Symbol:
Igbp1
Name:
immunoglobulin binding protein 1
RGD ID:
62011
Description:
Enables protein phosphatase 2A binding activity. Predicted to be involved in several processes, including negative regulation of stress-activated MAPK cascade; regulation of transcription by RNA polymerase II; and response to interleukin-1. Predicted to act upstream of or within negative regulation of apoptotic signaling pathway. Predicted to be located in cytoplasm and microtubule. Predicted to be active in cytosol. Human ortholog(s) of this gene implicated in corpus callosum agenesis-intellectual disability-coloboma-micrognathia syndrome. Orthologous to several human genes including IGBP1 (immunoglobulin binding protein 1); INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; acetamide.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
alpha4 phosphoprotein; CD79a-binding protein 1; immunoglobulin (CD79A) binding protein 1; immunoglobulin-binding protein 1; protein phosphatase 2/4/6 regulatory subunit
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
IGBP1 (immunoglobulin binding protein 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Igbp1 (immunoglobulin (CD79A) binding protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Igbp1 (immunoglobulin binding protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
IGBP1 (immunoglobulin binding protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
IGBP1 (immunoglobulin binding protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Igbp1 (immunoglobulin binding protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
IGBP1 (immunoglobulin binding protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
IGBP1 (immunoglobulin binding protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Igbp1 (immunoglobulin binding protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
IGBP1C (IGBP1 family member C) HGNC
Ensembl, OrthoDB, Panther
Homo sapiens (human):
FKBPL (FKBP prolyl isomerase like) HGNC
OMA
Alliance orthologs 3
Mus musculus (house mouse):
Igbp1 (immunoglobulin (CD79A) binding protein 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
IGBP1 (immunoglobulin binding protein 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
IGBP1C (IGBP1 family member C)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
igbp1 (immunoglobulin (CD79A) binding protein 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
TAP42
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
Tap42
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
ppfr-4
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
igbp1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 X 69,622,925 - 69,645,167 (+) NCBI GRCr8 mRatBN7.2 X 65,582,832 - 65,605,078 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl X 65,582,821 - 65,606,049 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx X 67,066,253 - 67,088,494 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 X 70,566,639 - 70,588,880 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 X 68,127,540 - 68,149,782 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 X 70,322,764 - 70,345,005 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 70,322,755 - 70,345,005 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 X 71,194,717 - 71,216,957 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 X 88,490,498 - 88,507,054 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 X 88,566,669 - 88,580,484 (+) NCBI Celera X 65,942,243 - 65,964,485 (+) NCBI Celera Cytogenetic Map X q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Igbp1 Rat (+)-catechin multiple interactions ISO IGBP1 (Homo sapiens) 6480464 [Catechin co-treated with Grape Seed Proanthocyanidins] results in increased expression of IGBP1 mRNA CTD PMID:24763279 Igbp1 Rat 1,2-dimethylhydrazine affects expression ISO Igbp1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine affects the expression of IGBP1 mRNA CTD PMID:22206623 Igbp1 Rat 1-chloro-2,4-dinitrobenzene affects binding ISO IGBP1 (Homo sapiens) 6480464 Dinitrochlorobenzene binds to IGBP1 protein CTD PMID:32991956 Igbp1 Rat 17beta-estradiol affects expression ISO IGBP1 (Homo sapiens) 6480464 Estradiol affects the expression of IGBP1 mRNA CTD PMID:22574217 Igbp1 Rat 