Symbol:
Cd200r1
Name:
CD200 receptor 1
RGD ID:
61837
Description:
Enables protein binding activity involved in heterotypic cell-cell adhesion. Involved in several processes, including negative regulation of interleukin-6 production; negative regulation of mononuclear cell migration; and negative regulation of neuroinflammatory response. Located in cell surface. Orthologous to human CD200R1 (CD200 receptor 1); INTERACTS WITH 17beta-estradiol; 17beta-estradiol 3-benzoate; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
antigen identified by monoclonal antibody MRC OX-2 receptor; CD200 cell surface glycoprotein receptor; cell surface glycoprotein CD200 receptor 1; cell surface glycoprotein OX2 receptor 1; Mox2r; OX102 antigen; OX2 receptor
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CD200R1 (CD200 receptor 1) HGNC
EggNOG, Ensembl, HomoloGene, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Cd200r1 (CD200 receptor 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Cd200r1 (CD200 receptor 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
LOC487977 (cell surface glycoprotein CD200 receptor 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
LOC103228312 (cell surface glycoprotein CD200 receptor 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
CD200R1L (CD200 receptor 1 like) HGNC
Ensembl, Inparanoid, OrthoDB, Panther, PhylomeDB, Treefam
Alliance orthologs 3
Mus musculus (house mouse):
Cd200r1 (CD200 receptor 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
CD200R1 (CD200 receptor 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
si:ch211-214p13.9
Alliance
DIOPT (Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
XB5962421 [provisional]
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 11 69,392,943 - 69,427,213 (-) NCBI GRCr8 mRatBN7.2 11 55,886,937 - 55,921,217 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 11 55,887,717 - 55,921,285 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 11 64,701,896 - 64,734,611 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 11 57,363,755 - 57,396,462 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 11 56,434,097 - 56,466,769 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 11 60,848,161 - 60,882,470 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 11 60,848,131 - 60,882,379 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 11 64,962,558 - 64,994,987 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 11 57,427,237 - 57,459,716 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 11 57,484,825 - 57,517,305 (-) NCBI Celera 11 55,452,759 - 55,484,520 (-) NCBI Celera Cytogenetic Map 11 q21 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Cd200r1 Rat 17beta-estradiol multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of CD200R1 mRNA CTD PMID:32741896 Cd200r1 Rat 17beta-estradiol 3-benzoate multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of CD200R1 mRNA CTD PMID:32741896 Cd200r1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of CD200R1 mRNA CTD PMID:33387578 and PMID:34747641 Cd200r1 Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression EXP 6480464 3 more ... CTD PMID:23196670 Cd200r1 Rat 4,4'-diaminodiphenylmethane increases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of CD200R1 mRNA CTD PMID:25380136 Cd200r1 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of CD200R1 mRNA CTD PMID:24780913 Cd200r1 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of CD200R1 mRNA CTD PMID:31881176 Cd200r1 Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of CD200R1 mRNA CTD PMID:28959563 Cd200r1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of CD200R1 mRNA CTD PMID:16483693 Cd200r1 Rat arsane multiple interactions ISO Cd200r1 (Mus musculus) 6480464 [sodium arsenite results in increased abundance of Arsenic] promotes the reaction [MIR129 mRNA binds to CD200R1 mRNA] more ... CTD PMID:34952004 Cd200r1 Rat arsane multiple interactions ISO CD200R1 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of CD200R1 protein CTD PMID:34952004 Cd200r1 Rat arsenic atom multiple interactions ISO Cd200r1 (Mus musculus) 6480464 [sodium arsenite results in increased abundance of Arsenic] promotes the reaction [MIR129 mRNA binds to CD200R1 mRNA] more ... CTD PMID:34952004 Cd200r1 Rat arsenic atom multiple interactions ISO CD200R1 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of CD200R1 protein CTD PMID:34952004 Cd200r1 Rat benzo[a]pyrene decreases expression ISO