Advanced Search (OLGA)

Gene: Gpr37 (G protein-coupled receptor 37) Rattus norvegicus

Analyze

Symbol:

Gpr37

Name:

G protein-coupled receptor 37

RGD ID:

619848

Description:

Predicted to enable several functions, including G protein-coupled receptor activity; Hsp70 protein binding activity; and PDZ domain binding activity. Predicted to be involved in several processes, including G protein-coupled receptor signaling pathway; cellular response to reactive oxygen species; and dendrite development. Predicted to act upstream of or within dopamine biosynthetic process; locomotion involved in locomotory behavior; and positive regulation of dopamine metabolic process. Predicted to be located in endoplasmic reticulum. Predicted to be part of receptor complex and ubiquitin ligase complex. Predicted to be active in cell surface; plasma membrane; and synapse. Orthologous to human GPR37 (G protein-coupled receptor 37); PARTICIPATES IN Parkinson's disease pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; alpha-Zearalanol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

Ednrbl; G protein-coupled receptor 37 (endothelin receptor type B-like); G-protein coupled receptor 37; G-protein coupled receptor CNS1; MGC105347; probable G-protein coupled receptor 37; prosaposin receptor GPR37

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GPR37 (G protein-coupled receptor 37)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Gpr37 (G protein-coupled receptor 37)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Gpr37 (G protein-coupled receptor 37)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	GPR37 (G protein-coupled receptor 37)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	GPR37 (G protein-coupled receptor 37)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Gpr37 (G protein-coupled receptor 37)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	GPR37 (G protein-coupled receptor 37)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	GPR37 (G protein-coupled receptor 37)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Gpr37 (G protein-coupled receptor 37)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Gpr37 (G protein-coupled receptor 37)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	TUBB3 (tubulin beta 3 class III)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	GPR37 (G protein-coupled receptor 37)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Gpr37 (G protein-coupled receptor 37)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	gpr37b (G protein-coupled receptor 37b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	gpr37a (G protein-coupled receptor 37a)	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	gpr37	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	gpr37	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	55,104,355 - 55,126,420 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	4	55,104,365 - 55,126,494 (-)	Ensembl				GRCr8
mRatBN7.2	4	54,138,860 - 54,160,927 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	54,138,870 - 54,161,001 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	4	59,140,517 - 59,162,546 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	55,054,096 - 55,076,127 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	53,458,667 - 53,480,642 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	51,822,163 - 51,844,228 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	51,822,153 - 51,844,331 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	4	51,598,203 - 51,620,268 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	4	52,166,918 - 52,188,983 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	4	49,276,912 - 49,299,393 (-)	NCBI		Celera
RGSC_v3.1	4	52,397,493 - 52,419,557 (-)	NCBI
Cytogenetic Map	4	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Lewy body dementia (ISO)

malignant mesothelioma (ISO)

Parkinson's disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

1,2-dichloroethane (ISO)

17beta-estradiol (ISO)

17beta-hydroxy-5alpha-androstan-3-one (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,4'-trichlorobiphenyl (ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

8-Br-cAMP (ISO)

all-trans-retinoic acid (ISO)

alpha-Zearalanol (EXP)

amitrole (EXP)

ammonium chloride (EXP)

arsenite(3-) (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

butanal (ISO)

cadmium atom (ISO)

carmustine (ISO)

chlorpyrifos (ISO)

cobalt dichloride (ISO)

Cuprizon (EXP)

cycloheximide (ISO)

dexamethasone (EXP)

diarsenic trioxide (ISO)

diethylstilbestrol (EXP)

dorsomorphin (ISO)

doxorubicin (ISO)

ethanol (ISO)

etoposide (ISO)

folic acid (ISO)

gentamycin (EXP)

ketoconazole (EXP)

mercury dibromide (ISO)

methylseleninic acid (ISO)

N,N-diethyl-m-toluamide (EXP)

N-methyl-4-phenylpyridinium (ISO)

ozone (ISO)

panobinostat (ISO)

paracetamol (EXP,ISO)

