rat azoxystrobin multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in increased expression of AKAP8 mRNA CTD PMID:33854195 Akap8 Rat azoxystrobin decreases expression ISO AKAP8 (Homo sapiens) 6480464 azoxystrobin results in decreased expression of AKAP8 mRNA CTD PMID:33512557 Akap8 Rat benzo[a]pyrene increases expression ISO Akap8 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of AKAP8 mRNA CTD PMID:22228805 Akap8 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO AKAP8 (Homo sapiens) 6480464 [Diethylhexyl Phthalate results in increased abundance of mono-(2-ethylhexyl)phthalate] which results in decreased methylation of AKAP8 gene CTD PMID:33872906 Akap8 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of AKAP8 mRNA CTD PMID:25181051 and PMID:38750585 Akap8 Rat bisphenol A decreases methylation ISO AKAP8 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of AKAP8 gene CTD PMID:31601247 Akap8 Rat bisphenol A decreases expression ISO Akap8 (Mus musculus) 6480464 bisphenol A results in decreased expression of AKAP8 mRNA CTD PMID:32156529 and PMID:33221593 Akap8 Rat bisphenol F decreases expression ISO Akap8 (Mus musculus) 6480464 bisphenol F results in decreased expression of AKAP8 mRNA CTD PMID:38685157 Akap8 Rat camptothecin increases expression ISO AKAP8 (Homo sapiens) 6480464 Camptothecin results in increased expression of AKAP8 mRNA CTD PMID:33770205 Akap8 Rat carbon nanotube decreases expression ISO Akap8 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Akap8 Rat chlorpyrifos multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in increased expression of AKAP8 mRNA CTD PMID:33854195 Akap8 Rat cisplatin increases phosphorylation ISO Akap8 (Mus musculus) 6480464 Cisplatin results in increased phosphorylation of AKAP8 protein CTD PMID:22006019 Akap8 Rat clofibrate affects expression ISO Akap8 (Mus musculus) 6480464 Clofibrate affects the expression of AKAP8 mRNA CTD PMID:17585979 Akap8 Rat clofibrate decreases expression EXP 6480464 Clofibrate results in decreased expression of AKAP8 mRNA CTD PMID:12851107 Akap8 Rat copper atom increases expression EXP 6480464 Copper results in increased expression of AKAP8 mRNA CTD PMID:30556269 Akap8 Rat copper(0) increases expression EXP 6480464 Copper results in increased expression of AKAP8 mRNA CTD PMID:30556269 Akap8 Rat copper(II) sulfate increases expression ISO AKAP8 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of AKAP8 mRNA CTD PMID:19549813 Akap8 Rat corosolic acid increases expression ISO AKAP8 (Homo sapiens) 6480464 corosolic acid results in increased expression of AKAP8 mRNA CTD PMID:37939859 Akap8 Rat coumarin increases phosphorylation ISO AKAP8 (Homo sapiens) 6480464 coumarin results in increased phosphorylation of AKAP8 protein CTD PMID:35688186 Akap8 Rat crocidolite asbestos decreases expression ISO Akap8 (Mus musculus) 6480464 Asbestos and Crocidolite results in decreased expression of AKAP8 mRNA CTD PMID:29279043 Akap8 Rat cyclophosphamide increases expression EXP 6480464 Cyclophosphamide results in increased expression of AKAP8 mRNA CTD PMID:27281708 Akap8 Rat cyclosporin A increases expression ISO Akap8 (Mus musculus) 6480464 Cyclosporine results in increased expression of AKAP8 mRNA CTD PMID:19770486 Akap8 Rat dextran sulfate increases expression ISO Akap8 (Mus musculus) 6480464 Dextran Sulfate results in increased expression of AKAP8 protein CTD PMID:35362542 Akap8 Rat dextran sulfate multiple interactions ISO