Symbol:
Doc2a
Name:
double C2 domain alpha
RGD ID:
620518
Description:
Predicted to enable calcium-dependent phospholipid binding activity and metal ion binding activity. Involved in calcium-dependent activation of synaptic vesicle fusion. Located in lysosome. Is active in glutamatergic synapse. Is extrinsic component of synaptic vesicle membrane. Orthologous to human DOC2A (double C2 domain alpha); INTERACTS WITH (+)-schisandrin B; 1-naphthyl isothiocyanate; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
doc2-alpha; double C2, alpha; double C2-like domain-containing protein alpha; double C2-like domains, alpha
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
DOC2A (double C2 domain alpha) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Doc2a (double C2, alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Doc2a (double C2 domain alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
DOC2A (double C2 domain alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
DOC2A (double C2 domain alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Doc2a (double C2 domain alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
DOC2A (double C2 domain alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
DOC2A (double C2 domain alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Doc2a (double C2 domain alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
DOC2B (double C2 domain beta) HGNC
OrthoDB
Homo sapiens (human):
ITK (IL2 inducible T cell kinase) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
DOC2A (double C2 domain alpha)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Doc2a (double C2, alpha)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
doc2a (double C2-like domains, alpha)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Rph
Alliance
DIOPT (Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
rbf-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 190,887,306 - 190,893,057 (+) NCBI GRCr8 mRatBN7.2 1 181,457,415 - 181,462,528 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 181,458,390 - 181,462,030 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 189,809,758 - 189,813,398 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 196,995,831 - 196,999,471 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 189,663,042 - 189,666,682 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 198,282,828 - 198,288,611 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 198,284,473 - 198,288,113 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 205,263,516 - 205,268,791 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 186,027,821 - 186,031,461 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 186,177,701 - 186,181,341 (+) NCBI Celera 1 179,113,629 - 179,117,269 (+) NCBI Celera Cytogenetic Map 1 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Doc2a Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of DOC2A mRNA] CTD PMID:31150632 Doc2a Rat 1,2-dimethylhydrazine decreases expression ISO RGD:731424 6480464 1,2-Dimethylhydrazine results in decreased expression of DOC2A mRNA CTD PMID:22206623 Doc2a Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of DOC2A mRNA CTD PMID:30723492 Doc2a Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:731424 6480464 Tetrachlorodibenzodioxin affects the expression of DOC2A mRNA CTD PMID:21570461 Doc2a Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:731424 6480464 Tetrachlorodibenzodioxin results in increased expression of DOC2A mRNA CTD PMID:33956508 Doc2a Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of DOC2A mRNA CTD PMID:32109520 Doc2a Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2,3,7,8-tetrachlorodibenzofuran results in decreased expression of DOC2A mRNA CTD PMID:32109520 Doc2a Rat 2-palmitoylglycerol increases expression ISO RGD:731423 6480464 2-palmitoylglycerol results in increased expression of DOC2A mRNA CTD PMID:37199045 Doc2a Rat 3,4-methylenedioxymethamphetamine increases expression ISO RGD:731424 6480464 N-Methyl-3,4-methylenedioxyamphetamine results in increased expression of DOC2A mRNA CTD PMID:20188158 Doc2a Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of DOC2A mRNA CTD PMID:24780913|PMID:30047161 Doc2a Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of DOC2A