Slc3a1 (solute carrier family 3 member 1)

Gene: Slc3a1 (solute carrier family 3 member 1) Rattus norvegicus

Analyze

Symbol:

Slc3a1

Name:

solute carrier family 3 member 1

RGD ID:

3709

Description:

Predicted to enable protein heterodimerization activity. Involved in amino acid transport. Located in vacuolar membrane. Human ortholog(s) of this gene implicated in cystinuria. Orthologous to human SLC3A1 (solute carrier family 3 member 1); PARTICIPATES IN amiloride pharmacodynamics pathway; bendroflumethiazide pharmacodynamics pathway; bumetanide pharmacodynamics pathway; INTERACTS WITH 17alpha-ethynylestradiol; 2,2,2-tetramine; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

amino acid transporter heavy chain SLC3A1; b(0,+)-type amino acid transport protein; b(0,+)-type amino acid transporter-related heavy chain; D2; NAA-TR; NBAT; neutral and basic amino acid transport protein rBAT; rBAT; solute carrier family 3 (amino acid transporter heavy chain), member 1; solute carrier family 3, member 1

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SLC3A1 (solute carrier family 3 member 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Slc3a1 (solute carrier family 3, member 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Slc3a1 (solute carrier family 3 member 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SLC3A1 (solute carrier family 3 member 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SLC3A1 (solute carrier family 3 member 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Slc3a1 (solute carrier family 3 member 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SLC3A1 (solute carrier family 3 member 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SLC3A1 (solute carrier family 3 member 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Slc3a1 (solute carrier family 3 member 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Slc3a1 (solute carrier family 3, member 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	SLC3A1 (solute carrier family 3 member 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	slc3a1 (solute carrier family 3 member 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	atgp-2	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	IMA1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Mal-A1	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Mal-A2	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Mal-A3	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Mal-A4	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Mal-A5	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Mal-A6	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Mal-A7	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Mal-A8	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Mal-B1	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Mal-B2	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	atgp-1	Alliance	DIOPT (InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	IMA2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	IMA3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	IMA4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	IMA5	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	MAL12	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	MAL32	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	slc3a1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	15,361,037 - 15,396,695 (-)	NCBI		GRCr8
mRatBN7.2	6	9,608,169 - 9,641,881 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	9,608,178 - 9,641,907 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	9,897,026 - 9,930,636 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	10,206,403 - 10,240,011 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	9,727,975 - 9,761,655 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	8,284,937 - 8,318,649 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	8,284,878 - 8,318,674 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	8,217,549 - 8,251,133 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	6	8,385,186 - 8,419,465 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	6	8,385,185 - 8,419,461 (+)	NCBI
Celera	6	9,332,403 - 9,366,072 (-)	NCBI		Celera
Cytogenetic Map	6	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autism spectrum disorder (ISO)

congenital myasthenic syndrome 22 (ISO)

cystinuria (ISO,ISS)

genetic disease (ISO)

hypotonia-cystinuria syndrome (ISO)

intellectual disability (ISO)

Lynch syndrome (ISO)

nephrocalcinosis (ISO)

primary ovarian insufficiency (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,1-dichloroethene (ISO)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (EXP,ISO)

17beta-estradiol (ISO)

2,2,2-tetramine (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3,4-methylenedioxymethamphetamine (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

ammonium chloride (EXP)

ampicillin (EXP)

atrazine (EXP)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

cadmium dichloride (EXP)

carbon nanotube (ISO)

CGP 52608 (ISO)

clopidogrel (ISO)

cyclosporin A (ISO)

dextran sulfate (ISO)

dichloroacetic acid (ISO)

diclofenac (ISO)

dorsomorphin (ISO)

entinostat (ISO)

flavonoids (EXP)

folic acid (ISO)

furan (EXP)

genistein (ISO)

gentamycin (EXP)

GW 4064 (ISO)

inulin (ISO)

L-cysteine (ISO)

L-cystine (ISO)