Akap8 (Mus musculus) 6480464 evodiamine inhibits the reaction [Dextran Sulfate results in increased expression of AKAP8 protein] CTD PMID:35362542 Akap8 Rat diarsenic trioxide decreases expression ISO Akap8 (Mus musculus) 6480464 Arsenic Trioxide results in decreased expression of AKAP8 mRNA CTD PMID:35676786 Akap8 Rat Dibutyl phosphate affects expression ISO AKAP8 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of AKAP8 mRNA CTD PMID:37042841 Akap8 Rat doxorubicin decreases expression ISO AKAP8 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of AKAP8 mRNA CTD PMID:29803840 Akap8 Rat enzyme inhibitor multiple interactions ISO AKAP8 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of AKAP8 protein CTD PMID:23301498 Akap8 Rat Evodiamine multiple interactions ISO Akap8 (Mus musculus) 6480464 evodiamine inhibits the reaction [Dextran Sulfate results in increased expression of AKAP8 protein] CTD PMID:35362542 Akap8 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of AKAP8 mRNA CTD PMID:24136188 Akap8 Rat FR900359 increases phosphorylation ISO AKAP8 (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of AKAP8 protein CTD PMID:37730182 Akap8 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of AKAP8 mRNA CTD PMID:22061828 Akap8 Rat glyphosate multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in increased expression of AKAP8 mRNA CTD PMID:33854195 Akap8 Rat imidacloprid multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in increased expression of AKAP8 mRNA CTD PMID:33854195 Akap8 Rat lead diacetate increases methylation EXP 6480464 lead acetate results in increased methylation of AKAP8 gene CTD PMID:29571894 Akap8 Rat mono(2-ethylhexyl) phthalate multiple interactions ISO AKAP8 (Homo sapiens) 6480464 [Diethylhexyl Phthalate results in increased abundance of mono-(2-ethylhexyl)phthalate] which results in decreased methylation of AKAP8 gene CTD PMID:33872906 Akap8 Rat N-nitrosodiethylamine increases expression EXP 6480464 Diethylnitrosamine results in increased expression of AKAP8 mRNA CTD PMID:20360939 Akap8 Rat nitrates multiple interactions ISO Akap8 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of AKAP8 mRNA CTD PMID:35964746 Akap8 Rat paracetamol affects expression ISO Akap8 (Mus musculus) 6480464 Acetaminophen affects the expression of AKAP8 mRNA CTD PMID:17562736 Akap8 Rat phenobarbital increases expression ISO Akap8 (Mus musculus) 6480464 Phenobarbital results in increased expression of AKAP8 mRNA CTD PMID:31836555 Akap8 Rat picoxystrobin decreases expression ISO AKAP8 (Homo sapiens) 6480464 picoxystrobin results in decreased expression of AKAP8 mRNA CTD PMID:33512557 Akap8 Rat pirinixic acid increases expression ISO Akap8 (Mus musculus) 6480464 pirinixic acid results in increased expression of AKAP8 mRNA CTD PMID:12727805 Akap8 Rat progesterone decreases expression ISO AKAP8 (Homo sapiens) 6480464 Progesterone results in decreased expression of AKAP8 mRNA CTD PMID:18037150 Akap8 Rat resveratrol decreases expression ISO Akap8 (Mus musculus) 6480464 resveratrol results in decreased expression of AKAP8 protein CTD PMID:25505154 Akap8 Rat resveratrol multiple interactions ISO AKAP8 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of AKAP8 mRNA CTD PMID:23557933 Akap8 Rat rotenone decreases expression ISO AKAP8 (Homo sapiens) 6480464 Rotenone results in decreased expression of AKAP8 mRNA CTD PMID:33512557 Akap8 Rat silicon dioxide increases expression ISO AKAP8 (Homo sapiens) 6480464 Silicon Dioxide results in increased expression of AKAP8 mRNA CTD PMID:25351596 Akap8 Rat tamoxifen affects expression ISO Akap8 (Mus musculus) 6480464 Tamoxifen affects the expression of AKAP8 mRNA CTD PMID:17555576 Akap8 Rat temozolomide increases expression ISO AKAP8 (Homo sapiens) 6480464 Temozolomide results in increased expression of AKAP8 mRNA CTD PMID:31758290 Akap8 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of AKAP8 mRNA CTD PMID:31150632 Akap8 Rat tetraphene increases expression ISO Akap8 (Mus musculus) 6480464 benz(a)anthracene results in increased expression of AKAP8 mRNA CTD PMID:26377693 Akap8 Rat thiabendazole multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in increased expression of AKAP8 mRNA CTD PMID:33854195 Akap8 Rat titanium dioxide decreases methylation ISO Akap8 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of AKAP8 gene CTD PMID:35295148 Akap8 Rat titanium dioxide increases methylation ISO Akap8 (Mus musculus) 6480464 titanium dioxide results in increased methylation of AKAP8 gene CTD PMID:35295148 Akap8 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of AKAP8 mRNA CTD PMID:33387578 Akap8 Rat trichostatin A decreases expression ISO AKAP8 (Homo sapiens) 6480464 trichostatin A results in decreased expression of AKAP8 mRNA CTD PMID:24935251 and PMID:28542535 Akap8 Rat tunicamycin increases expression ISO AKAP8 (Homo sapiens) 6480464 Tunicamycin results in increased expression of AKAP8 mRNA CTD PMID:33770205 Akap8 Rat valproic acid affects expression ISO AKAP8 (Homo sapiens) 6480464 Valproic Acid affects the expression of AKAP8 mRNA CTD PMID:25979313 Akap8 Rat valproic acid decreases expression ISO AKAP8 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of AKAP8 mRNA CTD PMID:22083351 Akap8 Rat vorinostat decreases expression ISO AKAP8 (Homo sapiens) 6480464 vorinostat results in decreased expression of AKAP8 mRNA CTD PMID:22083351
1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP) 2,4-dinitrotoluene (EXP) 2,6-dinitrotoluene (EXP) 2-palmitoylglycerol (ISO) 3,3',4,4'-tetrachlorobiphenyl (ISO) 3H-1,2-dithiole-3-thione (EXP) aflatoxin B1 (ISO) ammonium chloride (EXP) Aroclor 1254 (ISO) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) azoxystrobin (EXP,ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) camptothecin (ISO) carbon nanotube (ISO) chlorpyrifos (EXP) cisplatin (ISO) clofibrate (EXP,ISO) copper atom (EXP) copper(0) (EXP) copper(II) sulfate (ISO) corosolic acid (ISO) coumarin (ISO) crocidolite asbestos (ISO) cyclophosphamide (EXP) cyclosporin A (ISO) dextran sulfate (ISO) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) doxorubicin (ISO) enzyme inhibitor (ISO) Evodiamine (ISO) flutamide (EXP) FR900359 (ISO) gentamycin (EXP) glyphosate (EXP) imidacloprid (EXP) lead diacetate (EXP) mono(2-ethylhexyl) phthalate (ISO) N-nitrosodiethylamine (EXP) nitrates (ISO) paracetamol (ISO) phenobarbital (ISO) picoxystrobin (ISO) pirinixic acid (ISO) progesterone (ISO) resveratrol (ISO) rotenone (ISO) silicon dioxide (ISO) tamoxifen (ISO) temozolomide (ISO) tetrachloromethane (EXP) tetraphene (ISO) thiabendazole (EXP) titanium dioxide (ISO) trichloroethene (EXP) trichostatin A (ISO) tunicamycin (ISO) valproic acid (ISO) vorinostat (ISO)
1.
A-kinase-anchoring protein AKAP95 is targeted to the nuclear matrix and associates with p68 RNA helicase.
Akileswaran L, etal., J Biol Chem. 2001 May 18;276(20):17448-54. Epub 2001 Feb 22.