mRNA CTD PMID:31881176 Doc2a Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of DOC2A mRNA CTD PMID:28959563 Doc2a Rat aflatoxin B1 decreases methylation ISO RGD:731423 6480464 Aflatoxin B1 results in decreased methylation of DOC2A exon CTD PMID:30157460 Doc2a Rat Aflatoxin B2 alpha decreases methylation ISO RGD:731423 6480464 aflatoxin B2 results in decreased methylation of DOC2A exon; aflatoxin B2 results in decreased methylation more ... CTD PMID:30157460 Doc2a Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of DOC2A mRNA CTD PMID:30047161 Doc2a Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of DOC2A mRNA CTD PMID:16483693 Doc2a Rat atrazine increases expression ISO RGD:731423 6480464 Atrazine results in increased expression of DOC2A mRNA CTD PMID:22378314 Doc2a Rat benzo[a]pyrene affects methylation ISO RGD:731423 6480464 Benzo(a)pyrene affects the methylation of DOC2A exon; Benzo(a)pyrene affects the methylation of DOC2A intron CTD PMID:30157460 Doc2a Rat benzo[a]pyrene decreases methylation ISO RGD:731423 6480464 Benzo(a)pyrene results in decreased methylation of DOC2A promoter CTD PMID:27901495 Doc2a Rat benzo[e]pyrene decreases methylation ISO RGD:731423 6480464 benzo(e)pyrene results in decreased methylation of DOC2A exon CTD PMID:30157460 Doc2a Rat bis(2-ethylhexyl) phthalate multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone more ... CTD PMID:25607892 Doc2a Rat bis(2-ethylhexyl) phthalate decreases expression ISO RGD:731423 6480464 Diethylhexyl Phthalate results in decreased expression of DOC2A mRNA CTD PMID:31163220 Doc2a Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of DOC2A mRNA CTD PMID:25181051 Doc2a Rat bisphenol A increases expression ISO RGD:731423 6480464 bisphenol A results in increased expression of DOC2A mRNA CTD PMID:33670352 Doc2a Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of DOC2A mRNA CTD PMID:34947998|PMID:36779543 Doc2a Rat bisphenol F decreases expression ISO RGD:731424 6480464 bisphenol F results in decreased expression of DOC2A mRNA CTD PMID:38685157 Doc2a Rat cyclosporin A decreases methylation ISO RGD:731423 6480464 Cyclosporine results in decreased methylation of DOC2A promoter CTD PMID:27989131 Doc2a Rat DDE multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone more ... CTD PMID:25607892 Doc2a Rat dibutyl phthalate multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone more ... CTD PMID:25607892 Doc2a Rat dicrotophos decreases expression ISO RGD:731423 6480464 dicrotophos results in decreased expression of DOC2A mRNA CTD PMID:28302478 Doc2a Rat dorsomorphin multiple interactions ISO RGD:731423 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Doc2a Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of DOC2A mRNA CTD PMID:29391264 Doc2a Rat entinostat multiple interactions ISO RGD:731423 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Doc2a Rat epoxiconazole multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone more ... CTD PMID:25607892 Doc2a Rat ethylparaben decreases expression ISO RGD:731423 6480464 ethyl-p-hydroxybenzoate results in decreased expression of DOC2A mRNA CTD PMID:37690743 Doc2a Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of DOC2A mRNA CTD PMID:33387578 Doc2a Rat glyphosate increases expression EXP 6480464 Glyphosate results in increased expression of DOC2A mRNA CTD PMID:38314887 Doc2a Rat graphite affects expression EXP 6480464 Graphite affects the expression of DOC2A mRNA CTD PMID:29933104 Doc2a Rat linuron multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone more ... CTD PMID:25607892 Doc2a Rat manganese(II) chloride increases expression EXP 6480464 manganese chloride results in increased expression of DOC2A mRNA CTD PMID:28801915 Doc2a Rat methapyrilene decreases methylation ISO RGD:731423 6480464 Methapyrilene results in decreased methylation of DOC2A exon CTD PMID:30157460 Doc2a Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of DOC2A mRNA CTD PMID:30047161 Doc2a Rat methotrexate affects expression ISO RGD:731424 6480464 Methotrexate affects the expression of DOC2A mRNA CTD PMID:18502557 Doc2a Rat N-methyl-4-phenylpyridinium increases expression EXP 6480464 1-Methyl-4-phenylpyridinium results in increased expression of DOC2A mRNA CTD PMID:28801915 Doc2a Rat