PCB138 (ISO)

pentanal (ISO)

perfluorooctanoic acid (EXP)

permethrin (EXP)

phenylmercury acetate (ISO)

potassium dichromate (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

testosterone (EXP)

tetrachloromethane (EXP)

trichloroethene (EXP)

trichostatin A (ISO)

triclosan (ISO)

valproic acid (ISO)

vinclozolin (EXP)

VX nerve agent (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway (IBA,IEA,ISO)

cellular response to reactive oxygen species (IEA,ISO)

dendrite development (IEA,ISO)

dopamine biosynthetic process (IEA,ISO)

G protein-coupled receptor signaling pathway (IEA)

locomotion involved in locomotory behavior (IEA,ISO)

neuropeptide signaling pathway (IEA,ISO)

positive regulation of dopamine metabolic process (IEA,ISO)

positive regulation of MAPK cascade (IBA,IEA,ISO)

signal transduction (IEA)

Cellular Component

cell surface (IEA,ISO)

cytoplasm (IEA,ISO)

dendrite (IEA)

endoplasmic reticulum (IEA,ISO)

endoplasmic reticulum membrane (IEA)

membrane (IEA)

plasma membrane (IBA,IEA,ISO)

receptor complex (IBA,IEA,ISO)

synapse (IEA,ISO)

ubiquitin ligase complex (IEA,ISO)

Molecular Function

G protein-coupled peptide receptor activity (IBA,IEA,ISO)

G protein-coupled receptor activity (IEA)

heat shock protein binding (IEA,ISO)

Hsp70 protein binding (IEA,ISO)

neuropeptide binding (IEA,ISO)

neuropeptide receptor activity (IEA,ISO)

PDZ domain binding (IEA,ISO)

peptide binding (IEA,ISO)

prosaposin receptor activity (IBA,IEA,ISO)

protein binding (ISO)

ubiquitin protein ligase binding (IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

Parkinson's disease pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Molecular cloning and characterization of two putative G protein-coupled receptors which are highly expressed in the central nervous system.	Leng N, etal., Brain Res Mol Brain Res 1999 May 21;69(1):73-83.
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	Pael-R is accumulated in Lewy bodies of Parkinson's disease.	Murakami T, etal., Ann Neurol. 2004 Mar;55(3):439-42. doi: 10.1002/ana.20064.
6.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
8.	GOA pipeline	RGD automated data pipeline
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:11439185	PMID:12150907	PMID:12477932	PMID:12618056	PMID:15218106	PMID:15489334	PMID:16443751	PMID:17059562	PMID:23382219	PMID:23690594	PMID:24749734	PMID:29656342
PMID:31215019	PMID:33259479

Genomics

Comparative Map Data

Gpr37
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	55,104,355 - 55,126,420 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	4	55,104,365 - 55,126,494 (-)	Ensembl				GRCr8
mRatBN7.2	4	54,138,860 - 54,160,927 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	54,138,870 - 54,161,001 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	4	59,140,517 - 59,162,546 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	55,054,096 - 55,076,127 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	53,458,667 - 53,480,642 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	51,822,163 - 51,844,228 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	51,822,153 - 51,844,331 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	4	51,598,203 - 51,620,268 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	4	52,166,918 - 52,188,983 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	4	49,276,912 - 49,299,393 (-)	NCBI		Celera
RGSC_v3.1	4	52,397,493 - 52,419,557 (-)	NCBI
Cytogenetic Map	4	q22	NCBI

GPR37
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	124,743,885 - 124,765,792 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	124,743,885 - 124,765,792 (-)	Ensembl			hg38	GRCh38
GRCh37	7	124,383,939 - 124,405,846 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	124,173,350 - 124,192,917 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	7	123,980,066 - 123,999,632	NCBI
Celera	7	119,191,362 - 119,210,932 (-)	NCBI		Celera
Cytogenetic Map	7	q31.33	NCBI
HuRef	7	118,750,711 - 118,771,098 (-)	NCBI		HuRef
CHM1_1	7	124,318,797 - 124,339,217 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	7	126,061,240 - 126,083,145 (-)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	123,775,046 - 123,795,470 (-)	NCBI