17beta-estradiol decreases expression ISO IGBP1 (Homo sapiens) 6480464 Estradiol results in decreased expression of IGBP1 mRNA CTD PMID:31614463 Igbp1 Rat 17beta-estradiol multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of IGBP1 mRNA CTD PMID:26496021 Igbp1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Igbp1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of IGBP1 mRNA CTD PMID:19465110 Igbp1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO IGBP1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of IGBP1 mRNA CTD PMID:22574217 Igbp1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Igbp1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of IGBP1 mRNA CTD PMID:21570461 Igbp1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of IGBP1 mRNA CTD PMID:21215274 Igbp1 Rat 4,4'-sulfonyldiphenol increases expression ISO Igbp1 (Mus musculus) 6480464 bisphenol S results in increased expression of IGBP1 mRNA CTD PMID:39298647 Igbp1 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of IGBP1 mRNA CTD PMID:31881176 Igbp1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of IGBP1 mRNA CTD PMID:16483693 Igbp1 Rat aristolochic acid A increases expression ISO IGBP1 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of IGBP1 mRNA CTD PMID:33212167 Igbp1 Rat Aroclor 1254 decreases expression ISO Igbp1 (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of IGBP1 mRNA CTD PMID:23650126 Igbp1 Rat arsenite(3-) increases expression ISO Igbp1 (Mus musculus) 6480464 arsenite results in increased expression of IGBP1 protein CTD PMID:37955338 Igbp1 Rat arsenite(3-) multiple interactions ISO IGBP1 (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to IGBP1 mRNA] CTD PMID:32406909 Igbp1 Rat benzo[a]pyrene affects methylation ISO IGBP1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of IGBP1 5' UTR and Benzo(a)pyrene affects the methylation of IGBP1 promoter CTD PMID:27901495 Igbp1 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of IGBP1 mRNA CTD PMID:26496021 Igbp1 Rat bisphenol A decreases expression ISO IGBP1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of IGBP1 protein CTD PMID:34186270 Igbp1 Rat bisphenol A multiple interactions ISO IGBP1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] affects the methylation of IGBP1 gene CTD PMID:31601247 Igbp1 Rat bisphenol A decreases methylation ISO IGBP1 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of IGBP1 gene CTD PMID:31601247 Igbp1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of IGBP1 mRNA CTD PMID:30816183 and PMID:32528016 Igbp1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of IGBP1 mRNA CTD PMID:25181051 Igbp1 Rat Brodifacoum increases expression EXP 6480464 bromfenacoum results in increased expression of IGBP1 protein CTD PMID:28903499 Igbp1 Rat carbamazepine affects expression ISO IGBP1 (Homo sapiens) 6480464 Carbamazepine affects the expression of IGBP1 mRNA CTD PMID:25979313 Igbp1 Rat CGP 52608 multiple interactions ISO IGBP1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to IGBP1 gene] CTD PMID:28238834 Igbp1 Rat cisplatin increases expression ISO IGBP1 (Homo sapiens) 6480464 Cisplatin results in increased expression of IGBP1 mRNA CTD PMID:27594783 Igbp1 Rat cyclosporin A increases expression ISO Igbp1 (Mus musculus) 6480464 Cyclosporine results in increased expression of IGBP1 mRNA CTD PMID:19770486 Igbp1 Rat dicrotophos decreases expression ISO IGBP1 (Homo sapiens) 6480464 dicrotophos results in decreased expression of IGBP1 mRNA CTD PMID:28302478 Igbp1 Rat enzyme inhibitor multiple interactions ISO IGBP1 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of IGBP1 protein CTD PMID:23301498 Igbp1 Rat ethyl methanesulfonate increases expression ISO IGBP1 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in increased expression of IGBP1 mRNA CTD PMID:23649840 Igbp1 Rat folic acid decreases expression ISO Igbp1 (Mus musculus) 6480464 Folic Acid results in decreased expression of IGBP1 mRNA CTD PMID:25629700 Igbp1 Rat fulvestrant multiple interactions ISO IGBP1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] affects the methylation of IGBP1 gene CTD PMID:31601247 Igbp1 Rat genistein increases expression ISO Igbp1 (Mus musculus) 6480464 Genistein results in increased