L-methionine (ISO)

lipopolysaccharide (ISO)

metronidazole (EXP)

neomycin (EXP)

O-methyleugenol (ISO)

ochratoxin A (EXP)

p-chloromercuribenzoic acid (ISO)

paracetamol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenobarbital (ISO)

phenylmercury acetate (ISO)

pirinixic acid (ISO)

poly(I:C) (EXP)

progesterone (ISO)

resveratrol (EXP)

rifampicin (ISO)

rotenone (EXP)

SB 431542 (ISO)

Se-methyl-L-selenocysteine (ISO)

Se-methylselenocysteine (ISO)

selenocystine (ISO)

selenomethionine (ISO)

senecionine (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

streptozocin (EXP)

tamoxifen (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

toluene (EXP)

tributylstannane (EXP)

trichloroethene (ISO)

triptonide (ISO)

vancomycin (EXP)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

amino acid transport (IBA,IDA)

aspartate transmembrane transport (ISO)

carbohydrate metabolic process (IEA)

gene expression (ISO)

L-cystine transport (ISO)

L-glutamate transmembrane transport (ISO)

maltose catabolic process (IEA)

sucrose catabolic process (IEA)

Cellular Component

apical plasma membrane (ISO)

brush border membrane (ISO)

vacuolar membrane (IDA)

Molecular Function

alpha-amylase activity (IEA)

glucan 1,4-alpha-maltotriohydrolase activity (IEA)

maltose alpha-glucosidase activity (IEA)

metal ion binding (IEA)

oligo-1,6-glucosidase activity (IEA)

protein binding (ISO)

protein heterodimerization activity (ISO)

protein-containing complex binding (IDA)

sucrose alpha-glucosidase activity (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

amiloride pharmacodynamics pathway (ISO)

bendroflumethiazide pharmacodynamics pathway (ISO)

bumetanide pharmacodynamics pathway (ISO)

chlorothiazide pharmacodynamics pathway (ISO)

chlorthalidone pharmacodynamics pathway (ISO)

cystinuria pathway (ISO)

eplerenone pharmacodynamics pathway (ISO)

etacrynic acid pharmacodynamics pathway (ISO)

furosemide pharmacodynamics pathway (ISO)

Hartnup disease pathway (ISO)

hydrochlorothiazide pharmacodynamics pathway (ISO)

hydroflumethiazide pharmacodynamics pathway (ISO)

iminoglycinuria pathway (ISO)

lysinuric protein intolerance pathway (ISO)

metolazone pharmacodynamics pathway (ISO)

spironolactone pharmacodynamics pathway (ISO)

torasemide pharmacodynamics pathway (ISO)

triamterene pharmacodynamics pathway (ISO)

trichlormethiazide pharmacodynamics pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Cystinuria caused by mutations in rBAT, a gene involved in the transport of cystine.	Calonge MJ, etal., Nat Genet. 1994 Apr;6(4):420-5.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	Membrane topology of the rat kidney neutral and basic amino acid transporter.	Mosckovitz R, etal., FASEB J. 1994 Oct;8(13):1069-74.
5.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
7.	Regional and subcellular distribution of a neutral and basic amino acid transporter in forebrain neurons containing nitric oxide synthase.	Pickel VM, etal., J Comp Neurol. 1999 Feb 22;404(4):459-72.
8.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
9.	GOA pipeline	RGD automated data pipeline
10.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
11.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
12.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
13.	Expression cloning of a Na(+)-independent neutral amino acid transporter from rat kidney.	Tate SS, etal., Proc Natl Acad Sci U S A 1992 Jan 1;89(1):1-5.
14.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
15.	Oligomeric structure of a renal cystine transporter: implications in cystinuria.	Wang Y and Tate SS, FEBS Lett. 1995 Jul 17;368(2):389-92.
16.	Cloning of a rat kidney cDNA that stimulates dibasic and neutral amino acid transport and has sequence similarity to glucosidases.	Wells RG and Hediger MA, Proc Natl Acad Sci U S A 1992 Jun 15;89(12):5596-600.