perfluorohexanesulfonic acid increases expression ISO RGD:731424 6480464 perfluorohexanesulfonic acid results in increased expression of DOC2A mRNA CTD PMID:37995155 Doc2a Rat prochloraz multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone more ... CTD PMID:25607892 Doc2a Rat procymidone multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone more ... CTD PMID:25607892 Doc2a Rat resveratrol multiple interactions ISO RGD:731423 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of DOC2A mRNA CTD PMID:23557933 Doc2a Rat SB 431542 multiple interactions ISO RGD:731423 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Doc2a Rat silver atom decreases expression ISO RGD:731424 6480464 Silver results in decreased expression of DOC2A mRNA CTD PMID:27131904 Doc2a Rat silver(0) decreases expression ISO RGD:731424 6480464 Silver results in decreased expression of DOC2A mRNA CTD PMID:27131904 Doc2a Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of DOC2A mRNA CTD PMID:30047161 Doc2a Rat tacrolimus hydrate decreases expression ISO RGD:731424 6480464 Tacrolimus results in decreased expression of DOC2A mRNA CTD PMID:25270620 Doc2a Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of DOC2A mRNA CTD PMID:31150632 Doc2a Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of DOC2A mRNA] CTD PMID:31150632 Doc2a Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of DOC2A mRNA CTD PMID:23411599|PMID:34492290 Doc2a Rat titanium dioxide increases expression EXP 6480464 titanium dioxide results in increased expression of DOC2A mRNA CTD PMID:30012374 Doc2a Rat titanium dioxide decreases methylation ISO RGD:731424 6480464 titanium dioxide results in decreased methylation of DOC2A gene CTD PMID:35295148 Doc2a Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of DOC2A mRNA CTD PMID:33387578 Doc2a Rat valproic acid affects expression ISO RGD:731423 6480464 Valproic Acid affects the expression of DOC2A mRNA CTD PMID:25979313 Doc2a Rat vinclozolin multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone more ... CTD PMID:25607892
(+)-schisandrin B (EXP) 1,2-dimethylhydrazine (ISO) 1-naphthyl isothiocyanate (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2-palmitoylglycerol (ISO) 3,4-methylenedioxymethamphetamine (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) acrylamide (EXP) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) amitrole (EXP) ammonium chloride (EXP) atrazine (ISO) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) cyclosporin A (ISO) DDE (EXP) dibutyl phthalate (EXP) dicrotophos (ISO) dorsomorphin (ISO) endosulfan (EXP) entinostat (ISO) epoxiconazole (EXP) ethylparaben (ISO) gentamycin (EXP) glyphosate (EXP) graphite (EXP) linuron (EXP) manganese(II) chloride (EXP) methapyrilene (ISO) methimazole (EXP) methotrexate (ISO) N-methyl-4-phenylpyridinium (EXP) perfluorohexanesulfonic acid (ISO) prochloraz (EXP) procymidone (EXP) resveratrol (ISO) SB 431542 (ISO) silver atom (ISO) silver(0) (ISO) sulfadimethoxine (EXP) tacrolimus hydrate (ISO) tetrachloromethane (EXP) thioacetamide (EXP) titanium dioxide (EXP,ISO) trichloroethene (EXP) valproic acid (ISO) vinclozolin (EXP)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
3.
Doc2 alpha and Munc13-4 regulate Ca(2+) -dependent secretory lysosome exocytosis in mast cells.
Higashio H, etal., J Immunol. 2008 Apr 1;180(7):4774-84.
4.
Different spatiotemporal expression of DOC2 genes in the developing rat brain argues for an additional, nonsynaptic role of DOC2B in early development.
Korteweg N, etal., Eur J Neurosci 2000 Jan;12(1):165-71.
5.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
6.
Molecular cloning of mouse Doc2alpha and distribution of its mRNA in adult mouse brain.
Naito A, etal., Brain Res Mol Brain Res 1997 Mar;44(2):198-204.
7.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.
GOA pipeline
RGD automated data pipeline
9.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
11.
DOC2 proteins in rat brain: complementary distribution and proposed function as vesicular adapter proteins in early stages of secretion.
Verhage M, etal., Neuron 1997 Mar;18(3):453-61.
12.
Doc2 is a Ca2+ sensor required for asynchronous neurotransmitter release.
Yao J, etal., Cell. 2011 Oct 28;147(3):666-77. doi: 10.1016/j.cell.2011.09.046.