CD200R1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of CD200R1 mRNA CTD PMID:22316170 Cd200r1 Rat benzo[a]pyrene increases expression ISO Cd200r1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of CD200R1 mRNA CTD PMID:32417428 Cd200r1 Rat benzo[a]pyrene increases methylation ISO CD200R1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of CD200R1 exon CTD PMID:27901495 Cd200r1 Rat benzo[a]pyrene increases methylation ISO Cd200r1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased methylation of CD200R1 promoter CTD PMID:27901495 Cd200r1 Rat benzo[a]pyrene affects methylation ISO CD200R1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of CD200R1 3' UTR CTD PMID:27901495 Cd200r1 Rat bis(2-ethylhexyl) phthalate increases expression ISO Cd200r1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of CD200R1 mRNA CTD PMID:28085963 Cd200r1 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Cd200r1 (Mus musculus) 6480464 [Streptozocin co-treated with Diethylhexyl Phthalate] results in increased expression of CD200R1 mRNA CTD PMID:31606821 Cd200r1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of CD200R1 mRNA CTD PMID:25181051 Cd200r1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of CD200R1 mRNA CTD PMID:30816183 and PMID:32528016 Cd200r1 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of CD200R1 gene CTD PMID:28505145 Cd200r1 Rat carbon nanotube increases expression ISO Cd200r1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Cd200r1 Rat CGP 52608 multiple interactions ISO CD200R1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to CD200R1 gene] CTD PMID:28238834 Cd200r1 Rat choline multiple interactions ISO Cd200r1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of CD200R1 mRNA CTD PMID:20938992 Cd200r1 Rat daidzein multiple interactions ISO CD200R1 (Homo sapiens) 6480464 [daidzein co-treated with daidzin co-treated with genistin co-treated with Genistein co-treated with glycitin co-treated with glycitein] results in increased expression of CD200R1 mRNA CTD PMID:27424125 Cd200r1 Rat daidzein 7-O-beta-D-glucoside multiple interactions ISO CD200R1 (Homo sapiens) 6480464 [daidzein co-treated with daidzin co-treated with genistin co-treated with Genistein co-treated with glycitin co-treated with glycitein] results in increased expression of CD200R1 mRNA CTD PMID:27424125 Cd200r1 Rat dioxygen multiple interactions EXP 6480464 [Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in increased expression of CD200R1 mRNA CTD PMID:33729688 Cd200r1 Rat folic acid multiple interactions ISO Cd200r1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of CD200R1 mRNA CTD PMID:20938992 Cd200r1 Rat genistein multiple interactions ISO CD200R1 (Homo sapiens) 6480464 [daidzein co-treated with daidzin co-treated with genistin co-treated with Genistein co-treated with glycitin co-treated with glycitein] results in increased expression of CD200R1 mRNA CTD PMID:27424125 Cd200r1 Rat genistein 7-O-beta-D-glucoside multiple interactions ISO CD200R1 (Homo sapiens) 6480464 [daidzein co-treated with daidzin co-treated with genistin co-treated with Genistein co-treated with glycitin co-treated with glycitein] results in increased expression of CD200R1 mRNA CTD PMID:27424125 Cd200r1 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of CD200R1 mRNA CTD PMID:33387578 Cd200r1 Rat glycitein multiple interactions ISO CD200R1 (Homo sapiens) 6480464 [daidzein co-treated with daidzin co-treated with genistin co-treated with Genistein co-treated with glycitin co-treated with glycitein] results in increased expression of CD200R1 mRNA CTD PMID:27424125 Cd200r1 Rat glycitin multiple interactions ISO CD200R1 (Homo sapiens) 6480464 [daidzein co-treated with daidzin co-treated with genistin co-treated with Genistein co-treated with glycitin co-treated with glycitein] results in increased expression of CD200R1 mRNA CTD PMID:27424125 Cd200r1 Rat inulin multiple interactions ISO Cd200r1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of CD200R1 mRNA CTD PMID:36331819 Cd200r1 Rat L-methionine multiple interactions ISO Cd200r1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of CD200R1 mRNA CTD PMID:20938992 Cd200r1 Rat lidocaine increases expression EXP 6480464 Lidocaine results in increased expression of CD200R1 mRNA CTD PMID:35283115 Cd200r1 Rat lipopolysaccharide decreases expression ISO Cd200r1 (Mus musculus) 6480464 Lipopolysaccharides results in decreased expression of CD200R1 mRNA