Additional References at PubMed

PMID:8052618	PMID:10506124	PMID:12167606	PMID:12865426	PMID:15489334	PMID:19056867	PMID:23376485

Genomics

Comparative Map Data

Slc3a1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	15,361,037 - 15,396,695 (-)	NCBI		GRCr8
mRatBN7.2	6	9,608,169 - 9,641,881 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	9,608,178 - 9,641,907 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	9,897,026 - 9,930,636 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	10,206,403 - 10,240,011 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	9,727,975 - 9,761,655 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	8,284,937 - 8,318,649 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	8,284,878 - 8,318,674 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	8,217,549 - 8,251,133 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	6	8,385,186 - 8,419,465 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	6	8,385,185 - 8,419,461 (+)	NCBI
Celera	6	9,332,403 - 9,366,072 (-)	NCBI		Celera
Cytogenetic Map	6	q12	NCBI

SLC3A1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	44,275,480 - 44,322,437 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	44,275,458 - 44,321,494 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	44,502,619 - 44,548,633 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	44,356,103 - 44,401,448 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	2	44,414,249 - 44,459,588	NCBI
Celera	2	44,341,552 - 44,386,916 (+)	NCBI		Celera
Cytogenetic Map	2	p21	NCBI
HuRef	2	44,239,242 - 44,284,624 (+)	NCBI		HuRef
CHM1_1	2	44,430,299 - 44,475,664 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	2	44,280,847 - 44,327,754 (+)	NCBI		T2T-CHM13v2.0

Slc3a1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	17	85,335,775 - 85,371,669 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	17	85,335,804 - 85,371,664 (+)	Ensembl		GRCm39 Ensembl
GRCm38	17	85,028,347 - 85,064,241 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	17	85,028,376 - 85,064,236 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	17	85,427,687 - 85,463,581 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	17	84,936,718 - 84,983,241 (+)	NCBI		MGSCv36	mm8
Celera	17	89,390,574 - 89,425,929 (+)	NCBI		Celera
Cytogenetic Map	17	E4	NCBI
cM Map	17	55.17	NCBI

Slc3a1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955441	11,381,441 - 11,418,025 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955441	11,381,390 - 11,418,193 (+)	NCBI	ChiLan1.0	ChiLan1.0

SLC3A1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	12	82,089,000 - 82,146,430 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2A	82,092,970 - 82,150,400 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2A	44,371,328 - 44,419,611 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2A	45,307,885 - 45,356,055 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2A	45,307,885 - 45,355,386 (+)	Ensembl	panpan1.1		panPan2

SLC3A1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	10	46,690,555 - 46,737,417 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	10	46,685,137 - 46,737,147 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	10	46,562,101 - 46,597,364 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	10	47,580,243 - 47,618,780 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	10	47,580,243 - 47,615,494 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	10	47,287,361 - 47,322,625 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	10	47,578,444 - 47,613,677 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	10	47,760,850 - 47,796,315 (+)	NCBI		UU_Cfam_GSD_1.0