Doc2a Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 190,887,306 - 190,893,057 (+) NCBI GRCr8 mRatBN7.2 1 181,457,415 - 181,462,528 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 181,458,390 - 181,462,030 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 189,809,758 - 189,813,398 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 196,995,831 - 196,999,471 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 189,663,042 - 189,666,682 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 198,282,828 - 198,288,611 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 198,284,473 - 198,288,113 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 205,263,516 - 205,268,791 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 186,027,821 - 186,031,461 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 186,177,701 - 186,181,341 (+) NCBI Celera 1 179,113,629 - 179,117,269 (+) NCBI Celera Cytogenetic Map 1 q36 NCBI
DOC2A Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 16 30,005,514 - 30,023,228 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 16 30,005,514 - 30,023,270 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 16 30,016,835 - 30,024,917 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 16 29,924,336 - 29,929,902 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 16 29,924,335 - 29,929,902 NCBI Celera 16 72,773,320 - 72,778,886 (+) NCBI Celera Cytogenetic Map 16 p11.2 NCBI HuRef 16 27,677,850 - 27,683,416 (-) NCBI HuRef CHM1_1 16 31,232,624 - 31,238,190 (-) NCBI CHM1_1 T2T-CHM13v2.0 16 30,288,154 - 30,305,880 (-) NCBI T2T-CHM13v2.0
Doc2a Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 126,446,525 - 126,451,877 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 126,446,588 - 126,451,877 (+) Ensembl GRCm39 Ensembl GRCm38 7 126,846,983 - 126,852,705 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 126,847,416 - 126,852,705 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 133,991,067 - 133,996,219 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 126,638,701 - 126,643,853 (+) NCBI MGSCv36 mm8 Celera 7 126,695,691 - 126,700,843 (+) NCBI Celera Cytogenetic Map 7 F3 NCBI cM Map 7 69.25 NCBI
Doc2a Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955493 6,947,512 - 6,953,835 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955493 6,948,089 - 6,953,835 (+) NCBI ChiLan1.0 ChiLan1.0
DOC2A Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 18 30,755,311 - 30,762,196 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 16 35,463,559 - 35,470,605 (+) NCBI NHGRI_mPanPan1 PanPan1.1 16 30,378,922 - 30,385,982 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 16 30,378,922 - 30,384,142 (-) Ensembl panpan1.1 panPan2
DOC2A Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 6 18,041,551 - 18,046,779 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 6 18,041,296 - 18,046,265 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 6 19,618,518 - 19,623,772 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 6 18,175,690 - 18,180,937 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 6 18,175,456 - 18,181,065 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 6 17,974,905 - 17,980,142 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 6 17,890,274 - 17,895,521 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 6 18,205,875 - 18,211,122 (-) NCBI UU_Cfam_GSD_1.0
Doc2a Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409344 124,359,243 - 124,365,997 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936501 12,458,482 - 12,463,199 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936501 12,458,537 - 12,463,857 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
DOC2A
DOC2A Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 5 26,649,818 - 26,656,755 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 5 26,651,949 - 26,656,075 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666068 2,876,676 - 2,883,649 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Doc2a
.
Predicted Target Of