Gpr37
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	25,668,522 - 25,689,979 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	25,665,877 - 25,690,728 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	6	25,668,523 - 25,689,980 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	25,665,878 - 25,690,729 (-)	Ensembl			mm10	GRCm38
MGSCv37	6	25,618,523 - 25,639,980 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	6	25,618,118 - 25,640,739 (-)	NCBI		MGSCv36	mm8
Celera	6	25,669,443 - 25,690,900 (-)	NCBI		Celera
Cytogenetic Map	6	A3.1	NCBI
cM Map	6	11.65	NCBI

Gpr37
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955479	6,057,276 - 6,080,994 (-)	Ensembl
ChiLan1.0	NW_004955479	6,061,424 - 6,080,129 (-)	NCBI	ChiLan1.0	ChiLan1.0

GPR37
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	161,593,816 - 161,613,989 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	13,604,066 - 13,624,239 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	7	116,727,912 - 116,751,647 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	7	129,410,462 - 129,430,292 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	129,410,458 - 129,430,292 (-)	Ensembl			panPan2	panpan1.1

GPR37
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	14	11,113,584 - 11,137,639 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	14	11,114,415 - 11,132,395 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	14	10,812,992 - 10,835,790 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	14	10,895,712 - 10,918,523 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	14	10,896,513 - 10,918,510 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	14	11,087,569 - 11,110,364 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	14	10,819,644 - 10,842,429 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	14	10,979,393 - 11,002,189 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Gpr37
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	51,206,369 - 51,225,767 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936605	978,980 - 999,741 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936605	978,174 - 997,093 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GPR37
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	18	23,019,749 - 23,038,356 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	18	23,019,752 - 23,036,483 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	18	24,665,384 - 24,682,115 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GPR37
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	21	93,487,178 - 93,507,317 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	21	93,486,702 - 93,507,056 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666042	9,949,159 - 9,971,276 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gpr37
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624783	11,291,497 - 11,320,952 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624783	11,291,601 - 11,319,467 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Gpr37
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	6	114,036,346 - 114,058,252 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Gpr37
238 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	68
Count of miRNA genes:	51
Interacting mature miRNAs:	62
Transcripts:	ENSRNOT00000003593
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2302371	Stl22	Serum triglyceride level QTL 22	5.15		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	13080146	58080146	Rat
2303585	Bw86	Body weight QTL 86	4		body mass (VT:0001259)	body weight (CMO:0000012)	4	15644309	60644309	Rat
5685012	Bmd87	Bone mineral density QTL 87	5.1		tibia mineral mass (VT:1000283)	bone mineral content (CMO:0001554)	4	35113290	80113290	Rat
1358352	Srcrt3	Stress Responsive Cort QTL 3	2.29		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	39431983	123203361	Rat
61445	Strs3	Sensitivity to stroke QTL 3	3		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	4	41400577	86400577	Rat
6893678	Bw108	Body weight QTL 108	2.6	0.006	body mass (VT:0001259)	body weight (CMO:0000012)	4	44425024	89425024	Rat
8552906	Pigfal3	Plasma insulin-like growth factor 1 level QTL 3			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	4	11038706	56038706	Rat
10755501	Bp390	Blood pressure QTL 390	2.5		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	4	27730518	170099664	Rat
1331807	Rf31	Renal function QTL 31	2.988		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	4	40490442	75726188	Rat
6478766	Anxrr47	Anxiety related response QTL 47		0.09637	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	4	11038706	56038706	Rat
61330	Eau1	Experimental allergic uveoretinitis QTL 1		0.0003	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	4	26234499	134199155	Rat
631642	Stl2	Serum triglyceride level QTL 2	3.3		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	5894575	57613242	Rat
6478769	Anxrr48	Anxiety related response QTL 48		0.02514	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	11038706	56038706	Rat
631261	Tcas3	Tongue tumor susceptibility QTL 3	6.88		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	4	11706604	92690519	Rat
10450825	Scl78	Serum cholesterol level QTL 78	3.7	0.01	blood VLDL cholesterol amount (VT:0005144)	blood low density lipoprotein cholesterol level (CMO:0000053)	4	50143926	58080146	Rat
2313401	Anxrr27	Anxiety related response QTL 27			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	4	18900697	63900697	Rat
10450821	Scl77	Serum cholesterol level QTL 77	4.1	0.01	blood VLDL cholesterol amount (VT:0005144)	blood high density lipoprotein cholesterol level (CMO:0000052)	4	50143926	58080146	Rat
8655961	Kidm43	Kidney mass QTL 43	18		kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	4	37269577	82269577	Rat
10450818	Scl76	Serum cholesterol level QTL 76	3.6	0.01	blood VLDL cholesterol amount (VT:0005144)	blood high density lipoprotein cholesterol level (CMO:0000052)	4	50143926	58080146	Rat
1354612	Foco1	Food consumption QTL 1	8.87		eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	4	45429897	149763204	Rat
6909128	Pancm4	Pancreatic morphology QTL 4	11.35		pancreas mass (VT:0010144)	pancreas wet weight (CMO:0000626)	4	27862204	126119996	Rat
8694374	Bw155	Body weight QTL 155	3.39	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	4	11038706	56038706	Rat
2303168	Bp330	Blood pressure QTL 330	4.25	0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	5889999	148002343	Rat
61475	Aia2	Adjuvant induced arthritis QTL 2	5.8		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	40471453	75939996	Rat
8694439	Bw168	Body weight QTL 168	9.57	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	4	41400603	86400603	Rat
61412	Pia2	Pristane induced arthritis QTL 2	3.9		joint integrity trait (VT:0010548)	post-insult time to onset of experimental arthritis (CMO:0001450)	4	22288453	63245191	Rat
8552807	Vie4	Viral induced encephalitis QTL 4	7.3		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	4	18900697	63900697	Rat
6478724	Anxrr35	Anxiety related response QTL 35		0.00449	defecation behavior trait (VT:0010462)	defecation measurement (CMO:0000997)	4	11038706	56038706	Rat
8655906	Rf60	Renal function QTL 60	3.8		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	4	30448961	82336920	Rat
1576305	Emca6	Estrogen-induced mammary cancer QTL 6	5.8		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	4	45429709	157555683	Rat
7387227	Uae40	Urinary albumin excretion QTL 40	2.9	0.0052	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	4	18913151	63913151	Rat
6909122	Insul22	Insulin level QTL 22	4.63		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	4	27862204	62997402	Rat
1558651	Swd3	Spike wave discharge measurement QTL 3	4.62	0.000024	brain electrophysiology trait (VT:0010557)	brain spike-and-wave discharge frequency (CMO:0001742)	4	41400577	86400577	Rat
1358203	Stl19	Serum triglyceride level QTL 19	2.8	0.002	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	21925151	66925151	Rat
1354660	Salc1	Saline consumption QTL 1	11.26		drinking behavior trait (VT:0001422)	saline drink intake rate (CMO:0001627)	4	45429897	149763204	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	4	1	63900697	Rat
1298082	Stresp4	Stress response QTL 4			blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	51085655	113588029	Rat
9590304	Scort17	Serum corticosterone level QTL 17	4.96	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	11038706	56038706	Rat
1300139	Hrtrt6	Heart rate QTL 6	2.85		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	40490442	117737312	Rat
12798520	Anxrr55	Anxiety related response QTL 55	4.45	0.01	locomotor behavior trait (VT:0001392)	number of rearing movements with lid-pushing in an experimental apparatus (CMO:0002715)	4	33538597	116185060	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	12212457	182430611	Rat