Slc3a1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024406292	36,243,175 - 36,276,008 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936508	7,672,223 - 7,703,961 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936508	7,672,274 - 7,703,962 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SLC3A1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	96,157,380 - 96,215,454 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	96,157,387 - 96,201,057 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	102,312,692 - 102,371,561 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SLC3A1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	14	62,924,906 - 62,971,268 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	14	62,925,443 - 62,971,252 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666045	48,910,733 - 48,957,571 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Slc3a1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624738	25,768,573 - 25,802,716 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624738	25,762,064 - 25,802,407 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Slc3a1
166 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	38
Count of miRNA genes:	35
Interacting mature miRNAs:	37
Transcripts:	ENSRNOT00000009581
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
738023	Alc17	Alcohol consumption QTL 17	3.1	0.003	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	6	1	27574569	Rat
1354616	Despr12	Despair related QTL 12		0.0012	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	6	1	27574569	Rat
1549905	Stresp10	Stress response QTL 10	6.83	0.0066	stress-related behavior trait (VT:0010451)	number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960)	6	1	27574569	Rat
2300176	Bmd51	Bone mineral density QTL 51	11.7	0.0001	femur mineral mass (VT:0010011)	bone mineral density (CMO:0001226)	6	1	27574569	Rat
2300190	Bmd52	Bone mineral density QTL 52	11.2	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	6	1	27574569	Rat
1331743	Uae28	Urinary albumin excretion QTL 28	4.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	6	1	34235784	Rat
1578758	Tcas9	Tongue tumor susceptibility QTL 9	3.29		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	6	1	37618905	Rat
1598843	Cm63	Cardiac mass QTL 63	2.6		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	6	1	39036266	Rat
7411603	Foco13	Food consumption QTL 13	5.5	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	6	1	41223769	Rat
8552962	Pigfal16	Plasma insulin-like growth factor 1 level QTL 16	9.4		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	6	1	41223769	Rat
7411542	Bw127	Body weight QTL 127	5.5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	1	41223769	Rat
9589129	Insul24	Insulin level QTL 24	19.06	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	6	1	41223769	Rat
9589048	Scfw3	Subcutaneous fat weight QTL 3	4.57	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	6	1	41223769	Rat
2293709	Bss23	Bone structure and strength QTL 23	5.18	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	6	1	42487980	Rat
2293650	Bss31	Bone structure and strength QTL 31	5.05	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	6	1	42487980	Rat
2293656	Bss28	Bone structure and strength QTL 28	6.79	0.0001	femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	6	1	42487980	Rat
7411584	Foco4	Food consumption QTL 4	4.3	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	6	1	42838846	Rat
738024	Sach5	Saccharine consumption QTL 5	3.9	0.00039	consumption behavior trait (VT:0002069)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	6	1	43394190	Rat
2301972	Bp325	Blood pressure QTL 325	4.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	6	1	72227641	Rat
2293706	Bmd20	Bone mineral density QTL 20	4.3	0.0002	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	6	5074497	19988050	Rat
1300128	Rf16	Renal function QTL 16	3.89		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	6	5074497	34434305	Rat
1300164	Rf15	Renal function QTL 15	3.12		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	6	5074497	54641141	Rat

Markers in Region

RH132752

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	9,608,328 - 9,608,534 (-)	MAPPER	mRatBN7.2
Rnor_6.0	6	8,318,284 - 8,318,489	NCBI	Rnor6.0
Rnor_5.0	6	8,250,768 - 8,250,973	UniSTS	Rnor5.0
RGSC_v3.4	6	8,419,100 - 8,419,305	UniSTS	RGSC3.4
Celera	6	9,332,563 - 9,332,768	UniSTS
Cytogenetic Map	6	q12	UniSTS

AW535278

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	9,610,813 - 9,610,967 (-)	MAPPER	mRatBN7.2
Rnor_6.0	6	8,315,851 - 8,316,004	NCBI	Rnor6.0
Rnor_5.0	6	8,248,335 - 8,248,488	UniSTS	Rnor5.0
RGSC_v3.4	6	8,416,667 - 8,416,820	UniSTS	RGSC3.4
Celera	6	9,335,053 - 9,335,206	UniSTS
Cytogenetic Map	6	q12	UniSTS

RH139082

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	9,609,676 - 9,609,859 (-)	MAPPER	mRatBN7.2
Rnor_6.0	6	8,316,959 - 8,317,141	NCBI	Rnor6.0
Rnor_5.0	6	8,249,443 - 8,249,625	UniSTS	Rnor5.0
RGSC_v3.4	6	8,417,775 - 8,417,957	UniSTS	RGSC3.4
Celera	6	9,333,911 - 9,334,093	UniSTS
Cytogenetic Map	6	q12	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High										13
Medium	1	3					1	4	11	18	2	3	1
Low	2	8	27	11	19	11	7	7	2	4	26	8	7
Below cutoff		20	22	22		22			57		13