2.
A-kinase anchoring proteins: from protein complexes to physiology and disease.
Carnegie GK, etal., IUBMB Life. 2009 Apr;61(4):394-406.
3.
Cloning and characterization of AKAP 95, a nuclear protein that associates with the regulatory subunit of type II cAMP-dependent protein kinase.
Coghlan VM, etal., J Biol Chem 1994 Mar 11;269(10):7658-65.
4.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
6.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
7.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.
GOA pipeline
RGD automated data pipeline
9.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
11.
Localized effects of cAMP mediated by distinct routes of protein kinase A.
Tasken K and Aandahl EM, Physiol Rev. 2004 Jan;84(1):137-67.
Akap8 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 11,966,769 - 11,983,056 (-) NCBI GRCr8 mRatBN7.2 7 11,316,224 - 11,332,523 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 11,316,228 - 11,332,399 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 14,134,699 - 14,150,843 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 16,012,121 - 16,028,265 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 13,883,649 - 13,899,780 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 14,323,298 - 14,339,953 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 14,324,104 - 14,351,918 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 14,477,683 - 14,493,949 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 12,873,303 - 12,889,333 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 12,873,301 - 12,889,308 (-) NCBI Celera 7 9,427,350 - 9,443,479 (-) NCBI Celera Cytogenetic Map 7 q11 NCBI
AKAP8 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 19 15,353,385 - 15,379,787 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 19 15,353,385 - 15,379,815 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 19 15,464,196 - 15,490,598 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 19 15,325,335 - 15,351,603 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 19 15,325,335 - 15,351,603 NCBI Celera 19 15,359,984 - 15,386,240 (-) NCBI Celera Cytogenetic Map 19 p13.12 NCBI HuRef 19 15,032,304 - 15,058,582 (-) NCBI HuRef CHM1_1 19 15,463,860 - 15,490,252 (-) NCBI CHM1_1 T2T-CHM13v2.0 19 15,478,331 - 15,504,764 (-) NCBI T2T-CHM13v2.0
Akap8 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 17 32,522,646 - 32,540,212 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 17 32,522,646 - 32,540,212 (-) Ensembl GRCm39 Ensembl GRCm38 17 32,303,672 - 32,321,238 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 17 32,303,672 - 32,321,238 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 17 32,440,621 - 32,458,098 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 17 32,035,284 - 32,052,761 (-) NCBI MGSCv36 mm8 Celera 17 33,224,515 - 33,241,992 (-) NCBI Celera Cytogenetic Map 17 B1 NCBI cM Map 17 17.48 NCBI
Akap8 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955495 7,874,746 - 7,892,944 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955495 7,874,655 - 7,893,209 (+) NCBI ChiLan1.0 ChiLan1.0
AKAP8 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 20 20,269,069 - 20,293,662 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 19 19,271,846 - 19,296,405 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 19 14,888,201 - 14,912,739 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 19 15,872,536 - 15,897,661 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 19 15,872,536 - 15,897,661 (-) Ensembl panpan1.1 panPan2
AKAP8 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 20 46,800,917 - 46,817,397 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 20 46,800,872 - 46,817,397 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 20 46,648,485 - 46,664,965 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 20 47,287,578 - 47,304,050 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 20 47,287,529 - 47,305,307 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 20 46,522,426 - 46,538,895 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 20 46,939,069 - 46,955,544 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 20 47,212,596 - 47,229,069 (+) NCBI UU_Cfam_GSD_1.0
Akap8 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 205,574,820 - 205,593,183 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936596 5,124,083 - 5,142,027 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936596 5,123,988 - 5,142,326 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
AKAP8 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 62,222,249 - 62,241,611 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 62,222,060 - 62,241,631 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 61,797,360 - 61,817,852 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
AKAP8
Akap8
.