Markers in Region

RH140423

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	54,138,951 - 54,139,133 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	51,822,255 - 51,822,436	NCBI	Rnor6.0
Rnor_5.0	4	51,598,295 - 51,598,476	UniSTS	Rnor5.0
RGSC_v3.4	4	52,167,010 - 52,167,191	UniSTS	RGSC3.4
Celera	4	49,277,004 - 49,277,185	UniSTS
RH 3.4 Map	4	286.6	UniSTS
Cytogenetic Map	4	q22	UniSTS

BF409419

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	54,152,923 - 54,153,026 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	51,836,225 - 51,836,327	NCBI	Rnor6.0
Rnor_5.0	4	51,612,265 - 51,612,367	UniSTS	Rnor5.0
RGSC_v3.4	4	52,180,980 - 52,181,082	UniSTS	RGSC3.4
Celera	4	49,290,963 - 49,291,065	UniSTS
RH 3.4 Map	11	290.4	UniSTS
Cytogenetic Map	4	q22	UniSTS

UniSTS:495954

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	54,160,345 - 54,160,436 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	51,843,647 - 51,843,737	NCBI	Rnor6.0
Rnor_5.0	4	51,619,687 - 51,619,777	UniSTS	Rnor5.0
RGSC_v3.4	4	52,188,402 - 52,188,492	UniSTS	RGSC3.4
Celera	4	49,298,812 - 49,298,902	UniSTS
Cytogenetic Map	4	q22	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	11	67	163	91	90	59	52	59	6	312	152	11	142	78	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_057201	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF087946	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC087728	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473959	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000003593 ⟹ ENSRNOP00000003593

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	4	55,104,365 - 55,126,494 (-)	Ensembl
mRatBN7.2 Ensembl	4	54,138,870 - 54,161,001 (-)	Ensembl
Rnor_6.0 Ensembl	4	51,822,153 - 51,844,331 (-)	Ensembl

RefSeq Acc Id:

NM_057201 ⟹ NP_476549

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	55,104,355 - 55,126,420 (-)	NCBI
mRatBN7.2	4	54,138,860 - 54,160,927 (-)	NCBI
Rnor_6.0	4	51,822,163 - 51,844,228 (-)	NCBI
Rnor_5.0	4	51,598,203 - 51,620,268 (-)	NCBI
RGSC_v3.4	4	52,166,918 - 52,188,983 (-)	RGD
Celera	4	49,276,912 - 49,299,393 (-)	RGD

Sequence:

show sequence

GGCACGAGTCTACTCCACGCCTTCTCCGCCAGTGTACTATGCGCAGCCACCGGCGCCATCCGCT
TGTCAACTTTGAGCTGAAGGAGCAGCAACTTTGACAGTGGCCGCGGGTTTCTAATCTGGCTTCT
CCTTGGCAACAGTCTCTTCGAAAGTCGAGTTAAACGAGGCAAGAGTTTCCTCTGAGCACCCTTG
TTGCCTTGTTTGCAACGGGTCCCCCGCCAGCCGAGAGTGGGATTGTGACAGCCAGTCCCCTAGT
GGAGGGGACTTGTTTTTCTTTTTCTCTAGAGACCTTTACTAGCGACTGGATAAAGCAGTACCGA
GAAAGGACGTAAATAGCAGAGCAACTGTTACCAAGAAGACAGCCACCACCCAAAGCCTGGGAGG
AACGCCGGGTTTCCTCCAGGCTGCGCCCAGTCGCAACATTAGGGAACAATCAGGTGGTGTTCGC
AACTTTTCAAGGTCAGCCTGTTGGATCTGTTATTTCTTTCGGACCCTTCGGGTGCACAGAGCTT
GGATTAGATTTGGCTGGGAAATGCTCAGGACACGAAACCTTGAAGGATTGTAGGGATGTGTTGA
GGACACCGTCCTTCCCCGACTGCCCTGTACCCTGCCCTCCCAGCAGTCTTCAGCTCCCCTCCAC
TAGCCAGCGGTGAGTATGTGACATGTGCCTAACTCTCTGCACCAAGTTTGGCAGCAGGTGTCGG
TGCTAAGGTAGAGCCAGGATACTAGGTGCGCCCTCGCGGAGCCATGCCAGCCCCGGGCGCGCCT
CTCTCTCGCACATCGCGGCTGCTGCTCCTTCTGCTGTTCAAGGTTTCTGTCTCTGCTGCCCTGA
GCTTTGTCCCTGAGCCCAGGAATGGAACTTGTTTGGGGGAGAGCTGTTCCCCACTGATTCCACG
TCGCAGCAGGGATGCCGGGGGACCTAGGAATTCAGCAAGAGATGCTCTGCGAGTCCATGTGCCC
AGAGAAAAGCTGGAAGCAGAGGTGAGAGGGGCGACCTCCTGGGACCTCCCACCACCCAGGGGCG
GTGACACAGGTGTGATTGAAGAGGCAGCGGCTTCTGGGCCCTTGGGACCTCCAACCAAGCCACC
AGGTGCCTGGAGATGGAAAGGAGCCCAGGGTAAAGAACCATCCGGACATTTGGGGAGAAGGGAG
CCCACGGACTCCCAACTCTTCCGTCAAACCTCTGAGAGAGGAGAGATGAGTTCCAAGCGCGACG
AGATTCCCCAGGGCAGCCAGGAGCACAGTGTGAAAACAGAACCTGAACCCAGAGATCTTTTTTA
CTGGCCAAGAAAAACAGGACAACTCCAGGGTTCCCATTACAGGCCTTCAGCGGTACACGAAGGA
AGAACCCTTGCTCCCCCAGGCAGGGCGCTACCTCAAAACGGGTCTGCAGATGACTGGGTCCCTG
ACCAAGGGGGTCCACGCCGTGGAAATAGCACTAACCGACGCGTGAGACTGAAGAACCCCTTCTA
CCCATTGACCCAGGAATCCTATGGAGCCTATGCTGTCATGTGCTTATCTGTGGTGATCTTTGGG
ACCGGCATCATTGGTAACTTGGCAGTGATGTGCATCGTGTGTCACAATTACTACATGAGGAGCA
TCTCCAATTCTCTCTTGGCCAACCTCGCTTTCTGGGACTTTCTCATCATCTTCTTCTGCCTCCC
CTTGGTCATCTTCCATGAGTTGACCAAGAAGTGGCTTTTGGAAGATTTCTCCTGCAAGATCGTG
CCCTATATCGAGGTAGCTTCTCTGGGTGTCACTACCTTCACCTTATGTGCACTGTGCATAGATC
GCTTCCGGGCTGCCACCAACGTCCAGATGTACTATGAAATGATTGAAAATTGTTCTTCCACCAC
TGCCAAACTTGCAGTTATCTGGGTTGGCGCTCTGCTCTTGGCACTTCCGGAAGTTGTCCTCCGC
CAGCTGAGTAAGGAGGATTTGGGCTTTAGTGGCCAGGCTCCTGCAGAACGGTGTGTCATAAAGA
TCTCTCCCGATTTACCGGACACCATCTATGTTTTGGCTCTCACTTATGATGGCGCACGGCTCTG
GTGGTATTTCGGCTGCTACTTTTGTCTGCCCACACTTTTCACCATCACCTGCTCTCTAGTGACC