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_017216	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063261585	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC111831	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC078852	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473947	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000006	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M77345	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M80804	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U10110	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000009581 ⟹ ENSRNOP00000009581

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	9,608,178 - 9,641,907 (-)	Ensembl
Rnor_6.0 Ensembl	6	8,284,878 - 8,318,674 (+)	Ensembl

RefSeq Acc Id:

NM_017216 ⟹ NP_058912

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	15,361,037 - 15,394,749 (-)	NCBI
mRatBN7.2	6	9,608,169 - 9,641,881 (-)	NCBI
Rnor_6.0	6	8,284,937 - 8,318,649 (+)	NCBI
Rnor_5.0	6	8,217,549 - 8,251,133 (+)	NCBI
RGSC_v3.4	6	8,385,186 - 8,419,465 (+)	RGD
Celera	6	9,332,403 - 9,366,072 (-)	RGD

Sequence:

show sequence

CTACTGGAAAGCACTGGGAAGAGCTGCACCGGATAGACATGAATGAGGACAAAGACAAGAGAGA
CTCTATCCAGATGAGTATGAAGGGATGCCGGACGAATAACGGGTTTGTCCAAAATGAAGACATC
CAGGAGCAGGACCCAGACTCCAGGGACACTCCACAGTCCAACGCTGTTAGTATCCCTGCTCCAG
AGGAGCCTCAACTAAAGGTGGTGCGGCCCTATGCAGGGATGCCCAAGGAGGTGCTGTTCCAGTT
CTCTGGCCAGGCTCGCTACCGGGTGCCTCGGGAGATCCTCTTCTGGCTCACCGTGGTCTCCGTG
TTCCTGCTCATCGGAGCCACCATAGCCATCATCATCATCTCTCCAAAATGCCTTGACTGGTGGC
AGGCAGGTCCCATGTACCAGATCTACCCGAGGTCTTTTAAGGACAGTGACAAGGATGGGAATGG
AGACCTGAAAGGTATCCAAGAGAAGCTGGACTACATCACTGCTTTAAATATAAAGACCATTTGG
ATCACTTCCTTTTATAAATCACCTTTGAAAGATTTTAGATATGCTGTTGAAGATTTCAAAGAAA
TTGACCCTATTTTCGGAACAATGAAAGATTTTGAGAATTTGGTTGCTGCGGTCCATGACAAAGG
TTTAAAATTAATAATTGACTTCATACCAAACCACACCAGTGACAAACATCCTTGGTTCCAATCG
AGTAGGACACGGAGCGGGAAATACACTGATTATTACATCTGGCACAACTGTACCCACGCCAACG
GTGTAACCACCCCTCCCAACAACTGGCTGAGCGTGTATGGAAACTCCAGCTGGCAGTTTGATGA
AGAACGAAAGCAATGTTATTTTCACCAGTTTTTGAAAGAGCAGCCGGATCTTAATTTCCGAAAT
CCTGCTGTTCAAGAAGAAATAAAGGAAATAATAAAGTTCTGGCTCTCAAAGGGTGTTGATGGGT
TTAGTTTCGATGCAGTTAAATTTCTTCTGGAAGCAAAGGACCTGAGAAATGAAATCCAAGTAAA
TACATCCCAAATTCCGGACACAGTGACCCGCTACTCAGAACTGTACCACGACTTCACCACTACC
CAGGTGGGAATGCATGACCTTGTCCGGGACTTCCGGCAGACCATGAACCAGTTCAGCCGGGAGC
CTGGCAGATACCGGTTCATGGGGACGGAGGTGTCAGCTGAGAGCACCGAGAGGACCATGGTGTA
CTATGGCCTGTCATTTATCCAGGAAGCTGACTTCCCTTTCAACAAGTACTTAGCCACACTAGAC
ACTCTTTCCGGGCATACTGTGTACGAAGCTATCACATCCTGGATGGAAAACATGCCGGAAGGAA
AATGGCCCAACTGGATGATTGGCGGACCAGAGACTTCTCGGCTGACTTCTCGAGTAGGGAGCGA
GTATGTCAATGCCATGAACATGCTTCTGTTCACACTCCCAGGAACCCCCATAACTTACTATGGG
GAAGAAATAGGGATGGGAGATATTTCCATTACAAACCTCAACGAGCGCTATGACACTAACGCCC
TTCTCTCCAAGTCACCGATGCAGTGGGACAATAGTTCAAATGCGGGGTTTACTGAGGCCAACCA
CACCTGGCTCCCCACAAACTCTGACTACCACACAGTGAATGTGGATGTCCAAAAAACCCAGCCG
AGCTCAGCACTGAGGCTATATCAGGATCTGAGTCTACTCCATGCCAGAGAGCTGCTTCTCAGCA
GAGGCTGGTTTTGCCTTTTGAGGGACGACAATCACTCTGTTGTGTACACCAGGGAGCTGGATGG
CATAGATAAAGTCTTCCTTGTGGTTCTGAATTTTGGAGAATCATCAACTGTGCTAAATCTACAG
GAAACTATTTCAGATGTTCCTACAAAACTGAGAATAAGATTAAGTACCAATCCAGCCTCCAAAG
GCAGTGATGTTGATACCCATGCCGTTTCTCTGGAGAAGGGAGAGGGGCTCATCTTGGAACACAG
CATGAAGACTCTCCTCCATCACCAGAAAGCTTTCAGAGACAAATGTTTTATTTCCAACCGTGCA
TGCTACTCCAGCGTGCTGGACCTTCTGTATAGCTCGTGCTAGGCAGCTCTGTAAGAGGTGGCCA
CCCTGCGTCTGGTATGCTTGCCATCACACATGCAAGGGCCTCAGGAATGGCATCAGTTCTTAGA
TATTTCTGTAGCACGAATGCATTGTTTTAGGTAAGATTCTCAAATGTTTGGAAGGACAATAAAA
TGTTTAAAAGATTACCCCCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
A