Count of predictions: 56 Count of miRNA genes: 47 Interacting mature miRNAs: 56 Transcripts: ENSRNOT00000027022 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1578778 Pur4 Proteinuria QTL 4 3.3 0.003 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 1 150700247 252085048 Rat 1354646 Kidm18 Kidney mass QTL 18 5.7 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 256448636 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 1354652 Kidm20 Kidney mass QTL 20 4.3 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 177227632 256448636 Rat 2302378 Insul11 Insulin level QTL 11 3.25 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 1 144267353 251128347 Rat 1354653 Despr9 Despair related QTL 9 0.00019 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 167909849 212909849 Rat 1578770 Stresp23 Stress response QTL 23 kidney sympathetic nerve activity (VT:0004050) stimulated renal sympathetic nerve activity to basal renal sympathetic nerve activity ratio (CMO:0001786) 1 123350408 182418476 Rat 2293673 Bss27 Bone structure and strength QTL 27 18.63 0.0001 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 1 171629477 216629477 Rat 61326 Eae6 Experimental allergic encephalomyelitis QTL 6 5.3 body mass (VT:0001259) change in body weight (CMO:0002045) 1 172949660 181830018 Rat 2293677 Bss41 Bone structure and strength QTL 41 9.38 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 1 171629477 216629477 Rat 1302787 Stl25 Serum triglyceride level QTL 25 2.7 0.0073 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 1 180359209 210702199 Rat 70160 Bw18 Body weight QTL 18 5.7 body mass (VT:0001259) body weight (CMO:0000012) 1 144267353 196383668 Rat 1549830 Bss1 Bone structure and strength QTL 1 4.8 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 1 172609619 217609619 Rat 7794788 Mcs32 Mammary carcinoma susceptibility QTL 32 2.61 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 1 115540693 238914717 Rat 70163 Bw20 Body weight QTL 20 5.1 body mass (VT:0001259) body weight (CMO:0000012) 1 174133260 219133260 Rat 1578763 Kidm29 Kidney mass QTL 29 3.3 0.0001 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 1 179567751 260522016 Rat 1354624 Cm35 Cardiac mass QTL35 5.7 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 177227632 256448636 Rat 1558658 Bw59 Body weight QTL 59 3.5 0.0003 body mass (VT:0001259) body weight (CMO:0000012) 1 178784622 223784622 Rat 1354636 Lmblg1 Limb length QTL 1 6.4 tibia length (VT:0004357) tibia length (CMO:0000450) 1 151162512 201278233 Rat 1549837 Hcar15 Hepatocarcinoma resistance QTL 15 0.05 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 153136852 260522016 Rat 2293689 Bss47 Bone structure and strength QTL 47 7.25 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra trabecular cross-sectional area (CMO:0001692) 1 171629477 216629477 Rat 152025235 Bw194 Body weight QTL 194 4.86 body mass (VT:0001259) 1 123556856 242907031 Rat 1598853 Memor3 Memory QTL 3 4.5 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 1 143506580 212458660 Rat 61341 Bp26 Blood pressure QTL 26 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 169537671 214537671 Rat 1354634 Kidm12 Kidney mass QTL 12 3.9 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 1 151162512 201278233 Rat 4889428 Stresp24 Stress response QTL 24 0.05 heart pumping trait (VT:2000009) absolute change in electrocardiographic low frequency R-R spectral component to high frequency R-R spectral component ratio (CMO:0002162) 1 155866514 200866514 Rat 152025232 Bw192 Body weight QTL 192 3.93 body mass (VT:0001259) 1 117917486 196963478 Rat 1578759 Uae30 Urinary albumin excretion QTL 30 3.3 0.003 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 150700247 252085048 Rat 61343 Bp28 Blood pressure QTL 28 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 151646613 196646613 Rat 2293693 Bss22 Bone structure and strength QTL 22 33.52 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 1 171629477 216629477 Rat 2300161 Bmd43 Bone mineral density QTL 43 8.4 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 171629477 216629477 Rat 61347 Bp197 Blood pressure QTL 197 4.2 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 1 158633083 203633083 Rat 61348 Bp30 Blood pressure QTL 30 2.