GCTCGGAAGATCCGCAAGGCGGAGAAAGCCAGTACCCGTGGGAACAAGCGGCAGATCCATCTAG
AGAGCCAGATGAACTGCACAGTGGTGGCTCTGACCATTTTATATGGATTTTGCATCATCCCCGA
GAATATCTGCAACATCGTCACTGCCTACATGGCCACGGGTGTCTCTCAGCAGACCATGGACCTC
CTCAACATCATCAGCCAGTTCCTTTTGTTCTTCAAGTCCTGCGTCACCCCTGTACTCCTCTTCT
GCCTCTGCAGGCCCTTCAGCAGGGCCTTCATGGAGTGCTGCTGTTGCTGCTGCGAGGAGTGCAT
CCAGAAGTCTTCCACTGTGACCAGTGATGACAACGACAACGAGTACACCACAGAGCTGGAGTTG
TCGCCCTTCAGCACCATCCGCAGAGAGATGTCCACCTTTGCCTCTGTGGGGACTCACTGCTGAA
GGAACGGCTTGGTTAGCTCAGATTCCTTCGATTTTCATAGCCTGTGAAAATTTTTACTCCATAT
TTTTCCTTACAGGGGAACAATGCAAACATTTTGAAAAGCAAGTAGAGGGAGACATATTAACTAC
TCTAGAACTGATTTTGCAGATTAATATTTGTGCTCTGGGAAAAAAAAGTTTCTATTTAGTTATG
TAAGAAGAAGGCAGTCAACAGTCTCAGATCATTTTTCCTGCTCTGGTGCTAATATTTTATTCAA
GAGTCATTGCACCTTAACCATATTAATTGTTCGATTTCTTTCTTTTTCTTTCTTTTGAAAACAT
AGTCGTTGTATATTGAAGAAGGGCCTGGGATTTTGCTAGTTATTTTGTTTTTGAGTTGTGACCG
AAAGTACATTGTATCTGAAATGATTTGGTTTTGTCCCAGCCATGAAACTTAGCACCAAATAAAC
TCCCCATCCTTCTTTAACCTGACTGTCAATCTACTTTTAACCAAGACTCAATAAATTTTTAATT
GCCTTAAATACACAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_476549	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAD54655	(Get FASTA)	NCBI Sequence Viewer
	AAH87728	(Get FASTA)	NCBI Sequence Viewer
	EDM15183	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000003593
	ENSRNOP00000003593.4
GenBank Protein	Q9QYC6	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_476549 ⟸ NM_057201
- Peptide Label:	precursor
- UniProtKB:	Q9QYC6 (UniProtKB/Swiss-Prot), A6IE96 (UniProtKB/TrEMBL)
- Sequence:	show sequence MPAPGAPLSRTSRLLLLLLFKVSVSAALSFVPEPRNGTCLGESCSPLIPRRSRDAGGPRNSARD ALRVHVPREKLEAEVRGATSWDLPPPRGGDTGVIEEAAASGPLGPPTKPPGAWRWKGAQGKEPS GHLGRREPTDSQLFRQTSERGEMSSKRDEIPQGSQEHSVKTEPEPRDLFYWPRKTGQLQGSHYR PSAVHEGRTLAPPGRALPQNGSADDWVPDQGGPRRGNSTNRRVRLKNPFYPLTQESYGAYAVMC LSVVIFGTGIIGNLAVMCIVCHNYYMRSISNSLLANLAFWDFLIIFFCLPLVIFHELTKKWLLE DFSCKIVPYIEVASLGVTTFTLCALCIDRFRAATNVQMYYEMIENCSSTTAKLAVIWVGALLLA LPEVVLRQLSKEDLGFSGQAPAERCVIKISPDLPDTIYVLALTYDGARLWWYFGCYFCLPTLFT ITCSLVTARKIRKAEKASTRGNKRQIHLESQMNCTVVALTILYGFCIIPENICNIVTAYMATGV SQQTMDLLNIISQFLLFFKSCVTPVLLFCLCRPFSRAFMECCCCCCEECIQKSSTVTSDDNDNE YTTELELSPFSTIRREMSTFASVGTHC hide sequence