and Lipopolysaccharides results in decreased expression of CD200R1 protein CTD PMID:25890327 and PMID:34952004 Cd200r1 Rat N,N-diethyl-m-toluamide multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in increased methylation of CD200R1 gene CTD PMID:33148267 Cd200r1 Rat N-methyl-4-phenylpyridinium decreases expression ISO Cd200r1 (Mus musculus) 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of CD200R1 mRNA CTD PMID:32606391 Cd200r1 Rat N-methyl-4-phenylpyridinium multiple interactions ISO Cd200r1 (Mus musculus) 6480464 1-Methyl-4-phenylpyridinium inhibits the reaction [IL4 protein results in increased expression of CD200R1 mRNA] CTD PMID:32606391 Cd200r1 Rat N-methyl-4-phenylpyridinium increases expression EXP 6480464 1-Methyl-4-phenylpyridinium results in increased expression of CD200R1 mRNA CTD PMID:28801915 Cd200r1 Rat N-nitrosodimethylamine increases expression EXP 6480464 Dimethylnitrosamine results in increased expression of CD200R1 mRNA CTD PMID:25380136 Cd200r1 Rat nickel atom decreases expression ISO CD200R1 (Homo sapiens) 6480464 Nickel results in decreased expression of CD200R1 mRNA CTD PMID:23195993 Cd200r1 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of CD200R1 mRNA CTD PMID:25729387 Cd200r1 Rat ozone multiple interactions ISO Cd200r1 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of CD200R1 mRNA and [Air Pollutants results in increased abundance of Ozone] which results in increased expression of CD200R1 mRNA CTD PMID:34911549 Cd200r1 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of CD200R1 mRNA CTD PMID:33387578 Cd200r1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Cd200r1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of CD200R1 mRNA CTD PMID:36331819 Cd200r1 Rat permethrin multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in increased methylation of CD200R1 gene CTD PMID:33148267 Cd200r1 Rat pirinixic acid decreases expression ISO Cd200r1 (Mus musculus) 6480464 pirinixic acid results in decreased expression of CD200R1 mRNA CTD PMID:20813756 Cd200r1 Rat rotenone multiple interactions ISO Cd200r1 (Mus musculus) 6480464 [IL4 protein co-treated with Rotenone] results in increased expression of CD200R1 mRNA CTD PMID:32606391 Cd200r1 Rat S-(1,2-dichlorovinyl)-L-cysteine increases expression ISO CD200R1 (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine results in increased expression of CD200R1 mRNA CTD PMID:35811015 Cd200r1 Rat silicon dioxide decreases expression ISO Cd200r1 (Mus musculus) 6480464 Silicon Dioxide results in decreased expression of CD200R1 mRNA CTD PMID:19073995 and PMID:33720480 Cd200r1 Rat silicon dioxide increases expression ISO Cd200r1 (Mus musculus) 6480464 Silicon Dioxide results in increased expression of CD200R1 mRNA CTD PMID:29203145 Cd200r1 Rat sodium arsenite multiple interactions ISO CD200R1 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of CD200R1 protein CTD PMID:34952004 Cd200r1 Rat sodium arsenite decreases expression ISO CD200R1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of CD200R1 mRNA CTD PMID:34032870 Cd200r1 Rat sodium arsenite increases expression ISO CD200R1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of CD200R1 mRNA CTD PMID:38568856 Cd200r1 Rat sodium arsenite multiple interactions ISO Cd200r1 (Mus musculus) 6480464 [sodium arsenite results in increased abundance of Arsenic] promotes the reaction [MIR129 mRNA binds to CD200R1 mRNA] more ... CTD PMID:34952004 Cd200r1 Rat streptozocin multiple interactions ISO Cd200r1 (Mus musculus) 6480464 [Streptozocin co-treated with Diethylhexyl Phthalate] results in increased expression of CD200R1 mRNA CTD PMID:31606821 Cd200r1 Rat testosterone multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of CD200R1 mRNA CTD PMID:32741896 Cd200r1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of CD200R1 mRNA CTD PMID:34492290 Cd200r1 Rat thiram increases expression ISO CD200R1 (Homo sapiens) 6480464 Thiram results in increased expression of CD200R1 mRNA CTD PMID:38568856 Cd200r1 Rat titanium dioxide decreases expression ISO Cd200r1 (Mus musculus) 6480464 titanium dioxide results in decreased expression of CD200R1 mRNA CTD PMID:29264374 Cd200r1 Rat topotecan increases expression EXP 6480464 Topotecan results in increased expression of CD200R1 mRNA CTD PMID:25729387 Cd200r1 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of CD200R1 mRNA CTD PMID:25729387 Cd200r1 Rat tremolite asbestos increases expression ISO Cd200r1 (Mus musculus) 6480464 tremolite results in increased expression of CD200R1 mRNA CTD PMID:29279043 Cd200r1 Rat triptonide increases expression ISO Cd200r1 (Mus musculus) 6480464 triptonide results in increased expression of CD200R1 mRNA CTD PMID:33045310