expression of IGBP1 mRNA CTD PMID:32186404 Igbp1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of IGBP1 mRNA CTD PMID:22061828 Igbp1 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of IGBP1 mRNA CTD PMID:33387578 Igbp1 Rat hydralazine multiple interactions ISO IGBP1 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of IGBP1 mRNA CTD PMID:17183730 Igbp1 Rat ivermectin decreases expression ISO IGBP1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of IGBP1 protein CTD PMID:32959892 Igbp1 Rat manganese atom multiple interactions ISO IGBP1 (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] which results in decreased expression of IGBP1 mRNA CTD PMID:39836092 Igbp1 Rat manganese(0) multiple interactions ISO IGBP1 (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] which results in decreased expression of IGBP1 mRNA CTD PMID:39836092 Igbp1 Rat manganese(II) chloride multiple interactions ISO IGBP1 (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] which results in decreased expression of IGBP1 mRNA CTD PMID:39836092 Igbp1 Rat methyl methanesulfonate increases expression ISO IGBP1 (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of IGBP1 mRNA CTD PMID:23649840 Igbp1 Rat microcystin-LR multiple interactions ISO IGBP1 (Homo sapiens) 6480464 [IGBP1 protein results in increased susceptibility to cyanoginosin LR] which affects the expression of PPP2CA protein modified form more ... CTD PMID:27393157 and PMID:29984889 Igbp1 Rat microcystin-LR increases response to substance ISO IGBP1 (Homo sapiens) 6480464 IGBP1 protein results in increased susceptibility to cyanoginosin LR CTD PMID:29984889 Igbp1 Rat microcystin-LR affects response to substance ISO IGBP1 (Homo sapiens) 6480464 IGBP1 protein affects the susceptibility to cyanoginosin LR CTD PMID:26784437 Igbp1 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with caffeic acid phenethyl ester] results in decreased expression of IGBP1 mRNA CTD PMID:20360939 Igbp1 Rat ozone multiple interactions ISO Igbp1 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of Ozone] which results in increased expression of IGBP1 mRNA CTD PMID:27106289 Igbp1 Rat phenethyl caffeate multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with caffeic acid phenethyl ester] results in decreased expression of IGBP1 mRNA CTD PMID:20360939 Igbp1 Rat sodium arsenite increases expression ISO IGBP1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of IGBP1 mRNA CTD PMID:38568856 Igbp1 Rat sodium fluoride decreases expression ISO Igbp1 (Mus musculus) 6480464 Sodium Fluoride results in decreased expression of IGBP1 mRNA CTD PMID:27862939 Igbp1 Rat sunitinib increases expression ISO IGBP1 (Homo sapiens) 6480464 Sunitinib results in increased expression of IGBP1 mRNA CTD PMID:31533062 Igbp1 Rat triphenyl phosphate affects expression ISO IGBP1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of IGBP1 mRNA CTD PMID:37042841 Igbp1 Rat urethane increases expression ISO IGBP1 (Homo sapiens) 6480464 Urethane results in increased expression of IGBP1 mRNA CTD PMID:28818685 Igbp1 Rat valproic acid multiple interactions ISO IGBP1 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of IGBP1 mRNA CTD PMID:17183730 Igbp1 Rat valproic acid decreases expression ISO IGBP1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of IGBP1 mRNA CTD PMID:23179753 Igbp1 Rat valproic acid affects expression ISO IGBP1 (Homo sapiens) 6480464 Valproic Acid affects the expression of IGBP1 mRNA CTD PMID:25979313
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
3.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
4.
Characterization of a novel, cytokine-inducible carboxypeptidase D isoform in haematopoietic tumour cells.
O'Malley PG, etal., Biochem J. 2005 Sep 15;390(Pt 3):665-73.
5.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
6.
GOA pipeline
RGD automated data pipeline
7.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
8.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
9.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
10.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
11.
Differential expression of elongation factor-2, alpha4 phosphoprotein and Cdc5-like protein in prolactin-dependent/independent rat lymphoid cells.