Predicted Target Of
Count of predictions: 425 Count of miRNA genes: 236 Interacting mature miRNAs: 283 Transcripts: ENSRNOT00000008827 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
61410 Bw19 Body weight QTL 19 6.2 0.001 body mass (VT:0001259) body weight (CMO:0000012) 7 1 44782185 Rat 1300176 Hrtrt10 Heart rate QTL 10 3.19 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 7 664270 26029351 Rat 9590102 Sffal5 Serum free fatty acids level QTL 5 8.62 0.001 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 7 5329019 50329019 Rat 1578652 Bmd15 Bone mineral density QTL 15 5.2 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 7 9866467 60460686 Rat 1643004 Pain2 Pain QTL 2 1 mechanical nociception trait (VT:0002734) self mutilation severity score (CMO:0002145) 7 9462246 98011544 Rat 631503 Bp102 Blood pressure QTL 102 1.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 1 44822433 Rat 634336 Anxrr17 Anxiety related response QTL 17 3.66 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 924703 115097879 Rat 10755438 Coatc9 Coat color QTL 9 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 3529280 48529280 Rat 9590142 Scort5 Serum corticosterone level QTL 5 24.4 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 7 1 31962314 Rat 2298547 Neuinf5 Neuroinflammation QTL 5 3.7 nervous system integrity trait (VT:0010566) spinal cord Cd74 protein level (CMO:0002131) 7 9462246 58265113 Rat 10059592 Kidm45 Kidney mass QTL 45 3.95 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 7 7573985 52573985 Rat 2317047 Wbc4 White blood cell count QTL 4 0.01 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 7 1 35342956 Rat 10755440 Coatc10 Coat color QTL 10 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 7496499 52496499 Rat 2298550 Neuinf6 Neuroinflammation QTL 6 3.3 nervous system integrity trait (VT:0010566) spinal cord RT1-B protein level (CMO:0002132) 7 1 27829089 Rat 724560 Plsm3 Polydactyly-luxate syndrome (PLS) morphotypes QTL 3 0.0003 tibia length (VT:0004357) tibia length (CMO:0000450) 7 1 34000259 Rat 7411566 Bw136 Body weight QTL 136 10.4 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 7 1 31962314 Rat
RH133817
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 11,332,819 - 11,333,001 (+) MAPPER mRatBN7.2 Rnor_6.0 7 14,340,317 - 14,340,498 NCBI Rnor6.0 Rnor_5.0 7 14,494,413 - 14,494,594 UniSTS Rnor5.0 RGSC_v3.4 7 12,889,797 - 12,889,978 UniSTS RGSC3.4 Celera 7 9,443,943 - 9,444,124 UniSTS Cytogenetic Map 7 q11 UniSTS
RH124529
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 11,317,380 - 11,317,591 (+) MAPPER mRatBN7.2 Rnor_6.0 7 14,324,455 - 14,324,665 NCBI Rnor6.0 Rnor_5.0 7 14,478,840 - 14,479,050 UniSTS Rnor5.0 RGSC_v3.4 7 12,874,458 - 12,874,668 UniSTS RGSC3.4 Celera 7 9,428,505 - 9,428,715 UniSTS Cytogenetic Map 7 q11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000008827 ⟹ ENSRNOP00000008827