17beta-estradiol (EXP) 17beta-estradiol 3-benzoate (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 3,3',4,4',5-pentachlorobiphenyl (EXP) 4,4'-diaminodiphenylmethane (EXP) 6-propyl-2-thiouracil (EXP) acetamide (EXP) acrylamide (EXP) ammonium chloride (EXP) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP) carbon nanotube (ISO) CGP 52608 (ISO) choline (ISO) daidzein (ISO) daidzein 7-O-beta-D-glucoside (ISO) dioxygen (EXP) folic acid (ISO) genistein (ISO) genistein 7-O-beta-D-glucoside (ISO) gentamycin (EXP) glycitein (ISO) glycitin (ISO) inulin (ISO) L-methionine (ISO) lidocaine (EXP) lipopolysaccharide (ISO) N,N-diethyl-m-toluamide (EXP) N-methyl-4-phenylpyridinium (EXP,ISO) N-nitrosodimethylamine (EXP) nickel atom (ISO) oxaliplatin (EXP) ozone (ISO) paracetamol (EXP) perfluorooctane-1-sulfonic acid (ISO) permethrin (EXP) pirinixic acid (ISO) rotenone (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) silicon dioxide (ISO) sodium arsenite (ISO) streptozocin (ISO) testosterone (EXP) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) topotecan (EXP) tremolite asbestos (ISO) triptonide (ISO)
Cd200r1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 11 69,392,943 - 69,427,213 (-) NCBI GRCr8 mRatBN7.2 11 55,886,937 - 55,921,217 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 11 55,887,717 - 55,921,285 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 11 64,701,896 - 64,734,611 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 11 57,363,755 - 57,396,462 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 11 56,434,097 - 56,466,769 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 11 60,848,161 - 60,882,470 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 11 60,848,131 - 60,882,379 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 11 64,962,558 - 64,994,987 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 11 57,427,237 - 57,459,716 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 11 57,484,825 - 57,517,305 (-) NCBI Celera 11 55,452,759 - 55,484,520 (-) NCBI Celera Cytogenetic Map 11 q21 NCBI
CD200R1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 112,921,205 - 112,975,103 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 112,921,205 - 112,975,103 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 112,640,052 - 112,693,950 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 114,124,222 - 114,176,627 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 3 111,049,870 - 111,102,275 (-) NCBI Celera Cytogenetic Map 3 q13.2 NCBI HuRef 3 110,025,071 - 110,077,471 (-) NCBI HuRef CHM1_1 3 112,605,064 - 112,657,469 (-) NCBI CHM1_1 T2T-CHM13v2.0 3 115,642,153 - 115,696,046 (-) NCBI T2T-CHM13v2.0
Cd200r1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 16 44,586,141 - 44,615,341 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 16 44,586,099 - 44,615,341 (+) Ensembl GRCm39 Ensembl GRCm38 16 44,765,736 - 44,794,977 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 16 44,765,736 - 44,794,978 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 16 44,765,849 - 44,795,090 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 16 44,685,124 - 44,714,310 (+) NCBI MGSCv36 mm8 Celera 16 45,131,563 - 45,160,813 (+) NCBI Celera Cytogenetic Map 16 B4 NCBI cM Map 16 29.08 NCBI
Cd200r1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955427 13,143,695 - 13,148,743 (-) NCBI ChiLan1.0 ChiLan1.0
LOC487977 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 33 17,332,986 - 17,357,301 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 33 17,436,279 - 17,460,591 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 33 17,577,294 - 17,601,611 (-) NCBI ROS_Cfam_1.0 UMICH_Zoey_3.1 33 17,381,692 - 17,406,001 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 33 17,429,158 - 17,453,448 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 33 17,978,760 - 18,003,078 (-) NCBI UU_Cfam_GSD_1.0
LOC103228312 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 22 67,862,368 - 67,902,875 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 22 67,862,783 - 67,901,872 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666041 98,576,511 - 98,618,733 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
.