hide sequence

RefSeq Acc Id:

XM_063261585 ⟹ XP_063117655

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	15,361,037 - 15,396,695 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_058912	(Get FASTA)	NCBI Sequence Viewer
	XP_063117655	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA20394	(Get FASTA)	NCBI Sequence Viewer
	AAA41544	(Get FASTA)	NCBI Sequence Viewer
	AAA73144	(Get FASTA)	NCBI Sequence Viewer
	AAH78852	(Get FASTA)	NCBI Sequence Viewer
	EDM02679	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000009581
	ENSRNOP00000009581.2
	ENSRNOP00055026470
	ENSRNOP00060005457
	ENSRNOP00065009246
GenBank Protein	Q64319	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_058912 ⟸ NM_017216

- UniProtKB:

Q62672 (UniProtKB/Swiss-Prot), Q64319 (UniProtKB/Swiss-Prot), A6H9H4 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MNEDKDKRDSIQMSMKGCRTNNGFVQNEDIQEQDPDSRDTPQSNAVSIPAPEEPQLKVVRPYAG
MPKEVLFQFSGQARYRVPREILFWLTVVSVFLLIGATIAIIIISPKCLDWWQAGPMYQIYPRSF
KDSDKDGNGDLKGIQEKLDYITALNIKTIWITSFYKSPLKDFRYAVEDFKEIDPIFGTMKDFEN
LVAAVHDKGLKLIIDFIPNHTSDKHPWFQSSRTRSGKYTDYYIWHNCTHANGVTTPPNNWLSVY
GNSSWQFDEERKQCYFHQFLKEQPDLNFRNPAVQEEIKEIIKFWLSKGVDGFSFDAVKFLLEAK
DLRNEIQVNTSQIPDTVTRYSELYHDFTTTQVGMHDLVRDFRQTMNQFSREPGRYRFMGTEVSA
ESTERTMVYYGLSFIQEADFPFNKYLATLDTLSGHTVYEAITSWMENMPEGKWPNWMIGGPETS
RLTSRVGSEYVNAMNMLLFTLPGTPITYYGEEIGMGDISITNLNERYDTNALLSKSPMQWDNSS
NAGFTEANHTWLPTNSDYHTVNVDVQKTQPSSALRLYQDLSLLHARELLLSRGWFCLLRDDNHS
VVYTRELDGIDKVFLVVLNFGESSTVLNLQETISDVPTKLRIRLSTNPASKGSDVDTHAVSLEK
GEGLILEHSMKTLLHHQKAFRDKCFISNRACYSSVLDLLYSSC