Ensembl Acc Id:

ENSRNOP00000003593 ⟸ ENSRNOT00000003593

Protein Domains

G-protein coupled receptors family 1 profile

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9QYC6-F1-model_v2	AlphaFold	Q9QYC6	1-603	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692907

Promoter ID:

EPDNEW_R3432

Type:

single initiation site

Name:

Gpr37_1

Description:

G protein-coupled receptor 37

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	4	51,844,316 - 51,844,376	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:619848	AgrOrtholog
BioCyc Gene	G2FUF-45463	BioCyc
Ensembl Genes	ENSRNOG00000002524	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000003593	ENTREZGENE
	ENSRNOT00000003593.7	UniProtKB/Swiss-Prot
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7320414	IMAGE-MGC_LOAD
InterPro	GPCR_Rhodpsn	UniProtKB/Swiss-Prot
	GPCR_Rhodpsn_7TM	UniProtKB/Swiss-Prot
	GPR37_orph	UniProtKB/Swiss-Prot
KEGG Report	rno:117549	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:105347	IMAGE-MGC_LOAD
NCBI Gene	117549	ENTREZGENE
PANTHER	PROSAPOSIN RECEPTOR GPR37	UniProtKB/Swiss-Prot
	PTHR46216	UniProtKB/Swiss-Prot
Pfam	7tm_1	UniProtKB/Swiss-Prot
PhenoGen	Gpr37	PhenoGen
PRINTS	GPCRRHODOPSN	UniProtKB/Swiss-Prot
	GPR37ORPHANR	UniProtKB/Swiss-Prot
PROSITE	G_PROTEIN_RECEP_F1_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000002524	RatGTEx
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/Swiss-Prot
UniProt	A6IE96	ENTREZGENE, UniProtKB/TrEMBL
	GPR37_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2004-12-14	Gpr37	G protein-coupled receptor 37		G protein-coupled receptor 37 (endothelin receptor type B-like)	Name updated	1299863	APPROVED
2002-08-07	Gpr37	G protein-coupled receptor 37 (endothelin receptor type B-like)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)