Predicted Target Of
Count of predictions: 88 Count of miRNA genes: 66 Interacting mature miRNAs: 69 Transcripts: ENSRNOT00000002799 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1300147 Bp187 Blood pressure QTL 187 3.67 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 11 1 69446234 Rat 724554 Iddm17 Insulin dependent diabetes mellitus QTL 17 0.001 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 11 18976208 86241447 Rat 70180 BpQTLcluster10 Blood pressure QTL cluster 10 3.19 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 11 34918041 79918041 Rat 1581565 Pur10 Proteinuria QTL 10 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 11 44803318 82846466 Rat 4889859 Pur28 Proteinuria QTL 28 19.5 0.001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 11 45459323 75190161 Rat 8694376 Bw156 Body weight QTL 156 2.25 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 11 23280456 68280456 Rat 10755497 Bp388 Blood pressure QTL 388 2.76 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 11 19456205 76331918 Rat 10058952 Gmadr6 Adrenal mass QTL 6 2.29 0.0072 adrenal gland mass (VT:0010420) both adrenal glands wet weight to body weight ratio (CMO:0002411) 11 22959403 67959403 Rat 1300130 Rf20 Renal function QTL 20 4.44 kidney glomerulus integrity trait (VT:0010546) kidney glomerulus diameter (CMO:0001166) 11 29528418 60324829 Rat 1558659 Tescar1 Testicular tumor resistance QTL 1 3.9 testis integrity trait (VT:0010572) percentage of study population developing testis tumors during a period of time (CMO:0001261) 11 1041931 66113562 Rat 2298551 Neuinf10 Neuroinflammation QTL 10 3.7 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 11 31239134 78851519 Rat 1300135 Rf19 Renal function QTL 19 3.38 blood creatinine amount (VT:0005328) creatinine clearance (CMO:0000765) 11 40946188 82566702 Rat 2312566 Glom20 Glomerulus QTL 20 3.6 0.001 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 11 44285759 82566702 Rat 724563 Uae10 Urinary albumin excretion QTL 10 6 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 11 27672410 82846715 Rat 9589032 Epfw10 Epididymal fat weight QTL 10 9.29 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 11 23280456 68280456 Rat 724561 Plsm4 Polydactyly-luxate syndrome (PLS) morphotypes QTL 4 0.0003 forelimb integrity trait (VT:0010562) front foot phalanges count (CMO:0001947) 11 54457534 86241447 Rat 9590313 Scort20 Serum corticosterone level QTL 20 6.51 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 11 23280456 68280456 Rat 4889521 Gluco62 Glucose level QTL 62 2.82 0.001 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 11 55136729 82993457 Rat 8694424 Bw162 Body weight QTL 162 3.8 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 11 23280456 68280456 Rat 1581572 Uae35 Urinary albumin excretion QTL 35 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 11 44803318 82846466 Rat 1300110 Stl7 Serum triglyceride level QTL 7 4.64 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 11 29528418 82566702 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
111
91
90
59
25
59
6
217
96
91
45
58
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000002799 ⟹ ENSRNOP00000002799
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 11 55,887,717 - 55,921,285 (-) Ensembl Rnor_6.0 Ensembl 11 60,848,131 - 60,882,379 (-) Ensembl