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 144017057 197814409 Rat 8655649 Arrd1 Age-related retinal degeneration QTL 1 4.89 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 100357752 183970443 Rat 2303622 Vencon6 Ventilatory control QTL 6 0.001 respiration trait (VT:0001943) respiration rate (CMO:0000289) 1 154561505 199561505 Rat 631214 Bw61 Body weight QTL61 3.4 0.0001 intramuscular adipose amount (VT:0010044) intramuscular fat area (CMO:0001162) 1 173108781 218108781 Rat 7771612 Cm80 Cardiac mass QTL 80 8.4 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 1 149448574 221264292 Rat 731168 Bp154 Blood pressure QTL 154 3.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94642644 214537671 Rat 631205 Bp196 Blood pressure QTL 196 4 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118944897 199050459 Rat 1300158 Bp173 Blood pressure QTL 173 3.48 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 1 115540693 185145286 Rat 2300174 Bmd42 Bone mineral density QTL 42 8.4 0.0001 lumbar vertebra mineral mass (VT:0010511) bone mineral density (CMO:0001226) 1 171629477 216629477 Rat 737828 Hcas3 Hepatocarcinoma susceptibility QTL 3 4.9 liver integrity trait (VT:0010547) liver tumorous lesion volume to total liver volume ratio (CMO:0001082) 1 144267353 222987745 Rat 1331749 Hrtrt11 Heart rate QTL 11 2.973 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 94494440 198211706 Rat 1354661 Bw33 Body weight QTL 33 5.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1358886 Bp260 Blood pressure QTL 260 3.67 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 151162766 225824951 Rat 737977 Bp160 Blood pressure QTL 160 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 181133855 226133855 Rat 1331751 Bp199 Blood pressure QTL 199 3.60022 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 94494440 181830018 Rat 2293654 Bss30 Bone structure and strength QTL 30 32.65 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 1 171629477 216629477 Rat 724531 Uae5 Urinary albumin excretion QTL 5 4 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 1 150700142 252085212 Rat 2300187 Bmd41 Bone mineral density QTL 41 8.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 171629477 216629477 Rat 1641895 Bp298 Blood pressure QTL 298 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 123350408 182418476 Rat 70209 Niddm23 Non-insulin dependent diabetes mellitus QTL 23 2.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 94494440 198324465 Rat 1354580 Scort1 Serum corticosterone level QTL 1 3.4 blood corticosterone amount (VT:0005345) blood corticosterone level (CMO:0001172) 1 156677124 256448636 Rat 1358294 Bw37 Body weight QTL 37 5 0.000011 body mass (VT:0001259) body weight (CMO:0000012) 1 171310381 216310381 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 2312420 Pur17 Proteinuria QTL 17 7.1 0.0001 urine protein amount (VT:0005160) urine total protein excretion rate (CMO:0000756) 1 156677124 218753816 Rat 10059600 Bp378 Blood pressure QTL 378 3.08 0.05 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 176869060 221869060 Rat 1354591 Cm36 Cardiac mass QTL 36 4.1 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 102813953 201278233 Rat 724550 Thym3 Thymus enlargement QTL 3 7.82 0.001 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 1 136829932 181829932 Rat 2312558 Glom17 Glomerulus QTL 17 3.9 0.001 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 1 166532971 191278129 Rat 7421630 Bp362 Blood pressure QTL 362 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118608292 241799120 Rat 71118 Thym1 Thymus enlargement QTL 1 10.17 0.001 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 1 136829932 181829932 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 619613 Bp77 Blood pressure QTL 77 0.01 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 164747424 209747424 Rat 631519 Pia11 Pristane induced arthritis QTL 11 5.3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 1 136830018 181830018 Rat 619614 Bp78 Blood pressure QTL 78 0.001 