Too CK Mol Cell Endocrinol 1997 Aug 8;131(2):221-32.
Igbp1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 X 69,622,925 - 69,645,167 (+) NCBI GRCr8 mRatBN7.2 X 65,582,832 - 65,605,078 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl X 65,582,821 - 65,606,049 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx X 67,066,253 - 67,088,494 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 X 70,566,639 - 70,588,880 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 X 68,127,540 - 68,149,782 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 X 70,322,764 - 70,345,005 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 70,322,755 - 70,345,005 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 X 71,194,717 - 71,216,957 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 X 88,490,498 - 88,507,054 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 X 88,566,669 - 88,580,484 (+) NCBI Celera X 65,942,243 - 65,964,485 (+) NCBI Celera Cytogenetic Map X q22 NCBI
IGBP1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 X 70,133,447 - 70,166,324 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl X 70,133,447 - 70,166,324 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 X 69,353,297 - 69,386,174 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 X 69,270,043 - 69,302,899 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 X 69,136,338 - 69,169,192 NCBI Celera X 69,706,683 - 69,739,540 (+) NCBI Celera Cytogenetic Map X q13.1 NCBI HuRef X 63,174,076 - 63,207,564 (+) NCBI HuRef CHM1_1 X 69,246,939 - 69,279,788 (+) NCBI CHM1_1 T2T-CHM13v2.0 X 68,566,802 - 68,599,681 (+) NCBI T2T-CHM13v2.0
Igbp1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 X 99,537,897 - 99,559,731 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl X 99,537,897 - 99,559,731 (+) Ensembl GRCm39 Ensembl GRCm38 X 100,494,291 - 100,516,125 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl X 100,494,291 - 100,516,125 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 X 97,689,630 - 97,711,464 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 X 96,697,064 - 96,718,720 (+) NCBI MGSCv36 mm8 Celera X 87,420,356 - 87,442,287 (+) NCBI Celera Cytogenetic Map X C3 NCBI cM Map X 43.72 NCBI
Igbp1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955475 9,671,162 - 9,694,926 (+) NCBI ChiLan1.0 ChiLan1.0
IGBP1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 X 69,810,161 - 69,843,192 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 X 69,813,728 - 69,846,794 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 X 59,401,426 - 59,434,363 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 X 69,460,736 - 69,493,616 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl X 69,460,734 - 69,493,616 (+) Ensembl panpan1.1 panPan2
IGBP1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 X 54,558,515 - 54,612,029 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl X 54,547,446 - 54,613,171 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha X 45,384,171 - 45,437,674 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 X 55,524,457 - 55,577,975 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl X 55,513,867 - 55,579,130 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 X 53,493,501 - 53,547,031 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 X 54,824,297 - 54,877,823 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 X 54,751,460 - 54,804,992 (+) NCBI UU_Cfam_GSD_1.0
Igbp1
IGBP1
IGBP1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 X 59,970,740 - 60,008,066 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl X 59,971,234 - 60,008,047 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666065 1,827,501 - 1,859,929 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Igbp1
.