RefSeq Acc Id:
NM_023953 ⟹ NP_076443
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 69,392,975 - 69,427,128 (-) NCBI mRatBN7.2 11 55,886,969 - 55,921,130 (-) NCBI Rnor_6.0 11 60,849,447 - 60,882,153 (-) NCBI Rnor_5.0 11 64,962,558 - 64,994,987 (-) NCBI RGSC_v3.4 11 57,427,237 - 57,459,716 (-) RGD Celera 11 55,452,759 - 55,484,520 (-) RGD
Sequence:
ATGCTCTGCTTTTGGAGAACTTCTCACGTAGCAGTACTCTTGATCTGGGGGGTCTTCGCGGCTGAGTCAAGTTGTCCTGATAAGAATCAAACAATGCAGAACAATTCATCAACTATGACAGAAGTTAA
hide sequence
RefSeq Acc Id:
XM_006248347 ⟹ XP_006248409
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 69,392,943 - 69,427,212 (-) NCBI mRatBN7.2 11 55,886,937 - 55,921,217 (-) NCBI Rnor_6.0 11 60,848,161 - 60,882,470 (-) NCBI Rnor_5.0 11 64,962,558 - 64,994,987 (-) NCBI
Sequence:
AAGAGAGCCAATGGGCTGAAAGTAACCCACTTAGTCAGCTTCCTCTGTCTTTGCCTCACGGCTCTGCACAGGAAATCTATTGCTGTGTCAAGTCCCAGAGAAGTTTCTTCGCTTCCAAGTTACTAGTC
hide sequence
RefSeq Acc Id:
XM_008768743 ⟹ XP_008766965
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 69,392,943 - 69,427,212 (-) NCBI mRatBN7.2 11 55,886,937 - 55,921,217 (-) NCBI Rnor_6.0 11 60,848,161 - 60,882,468 (-) NCBI
Sequence:
GAGAGCCAATGGGCTGAAAGTAACCCACTTAGTCAGCTTCCTCTGTCTTTGCCTCACGGCTCTGCACAGGAAATCTATTGCTGTGTCAAGTCCCAGAGAAGTTTCTTCGCTTCCAAGTTACTAGTCAG
hide sequence
RefSeq Acc Id:
XM_039088611 ⟹ XP_038944539
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 69,392,943 - 69,427,211 (-) NCBI mRatBN7.2 11 55,886,937 - 55,921,215 (-) NCBI
RefSeq Acc Id:
XM_039088612 ⟹ XP_038944540
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 69,392,943 - 69,427,213 (-) NCBI mRatBN7.2 11 55,886,937 - 55,921,217 (-) NCBI
RefSeq Acc Id:
NP_076443 ⟸ NM_023953
- Peptide Label:
precursor
- UniProtKB:
Q6PS97 (UniProtKB/Swiss-Prot), Q9ES58 (UniProtKB/Swiss-Prot), A6IQZ7 (UniProtKB/TrEMBL)
- Sequence:
MLCFWRTSHVAVLLIWGVFAAESSCPDKNQTMQNNSSTMTEVNTTVFVQMGKKALLCCPSISLTKVILITWTITLRGQPSCIISYKADTRETHESNCSDRSITWASTPDLAPDLQISAVALQHEGRYS
hide sequence
RefSeq Acc Id:
XP_006248409 ⟸ XM_006248347
- Peptide Label:
isoform X4
- Sequence:
MLCFWRTSHVAVLLIWGVFAAESSCPDKNQTMQNNSSTMTEVNTTVFVQMGKKALLCCPSISLTKVILITWTITLRGQPSCIISYKADTRETHESNCSDRSITWASTPDLAPDLQISAVALQHEGRYS
hide sequence
RefSeq Acc Id:
XP_008766965 ⟸ XM_008768743
- Peptide Label:
isoform X1
- Sequence:
MLCFWRTSHVAVLLIWGVFAAESSCPDKNQTMQNNSSTMTEVFVQMGKKALLCCPSISLTKVIL
hide sequence
Ensembl Acc Id:
ENSRNOP00000002799 ⟸ ENSRNOT00000002799
RefSeq Acc Id:
XP_038944540 ⟸ XM_039088612
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_038944539 ⟸ XM_039088611
- Peptide Label:
isoform X2
RGD ID: 13698146 Promoter ID: EPDNEW_R8670 Type: initiation region Name: Cd200r1_1 Description: CD200 receptor 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 11 60,882,342 - 60,882,402 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-02-18
Cd200r1
CD200 receptor 1
Mox2r
antigen identified by monoclonal antibody MRC OX-2 receptor
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-06-10
Mox2r
antigen identified by monoclonal antibody MRC OX-2 receptor
Name updated
70584 APPROVED
Note Type
Note
Reference
gene_function
receptor for OX2
61663
gene_physical_interaction
interacts with OX2
61663
gene_regulation
phosphorylated on tyrosine residues
61663