hide sequence

RefSeq Acc Id:

ENSRNOP00000009581 ⟸ ENSRNOT00000009581

RefSeq Acc Id:	XP_063117655 ⟸ XM_063261585
- Peptide Label:	isoform X1

Protein Domains

Glycosyl hydrolase family 13 catalytic

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q64319-F1-model_v2	AlphaFold	Q64319	1-683	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13694379

Promoter ID:

EPDNEW_R4904

Type:

initiation region

Name:

Slc3a1_1

Description:

solute carrier family 3 member 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	6	8,284,903 - 8,284,963	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:3709	AgrOrtholog
BioCyc Gene	G2FUF-38653	BioCyc
Ensembl Genes	ENSRNOG00000007006	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOG00055019152	UniProtKB/Swiss-Prot
	ENSRNOG00060004289	UniProtKB/Swiss-Prot
	ENSRNOG00065007957	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000009581	ENTREZGENE
	ENSRNOT00000009581.5	UniProtKB/Swiss-Prot
	ENSRNOT00055032680	UniProtKB/Swiss-Prot
	ENSRNOT00060007198	UniProtKB/Swiss-Prot
	ENSRNOT00065012552	UniProtKB/Swiss-Prot
Gene3D-CATH	2.60.40.1180	UniProtKB/Swiss-Prot
	Glycosidases	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Golgi alpha-mannosidase II	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7110514	IMAGE-MGC_LOAD
InterPro	Glyco_hydro_13_cat_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Glyco_hydro_b	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Glycoside_hydrolase_SF	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	O16G_dom_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:29484	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:93505	IMAGE-MGC_LOAD
NCBI Gene	29484	ENTREZGENE
PANTHER	ALPHA-AMYLASE FAMILY MEMBER	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	NEUTRAL AND BASIC AMINO ACID TRANSPORT PROTEIN RBAT	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Alpha-amylase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Slc3a1	PhenoGen
RatGTEx	ENSRNOG00000007006	RatGTEx
	ENSRNOG00055019152	RatGTEx
	ENSRNOG00060004289	RatGTEx
	ENSRNOG00065007957	RatGTEx
SMART	Aamy	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	(Trans)glycosidases	UniProtKB/TrEMBL, UniProtKB/Swiss-Prot
TIGR	TC207343
UniProt	A6H9H4	ENTREZGENE, UniProtKB/TrEMBL
	Q62672	ENTREZGENE
	Q64319	ENTREZGENE, UniProtKB/Swiss-Prot
UniProt Secondary	Q62672	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-02-24	Slc3a1	solute carrier family 3 member 1	Slc3a1	solute carrier family 3 (amino acid transporter heavy chain), member 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2015-03-16	Slc3a1	solute carrier family 3 (amino acid transporter heavy chain), member 1	Slc3a1	solute carrier family 3, member 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2003-04-09	Slc3a1	solute carrier family 3, member 1		solute carrier family 3, member 1	Name updated	629478	APPROVED
2002-06-10	Slc3a1	solute carrier family 3, member 1			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_domains	appears to have a single transmembrane domain	70013
gene_expression	mRNA expressed specifically in kidney and intestine	70013
gene_protein	putative protein is of 78 kDa	70013

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Imported Annotations - SMPDB

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Imported Annotations - SMPDB