Predicted Target Of
Count of predictions: 204 Count of miRNA genes: 141 Interacting mature miRNAs: 159 Transcripts: ENSRNOT00000057900 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
61430 Cia18 Collagen induced arthritis QTL 18 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) X 14843113 120568734 Rat 738035 Stresp1 Stress response QTL 1 4.96 0.000011 stress-related behavior trait (VT:0010451) defensive burying - coping X 41304447 112935181 Rat 70221 Bp56 Blood pressure QTL 56 4.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) X 57042141 65612192 Rat 1598837 Memor13 Memory QTL 13 3.2 exploratory behavior trait (VT:0010471) difference between time of physical contact/close proximity of test subject and social stimulus during sample phase and test phase (CMO:0002678) X 41052407 146860749 Rat
RH129961
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 X 65,604,760 - 65,604,978 (+) MAPPER mRatBN7.2 Rnor_6.0 X 70,344,688 - 70,344,905 NCBI Rnor6.0 Rnor_5.0 X 71,216,640 - 71,216,857 UniSTS Rnor5.0 RGSC_v3.4 X 88,506,737 - 88,506,954 UniSTS RGSC3.4 Celera X 65,964,168 - 65,964,385 UniSTS Cytogenetic Map X q31 UniSTS
AW208785
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 X 65,604,709 - 65,604,825 (+) MAPPER mRatBN7.2 Rnor_6.0 X 70,344,637 - 70,344,752 NCBI Rnor6.0 Rnor_5.0 X 71,216,589 - 71,216,704 UniSTS Rnor5.0 RGSC_v3.4 X 88,506,686 - 88,506,801 UniSTS RGSC3.4 Celera X 65,964,117 - 65,964,232 UniSTS Cytogenetic Map X q31 UniSTS
RH135891
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 X 69,622,950 - 69,623,118 (+) Marker Load Pipeline mRatBN7.2 X 65,582,856 - 65,583,025 (+) MAPPER mRatBN7.2 Rnor_6.0 X 70,322,789 - 70,322,957 NCBI Rnor6.0 Rnor_5.0 X 71,194,742 - 71,194,910 UniSTS Rnor5.0 Celera X 65,942,268 - 65,942,436 UniSTS Cytogenetic Map X q31 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000057900 ⟹ ENSRNOP00000054708
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl X 65,582,821 - 65,606,049 (+) Ensembl Rnor_6.0 Ensembl X 70,322,755 - 70,345,005 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000076176
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl X 70,330,198 - 70,344,747 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000076293
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl X 70,332,936 - 70,344,879 (+) Ensembl
RefSeq Acc Id:
NM_031624 ⟹ NP_113812
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 69,622,925 - 69,645,167 (+) NCBI mRatBN7.2 X 65,582,832 - 65,605,078 (+) NCBI Rnor_6.0 X 70,322,764 - 70,345,005 (+) NCBI Rnor_5.0 X 71,194,717 - 71,216,957 (+) NCBI RGSC_v3.4 X 88,490,498 - 88,507,054 (+) RGD Celera X 65,942,243 - 65,964,485 (+) RGD
Sequence:
TCTTTCCACAAGATGGCAGCGTCTGAAGAAGAGTTACTGCTGCCGCGGCTTCCGGAGCTCTTCGAAACCAGCAAGAAACTTCTGGAGGAGTTGGAAGTAGCAACTGAACCCACCGGCTCCCGAACAAT
hide sequence
RefSeq Acc Id:
NP_113812 ⟸ NM_031624
- UniProtKB:
O08836 (UniProtKB/Swiss-Prot), A6IQ75 (UniProtKB/TrEMBL)
- Sequence:
MAASEEELLLPRLPELFETSKKLLEELEVATEPTGSRTIQDKVSKGLELLEKAAGMLSQLDLFSRNEDLEEIASIDLKYLMVPALQGALTMKQVNPSKRLDHLQRAREHFIHFLTQCHCYHVAEFQLP
hide sequence
Ensembl Acc Id:
ENSRNOP00000054708 ⟸ ENSRNOT00000057900
RGD ID: 13701864 Promoter ID: EPDNEW_R12388 Type: multiple initiation site Name: Igbp1_1 Description: immunoglobulin binding protein 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 X 70,322,765 - 70,322,825 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2017-02-01
Igbp1
immunoglobulin binding protein 1
Igbp1
immunoglobulin (CD79A) binding protein 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-09-10
Igbp1
immunoglobulin (CD79A) binding protein 1
immunoglobulin binding protein 1
Name updated
1299863 APPROVED
2002-06-10
Igbp1
immunoglobulin binding protein 1
Name updated
70584 APPROVED
Note Type
Note
Reference
gene_regulation
expression is responsive to prolactin
61637