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 169112897 197261052 Rat 634321 Hc1 Hypercalciuria QTL 1 2.91 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 1 178810256 240830002 Rat 724562 Rends1 Renal damage susceptibility QTL 1 0.05 kidney glomerulus integrity trait (VT:0010546) index of glomerular damage (CMO:0001135) 1 169537671 214537671 Rat 2292222 Bp307 Blood pressure QTL 307 3.06 0.0014 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 213533942 Rat 2292220 Bp306 Blood pressure QTL 306 3.47 0.00087 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 243914901 Rat 1354615 Cm32 Cardiac mass QTL 32 5.2 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 1 102813953 201278233 Rat 1600380 Niddm70 Non-insulin dependent diabetes mellitus QTL 70 3.1 0.0008 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 176550523 221550523 Rat 1354610 Bw34 Body weight QTL 34 4.1 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1354620 Kidm19 Kidney mass QTL 19 4 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 201278233 Rat 1354618 Kidm15 Kidney mass QTL 15 5 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 1 156677124 201278233 Rat 6903303 Scl34 Serum cholesterol QTL 34 2.5 0.0033 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 180359209 218108781 Rat 631544 Bp84 Blood pressure QTL 84 5.6 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123350408 181759564 Rat 152025212 Bw190 Body weight QTL 190 5.7 body mass (VT:0001259) 1 123556856 196963478 Rat 631549 Bp89 Blood pressure QTL 89 5.7 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123350581 201284552 Rat 1358189 Cstrr1 Cold stress response QTL 1 0.0001 catecholamine amount (VT:0010543) urine norepinephrine level (CMO:0001629) 1 123350408 182418476 Rat 1354606 Bp246 Blood pressure QTL 246 3.6 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 102813953 218753816 Rat 738032 Hcas5 Hepatocarcinoma susceptibility QTL 5 3.12 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 176426412 257976495 Rat 1354602 Bw35 Body weight QTL 35 12.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 201278233 Rat 2325725 Eae31 Experimental allergic encephalomyelitis QTL 31 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis severity score (CMO:0001419) 1 178810256 188377506 Rat 631670 Iddm10 Insulin dependent diabetes mellitus QTL 10 1.9 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 1 174133260 196383668 Rat
PMC21657P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 181,461,236 - 181,461,603 (+) MAPPER mRatBN7.2 Rnor_6.0 1 198,287,320 - 198,287,686 NCBI Rnor6.0 Rnor_5.0 1 205,267,500 - 205,267,866 UniSTS Rnor5.0 RGSC_v3.4 1 186,030,668 - 186,031,034 UniSTS RGSC3.4 Celera 1 179,116,476 - 179,116,842 UniSTS Cytogenetic Map 1 q36 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
9
37
113
79
78
47
25
47
6
192
84
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000027022 ⟹ ENSRNOP00000027022
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 181,458,390 - 181,462,030 (+) Ensembl Rnor_6.0 Ensembl 1 198,284,473 - 198,288,113 (+) Ensembl
RefSeq Acc Id:
NM_022937 ⟹ NP_075226
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 190,888,919 - 190,892,559 (+) NCBI mRatBN7.2 1 181,458,390 - 181,462,030 (+) NCBI Rnor_6.0 1 198,284,473 - 198,288,113 (+) NCBI Rnor_5.0 1 205,263,516 - 205,268,791 (+) NCBI RGSC_v3.4 1 186,027,821 - 186,031,461 (+) RGD Celera 1 179,113,629 - 179,117,269 (+) RGD
Sequence:
CCTACAGACCCCAGCCGGCCACTCCAGCTCTACACCCGTCTCCCAGCCAGAGGTGCTGCATGAGGGGCCGCAGGGGCGATCGCATGACCATCAACATCCAGGAGCACATGGCCATCAACGTGTGCCCT
hide sequence
RefSeq Acc Id:
XM_006230335 ⟹ XP_006230397
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 190,888,042 - 190,893,057 (+) NCBI mRatBN7.2 1 181,457,416 - 181,462,528 (+) NCBI Rnor_6.0 1 198,283,489 - 198,288,611 (+) NCBI Rnor_5.0 1 205,263,516 - 205,268,791 (+) NCBI
Sequence:
TTCCTTTCCCCTCTGGTGCTTTCTGGGATGGGGGTGTGAGTGAAACCAGCGTCGCTATGGCAAC
hide sequence
RefSeq Acc Id:
XM_006230336 ⟹ XP_006230398
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 190,888,175 - 190,893,057 (+) NCBI mRatBN7.2 1 181,457,642 - 181,462,528 (+) NCBI Rnor_6.0 1 198,283,720 - 198,288,611 (+) NCBI Rnor_5.0 1 205,263,516 - 205,268,791 (+) NCBI