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 11,316,228 - 11,332,399 (-) Ensembl Rnor_6.0 Ensembl 7 14,324,104 - 14,351,918 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000109363 ⟹ ENSRNOP00000088920
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 11,316,228 - 11,332,373 (-) Ensembl
RefSeq Acc Id:
NM_053855 ⟹ NP_446307
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 11,966,771 - 11,982,900 (-) NCBI mRatBN7.2 7 11,316,226 - 11,332,356 (-) NCBI Rnor_6.0 7 14,323,300 - 14,339,853 (-) NCBI Rnor_5.0 7 14,477,683 - 14,493,949 (-) NCBI RGSC_v3.4 7 12,873,303 - 12,889,333 (-) RGD Celera 7 9,427,350 - 9,443,479 (-) RGD
Sequence:
GCTGCTGGCGGGTCGTGTCGAAGACATGGAGCAAAGCTACGGAGGTTATGGGGCATGGAGTGCTGGACCTGCCAACACCCAGGGTACATATGGAAGTGGTGTGGCCAGCTGGCAAGGTTATGAAAACT
hide sequence
RefSeq Acc Id:
XM_006241047 ⟹ XP_006241109
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 11,966,769 - 11,982,621 (-) NCBI mRatBN7.2 7 11,316,224 - 11,332,085 (-) NCBI Rnor_6.0 7 14,323,298 - 14,339,565 (-) NCBI Rnor_5.0 7 14,477,683 - 14,493,949 (-) NCBI
Sequence:
TGCGCCTTGGGCCGCTTTCACCGTGCAGGTCCAGTGGCTCTCACTGCGGCGGGGACCCTAGGACTTGGGCTGTCTCAGTCCCGCCTTATCTTCTGAAGACGCCACAAAATGGCGGCCCCAGGGGTGGG
hide sequence
RefSeq Acc Id:
XM_017594573 ⟹ XP_017450062
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 11,966,769 - 11,982,958 (-) NCBI mRatBN7.2 7 11,316,224 - 11,332,437 (-) NCBI Rnor_6.0 7 14,323,298 - 14,339,953 (-) NCBI
Sequence:
AACCAATAGTAGCGCCCAGAAGGAGAGACGTACGCTCTTCGTCTTCCAGTAGCAGACGGCACGT
hide sequence
RefSeq Acc Id:
XM_039078250 ⟹ XP_038934178
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 11,975,168 - 11,983,056 (-) NCBI mRatBN7.2 7 11,324,623 - 11,332,523 (-) NCBI
RefSeq Acc Id:
NP_446307 ⟸ NM_053855
- UniProtKB:
Q63014 (UniProtKB/Swiss-Prot), B2GV93 (UniProtKB/TrEMBL), A0A8I6AAG3 (UniProtKB/TrEMBL)
- Sequence:
MEQSYGGYGAWSAGPANTQGTYGSGVASWQGYENYSYYNAQNTSVPTGTPYSYGPASWEATKASDGGLAAGSSAMHVASFAPEPCTDNSDSLIAKINQRLDMLSKEGGRGGISSGGEGMQDRDSSFRF
hide sequence
RefSeq Acc Id:
XP_006241109 ⟸ XM_006241047
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6AAG3 (UniProtKB/TrEMBL)
- Sequence:
MHVASFAPEPCTDNSDSLIAKINQRLDMLSKEGGRGGISSGGEGMQDRDSSFRFQPYESYDSRP
hide sequence
RefSeq Acc Id:
XP_017450062 ⟸ XM_017594573
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I6AAG3 (UniProtKB/TrEMBL)
- Sequence:
MECWTCQHPGSFRFQPYESYDSRPCMPEHTPYRPSYSYDYDFDLGTDRNGSFGGTFNDCRDPTP
hide sequence
Ensembl Acc Id:
ENSRNOP00000008827 ⟸ ENSRNOT00000008827
RefSeq Acc Id:
XP_038934178 ⟸ XM_039078250
- Peptide Label:
isoform X3
Ensembl Acc Id:
ENSRNOP00000088920 ⟸ ENSRNOT00000109363
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-11-25
Akap8
A-kinase anchoring protein 8
Akap8
A kinase (PRKA) anchor protein 8
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-09-10
Akap8
A kinase (PRKA) anchor protein 8
A kinase anchor protein 8
Name updated
1299863 APPROVED
2002-08-07
Akap8
A kinase anchor protein 8
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_function
anchoring protein that mediates the subcellular compartmentation of cAMP-dependent protein kinase (pka type II)
724707