Sequence:
GTGCACGCGTGTCAGCTGGCCCAAGGCGCACGGGCGGGTGTGAGCGCGAGCACACGTGTGGAGTGTGCACTCGCGTGCGTTCTGGGGCCCGTGCCTGGCCCTCTTCGCCCCGCGCCCCTCCCGGCGGC
hide sequence
RefSeq Acc Id:
XM_006230337 ⟹ XP_006230399
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 190,888,081 - 190,893,057 (+) NCBI mRatBN7.2 1 181,457,416 - 181,462,528 (+) NCBI Rnor_6.0 1 198,283,489 - 198,288,611 (+) NCBI Rnor_5.0 1 205,263,516 - 205,268,791 (+) NCBI
Sequence:
TTCCTTTCCCCTCTGGTGCTTTCTGGGATGGGGGTGTGAGTGAAACCAGCGTCGCTATGGCAAC
hide sequence
RefSeq Acc Id:
XM_006230339 ⟹ XP_006230401
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 190,888,058 - 190,893,057 (+) NCBI mRatBN7.2 1 181,457,415 - 181,462,528 (+) NCBI Rnor_6.0 1 198,283,489 - 198,288,611 (+) NCBI Rnor_5.0 1 205,263,516 - 205,268,791 (+) NCBI
Sequence:
TTCCTTTCCCCTCTGGTGCTTTCTGGGATGGGGGTGTGAGTGAAACCAGCGTCGCTATGGCAACCAGGCCCGGTGGTCGGGCCCTGGAGCCCTGGGAGCCAGCGAAGGCGAGAGGCGGGGCAGCGGGA
hide sequence
RefSeq Acc Id:
XM_006230340 ⟹ XP_006230402
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 190,888,174 - 190,893,057 (+) NCBI mRatBN7.2 1 181,457,642 - 181,462,528 (+) NCBI Rnor_6.0 1 198,283,720 - 198,288,611 (+) NCBI Rnor_5.0 1 205,263,516 - 205,268,791 (+) NCBI
Sequence:
GTGCACGCGTGTCAGCTGGCCCAAGGCGCACGGGCGGGTGTGAGCGCGAGCACACGTGTGGAGTGTGCACTCGCGTGCGTTCTGGGGCCCGTGCCTGGCCCTCTTCGCCCCGCGCCCCTCCCGGCGGC
hide sequence
RefSeq Acc Id:
XM_039089802 ⟹ XP_038945730
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 190,888,175 - 190,893,057 (+) NCBI mRatBN7.2 1 181,457,642 - 181,462,528 (+) NCBI
RefSeq Acc Id:
XM_063272851 ⟹ XP_063128921
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 190,887,306 - 190,893,057 (+) NCBI
RefSeq Acc Id:
NP_075226 ⟸ NM_022937
- UniProtKB:
P70611 (UniProtKB/Swiss-Prot), A6I9G0 (UniProtKB/TrEMBL)
- Sequence:
MRGRRGDRMTINIQEHMAINVCPGPIRPIRQISDYFPRRGPGPEGGGGGRGFGEAPAHLAPLALAPPAALLGATTPDDGAEVDSYDSDDTTALGTLEFDLLYDQASCMLHCRILRAKGLKPMDFNGLA
hide sequence
RefSeq Acc Id:
XP_006230397 ⟸ XM_006230335
- Peptide Label:
isoform X1
- UniProtKB:
P70611 (UniProtKB/Swiss-Prot), A6I9G0 (UniProtKB/TrEMBL)
- Sequence:
MRGRRGDRMTINIQEHMAINVCPGPIRPIRQISDYFPRRGPGPEGGGGGRGFGEAPAHLAPLAL
hide sequence
RefSeq Acc Id:
XP_006230399 ⟸ XM_006230337
- Peptide Label:
isoform X1
- UniProtKB:
P70611 (UniProtKB/Swiss-Prot), A6I9G0 (UniProtKB/TrEMBL)
- Sequence:
MRGRRGDRMTINIQEHMAINVCPGPIRPIRQISDYFPRRGPGPEGGGGGRGFGEAPAHLAPLALAPPAALLGATTPDDGAEVDSYDSDDTTALGTLEFDLLYDQASCMLHCRILRAKGLKPMDFNGLA
hide sequence
RefSeq Acc Id:
XP_006230401 ⟸ XM_006230339
- Peptide Label:
isoform X1
- UniProtKB:
P70611 (UniProtKB/Swiss-Prot), A6I9G0 (UniProtKB/TrEMBL)
- Sequence:
MRGRRGDRMTINIQEHMAINVCPGPIRPIRQISDYFPRRGPGPEGGGGGRGFGEAPAHLAPLAL
hide sequence
RefSeq Acc Id:
XP_006230398 ⟸ XM_006230336
- Peptide Label:
isoform X1
- UniProtKB:
P70611 (UniProtKB/Swiss-Prot), A6I9G0 (UniProtKB/TrEMBL)
- Sequence:
MRGRRGDRMTINIQEHMAINVCPGPIRPIRQISDYFPRRGPGPEGGGGGRGFGEAPAHLAPLALAPPAALLGATTPDDGAEVDSYDSDDTTALGTLEFDLLYDQASCMLHCRILRAKGLKPMDFNGLA
hide sequence
RefSeq Acc Id:
XP_006230402 ⟸ XM_006230340
- Peptide Label:
isoform X1
- UniProtKB:
P70611 (UniProtKB/Swiss-Prot), A6I9G0 (UniProtKB/TrEMBL)
- Sequence:
MRGRRGDRMTINIQEHMAINVCPGPIRPIRQISDYFPRRGPGPEGGGGGRGFGEAPAHLAPLAL
hide sequence
Ensembl Acc Id:
ENSRNOP00000027022 ⟸ ENSRNOT00000027022
RefSeq Acc Id:
XP_038945730 ⟸ XM_039089802
- Peptide Label:
isoform X1
- UniProtKB:
P70611 (UniProtKB/Swiss-Prot), A6I9G0 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063128921 ⟸ XM_063272851
- Peptide Label:
isoform X1
- UniProtKB:
P70611 (UniProtKB/Swiss-Prot), A6I9G0 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-03-29
Doc2a
double C2 domain alpha
Doc2a
double C2-like domains, alpha
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-10-17
Doc2a
double C2-like domains, alpha
Doc2a
double C2, alpha
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-01-20
Doc2a
double C2, alpha
Doc2A
Symbol and Name status set to approved
1299863 APPROVED
2002-08-07
Doc2a
Doc2A
Symbol and Name status set to provisional
70820 PROVISIONAL
